Symbol:
Wasl
Name:
WASP like actin nucleation promoting factor
RGD ID:
735144
Description:
Enables cytoskeletal protein binding activity and identical protein binding activity. Involved in several processes, including plasma membrane tubulation; positive regulation of cellular component organization; and postsynaptic actin cytoskeleton organization. Located in Golgi membrane; cell leading edge; and cytoplasmic vesicle. Is active in glutamatergic synapse and postsynapse. Orthologous to human WASL (WASP like actin nucleation promoting factor); PARTICIPATES IN ephrin - ephrin receptor bidirectional signaling axis; epidermal growth factor/neuregulin signaling pathway; platelet-derived growth factor signaling pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
actin nucleation-promoting factor WASL; hypothetical protein LOC685687; IQ motif and ubiquitin domain containing; Iqub; LOC682507; MGC116166; N-WASP; neural Wiskott-Aldrich syndrome protein; similar to Neural Wiskott-Aldrich syndrome protein (N-WASP); TRS4; Wiskott-Aldrich syndrome-like; Wiskott-Aldrich syndrome-like (human)
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 54,049,081 - 54,097,653 (-) NCBI GRCr8 mRatBN7.2 4 53,083,536 - 53,132,061 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 53,083,536 - 53,132,022 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 58,070,385 - 58,118,872 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 53,977,276 - 54,025,972 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 52,411,758 - 52,460,472 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 51,677,722 - 51,726,212 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 51,677,722 - 51,726,212 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 51,455,978 - 51,504,496 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 51,063,710 - 51,092,848 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 51,294,288 - 51,323,128 (-) NCBI Celera 4 48,249,249 - 48,297,692 (-) NCBI Celera Cytogenetic Map 4 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Wasl Rat 1,2-dimethylhydrazine decreases expression ISO Wasl (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of WASL mRNA CTD PMID:22206623 Wasl Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of WASL mRNA CTD PMID:32145629 Wasl Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO WASL (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Wasl Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Wasl (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of WASL mRNA CTD PMID:21570461 Wasl Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of WASL mRNA CTD PMID:33387578 Wasl Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of WASL mRNA CTD PMID:34747641 Wasl Rat 2,4,6-tribromophenol decreases expression ISO WASL (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Wasl Rat 2-hydroxypropanoic acid decreases expression ISO WASL (Homo sapiens) 6480464 Lactic Acid results in decreased expression of WASL mRNA CTD PMID:30851411 Wasl Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO WASL (Homo sapiens) 6480464 tetrabromobisphenol A results in decreased expression of WASL protein CTD PMID:31675489 Wasl Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of WASL mRNA CTD PMID:24780913 Wasl Rat aflatoxin B1 decreases methylation ISO WASL (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of WASL gene CTD PMID:27153756 Wasl Rat Aflatoxin B2 alpha increases methylation ISO WASL (Homo sapiens) 6480464 aflatoxin B2 results in increased methylation of WASL intron CTD PMID:30157460 Wasl Rat antirheumatic drug increases expression ISO WASL (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of WASL mRNA CTD PMID:24449571 Wasl Rat arsane multiple interactions ISO WASL (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of WASL mRNA CTD PMID:39836092 Wasl Rat arsenic atom multiple interactions ISO WASL (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of WASL mRNA CTD PMID:39836092 Wasl Rat arsenite(3-) decreases methylation ISO WASL (Homo sapiens) 6480464 arsenite results in decreased methylation of WASL promoter CTD PMID:23974009 Wasl Rat arsenite(3-) increases expression ISO Wasl (Mus musculus) 6480464 arsenite results in increased expression of WASL protein CTD PMID:37955338 Wasl Rat benzo[a]pyrene multiple interactions ISO Wasl (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of WASL mRNA CTD PMID:27858113 Wasl Rat benzo[a]pyrene increases methylation ISO WASL (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of WASL promoter CTD PMID:27901495 Wasl Rat benzo[b]fluoranthene multiple interactions ISO Wasl (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of WASL mRNA CTD PMID:27858113 Wasl Rat bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [Diethylhexyl Phthalate co-treated with Genistein] results in increased expression of WASL mRNA CTD PMID:32533902 Wasl Rat bis(2-ethylhexyl) phthalate decreases expression ISO Wasl (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of WASL mRNA CTD PMID:33754040 Wasl Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of WASL mRNA CTD PMID:25181051 Wasl Rat bisphenol A decreases expression ISO WASL (Homo sapiens) 6480464 bisphenol A results in decreased expression of WASL protein CTD PMID:31675489 Wasl Rat bisphenol A affects methylation ISO WASL (Homo sapiens) 6480464 bisphenol A affects the methylation of WASL gene CTD PMID:31601247 Wasl Rat bisphenol A decreases expression ISO Wasl (Mus musculus) 6480464 bisphenol A results in decreased expression of WASL mRNA CTD PMID:33221593 Wasl Rat bisphenol AF increases expression ISO WASL (Homo sapiens) 6480464 bisphenol AF results in increased expression of WASL protein CTD PMID:34186270 Wasl Rat Bisphenol B increases expression ISO WASL (Homo sapiens) 6480464 bisphenol B results in increased expression of WASL protein CTD PMID:34186270 Wasl Rat buspirone increases expression EXP 6480464 Buspirone results in increased expression of WASL mRNA CTD PMID:24136188 Wasl Rat cadmium atom multiple interactions ISO WASL (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of WASL mRNA CTD PMID:35301059 Wasl Rat cadmium dichloride multiple interactions ISO WASL (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of WASL mRNA CTD PMID:35301059 Wasl Rat chloroprene increases expression EXP 6480464 Chloroprene results in increased expression of WASL mRNA CTD PMID:23125180 Wasl Rat chromium(6+) multiple interactions ISO WASL (Homo sapiens) 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in increased expression of WASL mRNA CTD PMID:38479592 Wasl Rat chrysene multiple interactions ISO Wasl (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of WASL mRNA CTD PMID:27858113 Wasl Rat ciguatoxin CTX1B affects expression ISO Wasl (Mus musculus) 6480464 Ciguatoxins affects the expression of WASL mRNA CTD PMID:18353800 Wasl Rat copper(II) sulfate increases expression ISO WASL (Homo sapiens) 6480464 Copper Sulfate results in increased expression of WASL mRNA CTD PMID:19549813 Wasl Rat curcumin increases expression ISO Wasl (Mus musculus) 6480464 Curcumin results in increased expression of WASL mRNA CTD PMID:18200517 Wasl Rat cyclosporin A increases methylation ISO WASL (Homo sapiens) 6480464 Cyclosporine results in increased methylation of WASL promoter CTD PMID:27989131 Wasl Rat decabromodiphenyl ether decreases expression ISO WASL (Homo sapiens) 6480464 decabromobiphenyl ether results in decreased expression of WASL protein CTD PMID:31675489 Wasl Rat dextran sulfate increases expression ISO Wasl (Mus musculus) 6480464 Dextran Sulfate results in increased expression of WASL protein CTD PMID:35362542 Wasl Rat dextran sulfate multiple interactions ISO Wasl (Mus musculus) 6480464 evodiamine inhibits the reaction [Dextran Sulfate results in increased expression of WASL protein] CTD PMID:35362542 Wasl Rat Dibutyl phosphate affects expression ISO WASL (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of WASL mRNA CTD PMID:37042841 Wasl Rat dibutyl phthalate increases expression ISO Wasl (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of WASL mRNA CTD PMID:17361019 and PMID:21266533 Wasl Rat dimethylarsinous acid decreases expression ISO WASL (Homo sapiens) 6480464 dimethylarsinous acid results in decreased expression of WASL mRNA CTD PMID:23487506 Wasl Rat dioxygen increases expression ISO Wasl (Mus musculus) 6480464 Oxygen deficiency results in increased expression of WASL mRNA CTD PMID:20880076 Wasl Rat diuron increases expression EXP 6480464 Diuron results in increased expression of WASL mRNA CTD PMID:21551480 Wasl Rat dorsomorphin multiple interactions ISO WASL (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of WASL mRNA CTD PMID:27188386 Wasl Rat doxorubicin decreases expression ISO WASL (Homo sapiens) 6480464 Doxorubicin results in decreased expression of WASL mRNA CTD PMID:29803840 Wasl Rat epoxiconazole increases expression ISO Wasl (Mus musculus) 6480464 epoxiconazole results in increased expression of WASL mRNA CTD PMID:35436446 Wasl Rat ethanol affects splicing ISO Wasl (Mus musculus) 6480464 Ethanol affects the splicing of WASL mRNA CTD PMID:30319688 Wasl Rat Evodiamine multiple interactions ISO Wasl (Mus musculus) 6480464 evodiamine inhibits the reaction [Dextran Sulfate results in increased expression of WASL protein] CTD PMID:35362542 Wasl Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of WASL mRNA CTD PMID:20566332 and PMID:24136188 Wasl Rat folic acid decreases expression ISO Wasl (Mus musculus) 6480464 Folic Acid results in decreased expression of WASL mRNA CTD PMID:25629700 Wasl Rat FR900359 decreases phosphorylation ISO WASL (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of WASL protein CTD PMID:37730182 Wasl Rat gamma-hexachlorocyclohexane increases expression EXP 6480464 Hexachlorocyclohexane results in increased expression of WASL mRNA CTD PMID:17785943 Wasl Rat genistein multiple interactions EXP 6480464 [Diethylhexyl Phthalate co-treated with Genistein] results in increased expression of WASL mRNA CTD PMID:32533902 Wasl Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of WASL mRNA CTD PMID:33387578 Wasl Rat irinotecan decreases expression ISO WASL (Homo sapiens) 6480464 Irinotecan analog results in decreased expression of WASL mRNA CTD PMID:18927307 Wasl Rat isotretinoin decreases expression ISO WASL (Homo sapiens) 6480464 Isotretinoin results in decreased expression of WASL mRNA CTD PMID:20436886 Wasl Rat ivermectin decreases expression ISO WASL (Homo sapiens) 6480464 Ivermectin results in decreased expression of WASL protein CTD PMID:32959892 Wasl Rat levofloxacin increases expression EXP 6480464 Levofloxacin results in increased expression of WASL mRNA CTD PMID:24136188 Wasl Rat MeIQx increases expression ISO WASL (Homo sapiens) 6480464 2-amino-3 more ... CTD PMID:20816883 Wasl Rat Mesaconitine decreases expression EXP 6480464 mesaconitine results in decreased expression of WASL protein CTD PMID:37182599 Wasl Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of WASL mRNA CTD PMID:30467583 Wasl Rat methyl methanesulfonate increases expression ISO WASL (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of WASL mRNA CTD PMID:23649840 Wasl Rat methylmercury chloride increases expression ISO WASL (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of WASL mRNA CTD PMID:23179753 and PMID:26272509 Wasl Rat methylmercury chloride multiple interactions ISO WASL (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of WASL mRNA CTD PMID:27188386 Wasl Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of WASL mRNA CTD PMID:24136188 Wasl Rat ozone increases expression EXP 6480464 Ozone results in increased expression of WASL mRNA CTD PMID:35737395 Wasl Rat paracetamol increases expression ISO WASL (Homo sapiens) 6480464 Acetaminophen results in increased expression of WASL mRNA CTD PMID:29067470 Wasl Rat phenobarbital affects expression ISO Wasl (Mus musculus) 6480464 Phenobarbital affects the expression of WASL mRNA CTD PMID:23091169 Wasl Rat phenylephrine multiple interactions EXP 6480464 ABL1 protein affects the reaction [Phenylephrine promotes the reaction [CRK protein binds to WASL protein]] CTD PMID:17615370 Wasl Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of WASL mRNA CTD PMID:12832660 Wasl Rat potassium dichromate increases expression ISO WASL (Homo sapiens) 6480464 Potassium Dichromate results in increased expression of WASL protein CTD PMID:23718831 Wasl Rat rac-lactic acid decreases expression ISO WASL (Homo sapiens) 6480464 Lactic Acid results in decreased expression of WASL mRNA CTD PMID:30851411 Wasl Rat resveratrol decreases expression EXP 6480464 resveratrol results in decreased expression of WASL mRNA CTD PMID:25905778 Wasl Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of WASL mRNA CTD PMID:19013527 Wasl Rat SB 431542 multiple interactions ISO WASL (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of WASL mRNA CTD PMID:27188386 Wasl Rat sodium arsenite increases expression ISO WASL (Homo sapiens) 6480464 sodium arsenite results in increased expression of WASL mRNA CTD PMID:20886546 and PMID:38568856 Wasl Rat sodium arsenite multiple interactions ISO WASL (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of WASL mRNA CTD PMID:39836092 Wasl Rat sodium arsenite decreases expression ISO Wasl (Mus musculus) 6480464 sodium arsenite results in decreased expression of WASL protein CTD PMID:29044176 Wasl Rat testosterone enanthate affects expression ISO WASL (Homo sapiens) 6480464 testosterone enanthate affects the expression of WASL mRNA CTD PMID:17440010 Wasl Rat tetraphene multiple interactions ISO Wasl (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of WASL mRNA CTD PMID:27858113 Wasl Rat thimerosal decreases expression ISO WASL (Homo sapiens) 6480464 Thimerosal results in decreased expression of WASL mRNA CTD PMID:27188386 Wasl Rat thiram increases expression ISO WASL (Homo sapiens) 6480464 Thiram results in increased expression of WASL mRNA CTD PMID:38568856 Wasl Rat titanium dioxide decreases methylation ISO Wasl (Mus musculus) 6480464 titanium dioxide results in decreased methylation of WASL promoter CTD PMID:35295148 Wasl Rat uranium atom affects expression ISO WASL (Homo sapiens) 6480464 Uranium affects the expression of WASL mRNA CTD PMID:15672453 Wasl Rat urethane increases expression ISO WASL (Homo sapiens) 6480464 Urethane results in increased expression of WASL mRNA CTD PMID:28818685 Wasl Rat valproic acid decreases methylation ISO WASL (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of WASL gene CTD PMID:29154799 Wasl Rat valproic acid affects expression ISO WASL (Homo sapiens) 6480464 Valproic Acid affects the expression of WASL mRNA CTD PMID:25979313 Wasl Rat vorinostat decreases expression ISO WASL (Homo sapiens) 6480464 vorinostat results in decreased expression of WASL mRNA CTD PMID:27188386
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
1,2-dimethylhydrazine (ISO) 17beta-estradiol (EXP) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (ISO) 2-hydroxypropanoic acid (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) antirheumatic drug (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) buspirone (EXP) cadmium atom (ISO) cadmium dichloride (ISO) chloroprene (EXP) chromium(6+) (ISO) chrysene (ISO) ciguatoxin CTX1B (ISO) copper(II) sulfate (ISO) curcumin (ISO) cyclosporin A (ISO) decabromodiphenyl ether (ISO) dextran sulfate (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) dimethylarsinous acid (ISO) dioxygen (ISO) diuron (EXP) dorsomorphin (ISO) doxorubicin (ISO) epoxiconazole (ISO) ethanol (ISO) Evodiamine (ISO) flutamide (EXP) folic acid (ISO) FR900359 (ISO) gamma-hexachlorocyclohexane (EXP) genistein (EXP) gentamycin (EXP) irinotecan (ISO) isotretinoin (ISO) ivermectin (ISO) levofloxacin (EXP) MeIQx (ISO) Mesaconitine (EXP) methapyrilene (EXP) methyl methanesulfonate (ISO) methylmercury chloride (ISO) nefazodone (EXP) ozone (EXP) paracetamol (ISO) phenobarbital (ISO) phenylephrine (EXP) pirinixic acid (EXP) potassium dichromate (ISO) rac-lactic acid (ISO) resveratrol (EXP) rotenone (EXP) SB 431542 (ISO) sodium arsenite (ISO) testosterone enanthate (ISO) tetraphene (ISO) thimerosal (ISO) thiram (ISO) titanium dioxide (ISO) uranium atom (ISO) urethane (ISO) valproic acid (ISO) vorinostat (ISO)
1.
Abl silencing inhibits CAS-mediated process and constriction in resistance arteries.
Anfinogenova Y, etal., Circ Res. 2007 Aug 17;101(4):420-8. Epub 2007 Jul 5.
2.
Cdc42 interaction with N-WASP and Toca-1 regulates membrane tubulation, vesicle formation and vesicle motility: implications for endocytosis.
Bu W, etal., PLoS One. 2010 Aug 13;5(8):e12153. doi: 10.1371/journal.pone.0012153.
3.
EspFU is a translocated EHEC effector that interacts with Tir and N-WASP and promotes Nck-independent actin assembly.
Campellone KG, etal., Dev Cell. 2004 Aug;7(2):217-28. doi: 10.1016/j.devcel.2004.07.004.
4.
Repetitive N-WASP-binding elements of the enterohemorrhagic Escherichia coli effector EspF(U) synergistically activate actin assembly.
Campellone KG, etal., PLoS Pathog. 2008 Oct;4(10):e1000191. doi: 10.1371/journal.ppat.1000191. Epub 2008 Oct 31.
5.
Tyrosine phosphorylation controls cortactin binding to two enterohaemorrhagic Escherichia coli effectors: Tir and EspFu/TccP.
Cantarelli VV, etal., Cell Microbiol. 2007 Jul;9(7):1782-95. doi: 10.1111/j.1462-5822.2007.00913.x. Epub 2007 Apr 19.
6.
Cytosol-derived proteins are sufficient for Arp2/3 recruitment and ARF/coatomer-dependent actin polymerization on Golgi membranes.
Chen JL, etal., FEBS Lett. 2004 May 21;566(1-3):281-6.
7.
N-WASP and cortactin are involved in invadopodium-dependent chemotaxis to EGF in breast tumor cells.
Desmarais V, etal., Cell Motil Cytoskeleton. 2009 Jun;66(6):303-16. doi: 10.1002/cm.20361.
8.
Identification of N-WASP homologs in human and rat brain.
Fukuoka M, etal., Gene 1997 Sep 1;196(1-2):43-8.
9.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
10.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
11.
NOSTRIN functions as a homotrimeric adaptor protein facilitating internalization of eNOS.
Icking A, etal., J Cell Sci. 2005 Nov 1;118(Pt 21):5059-69. Epub 2005 Oct 18.
12.
Syndapins integrate N-WASP in receptor-mediated endocytosis.
Kessels MM and Qualmann B, EMBO J 2002 Nov 15;21(22):6083-94.
13.
SPIN90/WISH interacts with PSD-95 and regulates dendritic spinogenesis via an N-WASP-independent mechanism.
Lee S, etal., EMBO J. 2006 Oct 18;25(20):4983-95. Epub 2006 Sep 21.
14.
Focal adhesion kinase-Tyr407 and -Tyr397 exhibit antagonistic effects on blood-testis barrier dynamics in the rat.
Lie PP, etal., Proc Natl Acad Sci U S A. 2012 Jul 31;109(31):12562-7. doi: 10.1073/pnas.1202316109. Epub 2012 Jul 12.
15.
Erk/Src phosphorylation of cortactin acts as a switch on-switch off mechanism that controls its ability to activate N-WASP.
Martinez-Quiles N, etal., Mol Cell Biol. 2004 Jun;24(12):5269-80. doi: 10.1128/MCB.24.12.5269-5280.2004.
16.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
17.
Induction of filopodium formation by a WASP-related actin-depolymerizing protein N-WASP.
Miki H, etal., Nature. 1998 Jan 1;391(6662):93-6.
18.
SNX18 shares a redundant role with SNX9 and modulates endocytic trafficking at the plasma membrane.
Park J, etal., J Cell Sci. 2010 May 15;123(Pt 10):1742-50. doi: 10.1242/jcs.064170. Epub 2010 Apr 27.
19.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
20.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
21.
Integration of multiple signals through cooperative regulation of the N-WASP-Arp2/3 complex.
Prehoda KE, etal., Science. 2000 Oct 27;290(5492):801-6.
22.
GOA pipeline
RGD automated data pipeline
23.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
24.
The pathogen protein EspF(U) hijacks actin polymerization using mimicry and multivalency.
Sallee NA, etal., Nature. 2008 Aug 21;454(7207):1005-8. doi: 10.1038/nature07170. Epub 2008 Jul 23.
25.
The essential role of profilin in the assembly of actin for microspike formation.
Suetsugu S, etal., EMBO J. 1998 Nov 16;17(22):6516-26.
26.
Synthetic triterpenoids target the Arp2/3 complex and inhibit branched actin polymerization.
To C, etal., J Biol Chem. 2010 Sep 3;285(36):27944-57. doi: 10.1074/jbc.M110.103036. Epub 2010 Jun 21.
27.
Structure of the N-WASP EVH1 domain-WIP complex: insight into the molecular basis of Wiskott-Aldrich Syndrome.
Volkman BF, etal., Cell 2002 Nov 15;111(4):565-76.
28.
N-wasp and the arp2/3 complex are critical regulators of actin in the development of dendritic spines and synapses.
Wegner AM, etal., J Biol Chem. 2008 Jun 6;283(23):15912-20. Epub 2008 Apr 21.
Wasl Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 54,049,081 - 54,097,653 (-) NCBI GRCr8 mRatBN7.2 4 53,083,536 - 53,132,061 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 53,083,536 - 53,132,022 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 58,070,385 - 58,118,872 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 53,977,276 - 54,025,972 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 52,411,758 - 52,460,472 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 51,677,722 - 51,726,212 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 51,677,722 - 51,726,212 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 51,455,978 - 51,504,496 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 51,063,710 - 51,092,848 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 51,294,288 - 51,323,128 (-) NCBI Celera 4 48,249,249 - 48,297,692 (-) NCBI Celera Cytogenetic Map 4 q22 NCBI
WASL Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 7 123,681,943 - 123,749,003 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 7 123,681,943 - 123,749,003 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 7 123,321,997 - 123,389,057 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 7 123,109,233 - 123,176,352 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 7 122,915,949 - 122,983,067 NCBI Celera 7 118,125,741 - 118,192,900 (-) NCBI Celera Cytogenetic Map 7 q31.32 NCBI HuRef 7 117,685,121 - 117,752,321 (-) NCBI HuRef CHM1_1 7 123,255,296 - 123,322,481 (-) NCBI CHM1_1 T2T-CHM13v2.0 7 124,998,697 - 125,065,742 (-) NCBI T2T-CHM13v2.0 CRA_TCAGchr7v2 7 122,710,608 - 122,777,749 (-) NCBI
Wasl Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 24,613,809 - 24,665,185 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 24,613,804 - 24,665,008 (-) Ensembl GRCm39 Ensembl GRCm38 6 24,613,810 - 24,664,995 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 24,613,805 - 24,665,009 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 24,563,810 - 24,614,995 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 24,563,815 - 24,614,981 (-) NCBI MGSCv36 mm8 Celera 6 24,624,846 - 24,676,054 (-) NCBI Celera Cytogenetic Map 6 A3.1 NCBI cM Map 6 11.28 NCBI
Wasl Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955479 5,166,393 - 5,200,512 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955479 5,167,851 - 5,200,512 (-) NCBI ChiLan1.0 ChiLan1.0
WASL Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 6 160,537,416 - 160,606,388 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 7 12,550,222 - 12,614,145 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 7 115,675,170 - 115,741,498 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 7 128,357,909 - 128,388,395 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 7 128,360,495 - 128,385,393 (-) Ensembl panpan1.1 panPan2
WASL Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 14 11,828,298 - 11,901,190 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 14 11,828,687 - 11,899,788 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 14 11,512,373 - 11,585,271 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 14 11,605,958 - 11,678,914 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 14 11,606,343 - 11,678,904 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 14 11,795,524 - 11,868,439 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 14 11,533,495 - 11,606,377 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 14 11,774,079 - 11,846,981 (+) NCBI UU_Cfam_GSD_1.0
Wasl Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 50,387,234 - 50,461,160 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936605 1,742,776 - 1,816,690 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936605 1,741,832 - 1,816,694 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
WASL Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 18 23,722,188 - 23,789,506 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 18 23,722,188 - 23,789,516 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 18 25,318,931 - 25,386,518 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
WASL Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 21 92,480,392 - 92,546,725 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 21 92,482,918 - 92,546,481 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666042 10,917,558 - 10,985,328 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Wasl
.
Predicted Target Of
Count of predictions: 599 Count of miRNA genes: 262 Interacting mature miRNAs: 340 Transcripts: ENSRNOT00000009261 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
2302371 Stl22 Serum triglyceride level QTL 22 5.15 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 4 5218294 57114705 Rat 2303585 Bw86 Body weight QTL 86 4 body mass (VT:0001259) body weight (CMO:0000012) 4 14678065 59678065 Rat 1358352 Srcrt3 Stress Responsive Cort QTL 3 2.29 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 38465774 146803430 Rat 61445 Strs3 Sensitivity to stroke QTL 3 3 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 4 40433388 85433388 Rat 6893678 Bw108 Body weight QTL 108 2.6 0.006 body mass (VT:0001259) body weight (CMO:0000012) 4 43457976 88457976 Rat 8552906 Pigfal3 Plasma insulin-like growth factor 1 level QTL 3 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 4 10084089 55084089 Rat 10755501 Bp390 Blood pressure QTL 390 2.5 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 4 26775591 168368347 Rat 1331807 Rf31 Renal function QTL 31 2.988 urine potassium amount (VT:0010539) urine potassium level (CMO:0000128) 4 39524264 74726312 Rat 6478766 Anxrr47 Anxiety related response QTL 47 0.09637 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 4 10084089 55084089 Rat 8552782 Vie1 Viral induced encephalitis QTL 1 26.4 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 4 34430484 82490359 Rat 631642 Stl2 Serum triglyceride level QTL 2 3.3 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 4 5219178 56647776 Rat 6478769 Anxrr48 Anxiety related response QTL 48 0.02514 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 10084089 55084089 Rat 631261 Tcas3 Tongue tumor susceptibility QTL 3 6.88 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 4 10814170 91360527 Rat 2312567 Glom19 Glomerulus QTL 19 1.9 0.006 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 4 45456990 146803430 Rat 10450825 Scl78 Serum cholesterol level QTL 78 3.7 0.01 blood VLDL cholesterol amount (VT:0005144) blood low density lipoprotein cholesterol level (CMO:0000053) 4 49178116 57114705 Rat 2313401 Anxrr27 Anxiety related response QTL 27 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 4 17933508 62933508 Rat 10450821 Scl77 Serum cholesterol level QTL 77 4.1 0.01 blood VLDL cholesterol amount (VT:0005144) blood high density lipoprotein cholesterol level (CMO:0000052) 4 49178116 57114705 Rat 8655961 Kidm43 Kidney mass QTL 43 18 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 4 36303261 103194984 Rat 10450818 Scl76 Serum cholesterol level QTL 76 3.6 0.01 blood VLDL cholesterol amount (VT:0005144) blood high density lipoprotein cholesterol level (CMO:0000052) 4 49178116 57114705 Rat 1354612 Foco1 Food consumption QTL 1 8.87 eating behavior trait (VT:0001431) food intake rate (CMO:0000427) 4 44463908 148090542 Rat 6909128 Pancm4 Pancreatic morphology QTL 4 11.35 pancreas mass (VT:0010144) pancreas wet weight (CMO:0000626) 4 26907285 75585128 Rat 8694374 Bw155 Body weight QTL 155 3.39 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 4 10084089 55084089 Rat 2303168 Bp330 Blood pressure QTL 330 4.25 0.017 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 5214602 146446691 Rat 8552801 Bw143 Body weight QTL 143 7.3 body mass (VT:0001259) change in body weight to body weight ratio (CMO:0002216) 4 34430484 82490359 Rat 61475 Aia2 Adjuvant induced arthritis QTL 2 5.8 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 39505275 73892441 Rat 8694439 Bw168 Body weight QTL 168 9.57 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 4 40433414 85433414 Rat 61412 Pia2 Pristane induced arthritis QTL 2 3.9 joint integrity trait (VT:0010548) post-insult time to onset of experimental arthritis (CMO:0001450) 4 21333343 62278020 Rat 6478724 Anxrr35 Anxiety related response QTL 35 0.00449 defecation behavior trait (VT:0010462) defecation measurement (CMO:0000997) 4 10084089 55084089 Rat 8655906 Rf60 Renal function QTL 60 3.8 blood creatinine amount (VT:0005328) creatinine clearance (CMO:0000765) 4 29494195 81006281 Rat 619616 Bp79 Blood pressure QTL 79 0.0292 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 5214602 78882945 Rat 1576305 Emca6 Estrogen-induced mammary cancer QTL 6 5.8 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 4 44463720 155883716 Rat 7387227 Uae40 Urinary albumin excretion QTL 40 2.9 0.0052 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 4 17946999 62946999 Rat 6909122 Insul22 Insulin level QTL 22 4.63 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 4 26907285 75585128 Rat 8552809 Vie5 Viral induced encephalitis QTL 5 25.3 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 4 34430484 82490359 Rat 1358203 Stl19 Serum triglyceride level QTL 19 2.8 0.002 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 4 5218294 65958103 Rat 1354660 Salc1 Saline consumption QTL 1 11.26 drinking behavior trait (VT:0001422) saline drink intake rate (CMO:0001627) 4 44463908 148090542 Rat 1298082 Stresp4 Stress response QTL 4 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 50119848 146803430 Rat 9590304 Scort17 Serum corticosterone level QTL 17 4.96 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 10084089 55084089 Rat 1300139 Hrtrt6 Heart rate QTL 6 2.85 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 39524264 116179656 Rat 12798520 Anxrr55 Anxiety related response QTL 55 4.45 0.01 locomotor behavior trait (VT:0001392) number of rearing movements with lid-pushing in an experimental apparatus (CMO:0002715) 4 32583980 114627242 Rat 2316958 Gluco58 Glucose level QTL 58 10 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 11320076 180699135 Rat
RH128038
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 53,085,580 - 53,085,797 (+) MAPPER mRatBN7.2 Rnor_6.0 4 51,679,767 - 51,679,983 NCBI Rnor6.0 Rnor_5.0 4 51,458,023 - 51,458,239 UniSTS Rnor5.0 Celera 4 48,251,294 - 48,251,510 UniSTS RH 3.4 Map 4 288.5 UniSTS
AI231276
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 53,085,097 - 53,085,268 (+) MAPPER mRatBN7.2 Rnor_6.0 4 51,679,284 - 51,679,454 NCBI Rnor6.0 Rnor_5.0 4 51,457,540 - 51,457,710 UniSTS Rnor5.0 Celera 4 48,250,811 - 48,250,981 UniSTS RH 3.4 Map 4 288.9 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000009261 ⟹ ENSRNOP00000009261
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 53,083,536 - 53,132,022 (-) Ensembl Rnor_6.0 Ensembl 4 51,677,722 - 51,726,212 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000106852 ⟹ ENSRNOP00000097692
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 53,086,866 - 53,132,022 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000114717 ⟹ ENSRNOP00000091229
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 53,083,550 - 53,131,984 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000116006 ⟹ ENSRNOP00000090815
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 53,101,963 - 53,132,022 (-) Ensembl
RefSeq Acc Id:
NM_001110365 ⟹ NP_001103835
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 54,049,082 - 54,097,570 (-) NCBI mRatBN7.2 4 53,083,536 - 53,132,022 (-) NCBI Rnor_6.0 4 51,677,722 - 51,726,212 (-) NCBI Rnor_5.0 4 51,455,978 - 51,504,496 (-) NCBI RGSC_v3.4 4 51,063,710 - 51,092,848 (-) RGD Celera 4 48,249,249 - 48,297,692 (-) RGD
Sequence:
CCGCGTCCCGTGGTCTCGCCCGCCCCTGCTGCCATGTTGGATTGTGCGGCTACTGCCGCCGCCGCCGCCGCCGCTGCCGCCGCCAGAGGACTGGAGGAGTAAGGAGTTTAGCGCAGCCGCTGGAGTGC
hide sequence
RefSeq Acc Id:
XM_039108349 ⟹ XP_038964277
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 54,049,081 - 54,097,653 (-) NCBI mRatBN7.2 4 53,083,540 - 53,132,061 (-) NCBI
RefSeq Acc Id:
NP_001103835 ⟸ NM_001110365
- UniProtKB:
O08816 (UniProtKB/Swiss-Prot), F1LSG0 (UniProtKB/TrEMBL), A6IE88 (UniProtKB/TrEMBL)
- Sequence:
MSSGQQPPRRVTNVGSLLLTPQENESLFSFLGKKCVTMSSAVVQLYAADRNCMWSKKCSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALNFANEEEAKKFR
hide sequence
Ensembl Acc Id:
ENSRNOP00000009261 ⟸ ENSRNOT00000009261
RefSeq Acc Id:
XP_038964277 ⟸ XM_039108349
- Peptide Label:
isoform X1
- UniProtKB:
O08816 (UniProtKB/Swiss-Prot)
Ensembl Acc Id:
ENSRNOP00000097692 ⟸ ENSRNOT00000106852
Ensembl Acc Id:
ENSRNOP00000090815 ⟸ ENSRNOT00000116006
Ensembl Acc Id:
ENSRNOP00000091229 ⟸ ENSRNOT00000114717
RGD ID: 13692906 Promoter ID: EPDNEW_R3431 Type: initiation region Name: Wasl_1 Description: Wiskott-Aldrich syndrome-like SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 4 51,726,177 - 51,726,237 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2019-04-02
Wasl
WASP like actin nucleation promoting factor
Wasl
Wiskott-Aldrich syndrome-like
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2013-05-24
Wasl
Wiskott-Aldrich syndrome-like
LOC685687
hypothetical protein LOC685687
Data merged from RGD:1591326
1643240 APPROVED
2009-12-15
Wasl
Wiskott-Aldrich syndrome-like
Iqub
IQ motif and ubiquitin domain containing
Data merged from RGD:2300151
737654 APPROVED
2008-09-22
Wasl
Wiskott-Aldrich syndrome-like
LOC682507
similar to Neural Wiskott-Aldrich syndrome protein (N-WASP)
Data merged from RGD:1597967
737654 APPROVED
2008-03-04
Wasl
Wiskott-Aldrich syndrome-like
Iqub
IQ motif and ubiquitin domain containing
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2007-11-07
Iqub
IQ motif and ubiquitin domain containing
Wasl
Wiskott-Aldrich syndrome-like (human)
Symbol and Name updated
1299863 APPROVED
2006-11-20
LOC682507
similar to Neural Wiskott-Aldrich syndrome protein (N-WASP)
Symbol and Name status set to provisional
70820 PROVISIONAL
2006-11-20
LOC685687
hypothetical protein LOC685687
Symbol and Name status set to provisional
70820 PROVISIONAL
2005-07-08
Wasl
Wiskott-Aldrich syndrome-like (human)
N-WASP
neural Wiskott-Aldrich syndrome protein
Symbol and Name updated
1299863 APPROVED
