Symbol:
Gabra5
Name:
gamma-aminobutyric acid type A receptor subunit alpha 5
RGD ID:
62151
MGI Page
MGI
Description:
Enables GABA-A receptor activity and GABA-gated chloride ion channel activity. Involved in cochlea development; inner ear receptor cell development; and innervation. Acts upstream of or within associative learning and behavioral fear response. Located in cell body and dendrite. Is expressed in several structures, including brain and palatal shelf. Human ortholog(s) of this gene implicated in bipolar disorder; depressive disorder; and developmental and epileptic encephalopathy 79. Orthologous to human GABRA5 (gamma-aminobutyric acid type A receptor subunit alpha5).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
A230018I05Rik; GABA(A) receptor subunit alpha-5; GABAA receptor alpha5 subunit; GABAAR subunit alpha-5; gamma-aminobutyric acid (GABA) A receptor, subunit alpha 5; gamma-aminobutyric acid (GABA-A) receptor, subunit alpha 5; gamma-aminobutyric acid receptor subunit alpha-5; ligand-gated ion channel subunit
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
GABRA5 (gamma-aminobutyric acid type A receptor subunit alpha5) HGNC
Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Gabra5 (gamma-aminobutyric acid type A receptor subunit alpha 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Gabra5 (gamma-aminobutyric acid type A receptor subunit alpha5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
GABRA5 (gamma-aminobutyric acid type A receptor subunit alpha5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
GABRA5 (gamma-aminobutyric acid type A receptor subunit alpha5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Gabra5 (gamma-aminobutyric acid type A receptor subunit alpha5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
GABRA5 (gamma-aminobutyric acid type A receptor subunit alpha5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
GABRA5 (gamma-aminobutyric acid type A receptor subunit alpha5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Gabra5 (gamma-aminobutyric acid type A receptor subunit alpha5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
GABRA1 (gamma-aminobutyric acid type A receptor subunit alpha1) HGNC
OrthoMCL
Homo sapiens (human):
GABRA3 (gamma-aminobutyric acid type A receptor subunit alpha3) HGNC
OrthoMCL
Homo sapiens (human):
GABRA2 (gamma-aminobutyric acid type A receptor subunit alpha2) HGNC
OrthoMCL
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Gabra5 (gamma-aminobutyric acid type A receptor subunit alpha 5)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
GABRA5 (gamma-aminobutyric acid type A receptor subunit alpha5)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
gabra5 (gamma-aminobutyric acid (GABA) A receptor, alpha 5)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid|ZFIN)
Caenorhabditis elegans (roundworm):
lgc-36
Alliance
DIOPT (OrthoFinder|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
lgc-37
Alliance
DIOPT (OMA|OrthoFinder|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Grd
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
lgc-52
Alliance
DIOPT (Ensembl Compara|OMA|PANTHER)
Xenopus tropicalis (tropical clawed frog):
gabra5
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 57,057,417 - 57,240,808 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 57,057,420 - 57,159,807 (-) Ensembl GRCm39 Ensembl GRCm38 7 57,407,669 - 57,591,016 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 57,407,672 - 57,510,059 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 64,663,039 - 64,765,379 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 57,275,688 - 57,377,873 (-) NCBI MGSCv36 mm8 Celera 7 54,720,522 - 54,830,242 (-) NCBI Celera Cytogenetic Map 7 B5 NCBI cM Map 7 33.52 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Gabra5 Mouse (+)-pilocarpine multiple interactions ISO Gabra5 (Rattus norvegicus) 6480464 bacoside A inhibits the reaction [Pilocarpine results in decreased expression of GABRA5 mRNA] and Carbamazepine inhibits the reaction [Pilocarpine results in decreased expression of GABRA5 mRNA] CTD PMID:20821261 Gabra5 Mouse (+)-pilocarpine decreases expression ISO Gabra5 (Rattus norvegicus) 6480464 Pilocarpine results in decreased expression of GABRA5 mRNA CTD PMID:20821261 Gabra5 Mouse (S)-nicotine increases expression ISO Gabra5 (Rattus norvegicus) 6480464 Nicotine results in increased expression of GABRA5 mRNA CTD PMID:28339662 Gabra5 Mouse 17beta-estradiol affects expression ISO GABRA5 (Homo sapiens) 6480464 Estradiol affects the expression of GABRA5 mRNA CTD PMID:16000229 Gabra5 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO GABRA5 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of GABRA5 mRNA CTD PMID:21296121 Gabra5 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Gabra5 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of GABRA5 mRNA CTD PMID:32109520 Gabra5 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of GABRA5 mRNA CTD PMID:21570461 Gabra5 Mouse 2,3,7,8-Tetrachlorodibenzofuran decreases expression ISO Gabra5 (Rattus norvegicus) 6480464 2 more ... CTD PMID:32109520 Gabra5 Mouse 2-palmitoylglycerol increases expression ISO GABRA5 (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of GABRA5 mRNA CTD PMID:37199045 Gabra5 Mouse 4,4'-sulfonyldiphenol increases methylation ISO GABRA5 (Homo sapiens) 6480464 bisphenol S results in increased methylation of GABRA5 gene CTD PMID:31601247 Gabra5 Mouse 4,4'-sulfonyldiphenol affects methylation EXP 6480464 bisphenol S affects the methylation of GABRA5 gene CTD PMID:31683443 Gabra5 Mouse 4,4'-sulfonyldiphenol multiple interactions ISO GABRA5 (Homo sapiens) 6480464 [bisphenol S co-treated with Fulvestrant] results in increased methylation of GABRA5 gene CTD PMID:31601247 Gabra5 Mouse 6-propyl-2-thiouracil increases expression ISO Gabra5 (Rattus norvegicus) 6480464 Propylthiouracil results in increased expression of GABRA5 mRNA CTD PMID:24780913 Gabra5 Mouse acrylamide decreases expression ISO GABRA5 (Homo sapiens) 6480464 Acrylamide results in decreased expression of GABRA5 mRNA CTD PMID:32763439 Gabra5 Mouse antirheumatic drug increases expression ISO GABRA5 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of GABRA5 mRNA CTD PMID:24449571 Gabra5 Mouse arsane multiple interactions ISO GABRA5 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of GABRA5 mRNA CTD PMID:39836092 Gabra5 Mouse arsenic atom multiple interactions ISO GABRA5 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of GABRA5 mRNA CTD PMID:39836092 Gabra5 Mouse Azoxymethane multiple interactions EXP 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of GABRA5 mRNA CTD PMID:29950665 Gabra5 Mouse Bacoside a multiple interactions ISO Gabra5 (Rattus norvegicus) 6480464 bacoside A inhibits the reaction [Pilocarpine results in decreased expression of GABRA5 mRNA] CTD PMID:20821261 Gabra5 Mouse benzo[a]pyrene increases expression ISO Gabra5 (Rattus norvegicus) 6480464 Benzo(a)pyrene results in increased expression of GABRA5 mRNA CTD PMID:21839799 Gabra5 Mouse benzo[a]pyrene increases methylation ISO GABRA5 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of GABRA5 5' UTR and Benzo(a)pyrene results in increased methylation of GABRA5 exon CTD PMID:27901495 Gabra5 Mouse benzo[a]pyrene affects methylation ISO GABRA5 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of GABRA5 promoter CTD PMID:27901495 Gabra5 Mouse bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of GABRA5 mRNA CTD PMID:34319233 Gabra5 Mouse bisphenol A decreases expression ISO Gabra5 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of GABRA5 mRNA CTD PMID:25181051 Gabra5 Mouse bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of GABRA5 mRNA CTD PMID:32156529 Gabra5 Mouse bisphenol A increases methylation ISO GABRA5 (Homo sapiens) 6480464 bisphenol A results in increased methylation of GABRA5 gene CTD PMID:31601247 Gabra5 Mouse bisphenol A decreases expression ISO GABRA5 (Homo sapiens) 6480464 bisphenol A results in decreased expression of GABRA5 mRNA CTD PMID:27685785 Gabra5 Mouse cadmium dichloride decreases expression ISO Gabra5 (Rattus norvegicus) 6480464 Cadmium Chloride results in decreased expression of GABRA5 mRNA CTD PMID:33453195 Gabra5 Mouse carbamazepine affects expression ISO GABRA5 (Homo sapiens) 6480464 Carbamazepine affects the expression of GABRA5 mRNA CTD PMID:25979313 Gabra5 Mouse carbamazepine multiple interactions ISO Gabra5 (Rattus norvegicus) 6480464 Carbamazepine inhibits the reaction [Pilocarpine results in decreased expression of GABRA5 mRNA] CTD PMID:20821261 Gabra5 Mouse copper(II) sulfate increases expression ISO GABRA5 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of GABRA5 mRNA CTD PMID:19549813 Gabra5 Mouse dextran sulfate multiple interactions EXP 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of GABRA5 mRNA CTD PMID:29950665 Gabra5 Mouse diazepam increases activity ISO Gabra5 (Rattus norvegicus) 6480464 Diazepam results in increased activity of GABRA5 protein CTD PMID:15613639 Gabra5 Mouse diclofenac decreases expression EXP 6480464 Diclofenac results in decreased expression of GABRA5 mRNA CTD PMID:26934552 Gabra5 Mouse diethylstilbestrol decreases expression ISO Gabra5 (Rattus norvegicus) 6480464 Diethylstilbestrol results in decreased expression of GABRA5 mRNA CTD PMID:37077353 Gabra5 Mouse dorsomorphin multiple interactions ISO GABRA5 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Gabra5 Mouse entinostat multiple interactions ISO GABRA5 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of GABRA5 mRNA CTD PMID:27188386 Gabra5 Mouse entinostat increases expression ISO GABRA5 (Homo sapiens) 6480464 entinostat results in increased expression of GABRA5 mRNA CTD PMID:26272509 Gabra5 Mouse Etizolam decreases expression ISO Gabra5 (Rattus norvegicus) 6480464 etizolam results in decreased expression of GABRA5 mRNA CTD PMID:16107249 Gabra5 Mouse etomidate multiple interactions EXP 6480464 Etomidate binds to and results in increased activity of GABRA5 protein CTD PMID:16597725 Gabra5 Mouse etomidate affects response to substance EXP 6480464 GABRA5 protein affects the susceptibility to Etomidate CTD PMID:16597725 Gabra5 Mouse folic acid decreases expression EXP 6480464 Folic Acid results in decreased expression of GABRA5 mRNA CTD PMID:25629700 Gabra5 Mouse folic acid decreases expression ISO GABRA5 (Homo sapiens) 6480464 Folic Acid results in decreased expression of GABRA5 mRNA CTD PMID:21867686 Gabra5 Mouse formaldehyde increases expression ISO GABRA5 (Homo sapiens) 6480464 Formaldehyde results in increased expression of GABRA5 mRNA CTD PMID:23649840 Gabra5 Mouse fulvestrant multiple interactions ISO GABRA5 (Homo sapiens) 6480464 [bisphenol S co-treated with Fulvestrant] results in increased methylation of GABRA5 gene CTD PMID:31601247 Gabra5 Mouse fulvestrant decreases methylation ISO GABRA5 (Homo sapiens) 6480464 Fulvestrant results in decreased methylation of GABRA5 gene CTD PMID:31601247 Gabra5 Mouse gamma-aminobutyric acid multiple interactions ISO GABRA5 (Homo sapiens) 6480464 GABRA5 protein affects the reaction [gamma-Aminobutyric Acid binds to and results in increased activity of [GABRB2 protein binds to GABRG2 protein]] CTD PMID:10987858 Gabra5 Mouse genistein multiple interactions ISO Gabra5 (Rattus norvegicus) 6480464 [Genistein co-treated with Methoxychlor] results in increased expression of GABRA5 mRNA CTD PMID:21782745 Gabra5 Mouse ketamine increases expression EXP 6480464 Ketamine results in increased expression of GABRA5 mRNA and Ketamine results in increased expression of GABRA5 protein CTD PMID:21712993 Gabra5 Mouse ketoconazole decreases expression ISO Gabra5 (Rattus norvegicus) 6480464 Ketoconazole results in decreased expression of GABRA5 mRNA CTD PMID:37077353 Gabra5 Mouse linsidomine increases oxidation ISO Gabra5 (Rattus norvegicus) 6480464 linsidomine results in increased oxidation of GABRA5 protein CTD PMID:28086193 Gabra5 Mouse manganese atom multiple interactions ISO GABRA5 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of GABRA5 mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of GABRA5 mRNA CTD PMID:39836092 Gabra5 Mouse manganese(0) multiple interactions ISO GABRA5 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of GABRA5 mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of GABRA5 mRNA CTD PMID:39836092 Gabra5 Mouse manganese(II) chloride multiple interactions ISO GABRA5 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of GABRA5 mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of GABRA5 mRNA CTD PMID:39836092 Gabra5 Mouse mercury dibromide decreases expression ISO GABRA5 (Homo sapiens) 6480464 mercuric bromide results in decreased expression of GABRA5 mRNA CTD PMID:26272509 Gabra5 Mouse mercury dibromide multiple interactions ISO GABRA5 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of GABRA5 mRNA CTD PMID:27188386 Gabra5 Mouse methotrexate decreases expression ISO GABRA5 (Homo sapiens) 6480464 Methotrexate results in decreased expression of GABRA5 mRNA CTD PMID:24449571 Gabra5 Mouse methoxychlor increases expression ISO Gabra5 (Rattus norvegicus) 6480464 Methoxychlor results in increased expression of GABRA5 mRNA CTD PMID:21782745 Gabra5 Mouse methoxychlor multiple interactions ISO Gabra5 (Rattus norvegicus) 6480464 [Genistein co-treated with Methoxychlor] results in increased expression of GABRA5 mRNA CTD PMID:21782745 Gabra5 Mouse nicotine increases expression ISO Gabra5 (Rattus norvegicus) 6480464 Nicotine results in increased expression of GABRA5 mRNA CTD PMID:28339662 Gabra5 Mouse p-chloromercuribenzoic acid decreases expression ISO GABRA5 (Homo sapiens) 6480464 p-Chloromercuribenzoic Acid results in decreased expression of GABRA5 mRNA CTD PMID:26272509 Gabra5 Mouse p-chloromercuribenzoic acid multiple interactions ISO GABRA5 (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of GABRA5 mRNA CTD PMID:27188386 Gabra5 Mouse paracetamol decreases expression ISO GABRA5 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of GABRA5 mRNA CTD PMID:26690555 Gabra5 Mouse phenylmercury acetate decreases expression ISO GABRA5 (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of GABRA5 mRNA CTD PMID:26272509 Gabra5 Mouse phenylmercury acetate multiple interactions ISO GABRA5 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of GABRA5 mRNA CTD PMID:27188386 Gabra5 Mouse pirinixic acid increases expression ISO Gabra5 (Rattus norvegicus) 6480464 pirinixic acid results in increased expression of GABRA5 mRNA CTD PMID:12832660 Gabra5 Mouse progesterone decreases expression ISO GABRA5 (Homo sapiens) 6480464 Progesterone results in decreased expression of GABRA5 mRNA CTD PMID:16000229 Gabra5 Mouse SB 431542 multiple interactions ISO GABRA5 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Gabra5 Mouse silicon dioxide increases expression ISO GABRA5 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of GABRA5 mRNA CTD PMID:25895662 Gabra5 Mouse sodium arsenite affects methylation ISO GABRA5 (Homo sapiens) 6480464 sodium arsenite affects the methylation of GABRA5 gene CTD PMID:28589171 Gabra5 Mouse sodium arsenite multiple interactions ISO GABRA5 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of GABRA5 mRNA CTD PMID:39836092 Gabra5 Mouse Soman decreases expression ISO Gabra5 (Rattus norvegicus) 6480464 Soman results in decreased expression of GABRA5 mRNA CTD PMID:19281266 Gabra5 Mouse Testosterone propionate increases expression EXP 6480464 Testosterone Propionate results in increased expression of GABRA5 mRNA CTD PMID:16957604 Gabra5 Mouse tetrachloromethane affects expression ISO Gabra5 (Rattus norvegicus) 6480464 Carbon Tetrachloride affects the expression of GABRA5 mRNA CTD PMID:12734012 Gabra5 Mouse titanium dioxide multiple interactions EXP 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of GABRA5 mRNA CTD PMID:29950665 Gabra5 Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of GABRA5 gene CTD PMID:35295148 Gabra5 Mouse toluene affects expression ISO Gabra5 (Rattus norvegicus) 6480464 Toluene affects the expression of GABRA5 mRNA CTD PMID:17108153 Gabra5 Mouse trichostatin A increases expression ISO GABRA5 (Homo sapiens) 6480464 trichostatin A results in increased expression of GABRA5 mRNA CTD PMID:24935251 Gabra5 Mouse valproic acid decreases methylation ISO GABRA5 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of GABRA5 gene CTD PMID:29154799 Gabra5 Mouse valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of GABRA5 mRNA CTD PMID:17963808 Gabra5 Mouse valproic acid affects expression ISO GABRA5 (Homo sapiens) 6480464 Valproic Acid affects the expression of GABRA5 mRNA CTD PMID:25979313 Gabra5 Mouse valproic acid multiple interactions ISO GABRA5 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of GABRA5 mRNA CTD PMID:27188386 Gabra5 Mouse valproic acid increases expression ISO GABRA5 (Homo sapiens) 6480464 Valproic Acid results in increased expression of GABRA5 mRNA CTD PMID:23179753 more ... Gabra5 Mouse vinclozolin increases methylation ISO Gabra5 (Rattus norvegicus) 6480464 vinclozolin results in increased methylation of GABRA5 gene CTD PMID:31079544
(+)-pilocarpine (ISO) (S)-nicotine (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (ISO) 2-palmitoylglycerol (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 6-propyl-2-thiouracil (ISO) acrylamide (ISO) antirheumatic drug (ISO) arsane (ISO) arsenic atom (ISO) Azoxymethane (EXP) Bacoside a (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) cadmium dichloride (ISO) carbamazepine (ISO) copper(II) sulfate (ISO) dextran sulfate (EXP) diazepam (ISO) diclofenac (EXP) diethylstilbestrol (ISO) dorsomorphin (ISO) entinostat (ISO) Etizolam (ISO) etomidate (EXP) folic acid (EXP,ISO) formaldehyde (ISO) fulvestrant (ISO) gamma-aminobutyric acid (ISO) genistein (ISO) ketamine (EXP) ketoconazole (ISO) linsidomine (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) mercury dibromide (ISO) methotrexate (ISO) methoxychlor (ISO) nicotine (ISO) p-chloromercuribenzoic acid (ISO) paracetamol (ISO) phenylmercury acetate (ISO) pirinixic acid (ISO) progesterone (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) Soman (ISO) Testosterone propionate (EXP) tetrachloromethane (ISO) titanium dioxide (EXP) toluene (ISO) trichostatin A (ISO) valproic acid (EXP,ISO) vinclozolin (ISO)
1.
mRNA and protein levels for GABAAalpha4, alpha5, beta1 and GABABR1 receptors are altered in brains from subjects with autism.
Fatemi SH, etal., J Autism Dev Disord. 2010 Jun;40(6):743-50.
2.
Excess of allele1 for alpha3 subunit GABA receptor gene (GABRA3) in bipolar patients: a multicentric association study.
Massat I, etal., Mol Psychiatry 2002;7(2):201-7.
3.
Electronic Transfer of Homolog Data
MGD and Homologene mouse data transfer
4.
MGDs mouse GO annotations
MGD data from the GO Consortium
5.
Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.
Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
6.
Positive association between the GABRA5 gene and unipolar recurrent major depression.
Oruc L, etal., Neuropsychobiology 1997;36(2):62-4.
7.
Association between the GABA(A) receptor alpha5 subunit gene locus (GABRA5) and bipolar affective disorder.
Papadimitriou GN, etal., Am J Med Genet 1998 Feb 7;81(1):73-80.
8.
Mouse MP Annotation Import Pipeline
RGD automated import pipeline
9.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
Gabra5 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 57,057,417 - 57,240,808 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 57,057,420 - 57,159,807 (-) Ensembl GRCm39 Ensembl GRCm38 7 57,407,669 - 57,591,016 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 57,407,672 - 57,510,059 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 64,663,039 - 64,765,379 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 57,275,688 - 57,377,873 (-) NCBI MGSCv36 mm8 Celera 7 54,720,522 - 54,830,242 (-) NCBI Celera Cytogenetic Map 7 B5 NCBI cM Map 7 33.52 NCBI
GABRA5 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 15 26,866,719 - 26,949,208 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 15 26,866,911 - 26,949,208 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 15 27,111,866 - 27,194,355 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 15 24,663,151 - 24,679,797 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 36 15 24,742,696 - 24,776,749 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 15 24,742,694 - 24,776,749 NCBI Celera 15 5,273,203 - 5,355,540 (+) NCBI Celera Cytogenetic Map 15 q12 NCBI HuRef 15 5,288,011 - 5,322,374 (+) NCBI HuRef HuRef 15 5,241,009 - 5,262,207 (+) NCBI HuRef CHM1_1 15 27,061,401 - 27,143,890 (+) NCBI CHM1_1 T2T-CHM13v2.0 15 24,607,751 - 24,690,792 (+) NCBI T2T-CHM13v2.0
Gabra5 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 117,404,446 - 117,517,424 (-) NCBI GRCr8 mRatBN7.2 1 108,268,728 - 108,381,670 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 108,268,776 - 108,380,917 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 113,646,984 - 113,751,778 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 122,119,493 - 122,224,279 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 115,367,807 - 115,472,601 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 112,833,941 - 112,947,482 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 112,833,944 - 112,947,451 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 113,844,235 - 113,955,760 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 108,843,086 - 108,955,130 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 108,921,428 - 109,033,473 (-) NCBI Celera 1 102,441,576 - 102,547,389 (-) NCBI Celera Cytogenetic Map 1 q22 NCBI
Gabra5 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955533 2,563,319 - 2,631,289 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955533 2,563,499 - 2,631,086 (-) NCBI ChiLan1.0 ChiLan1.0
GABRA5 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 16 8,328,194 - 8,411,167 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 15 11,969,290 - 12,052,259 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 15 2,953,857 - 3,036,722 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 15 24,300,300 - 24,382,535 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 15 24,300,300 - 24,382,730 (+) Ensembl panpan1.1 panPan2
GABRA5 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 3 33,663,414 - 33,746,120 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 3 33,664,169 - 33,744,328 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 3 36,353,800 - 36,436,241 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 3 33,999,325 - 34,081,790 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 3 33,999,318 - 34,081,948 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 3 33,539,876 - 33,622,259 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 3 33,802,491 - 33,884,937 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 3 33,949,742 - 34,032,243 (-) NCBI UU_Cfam_GSD_1.0
Gabra5 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 121,933,396 - 122,009,905 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936471 39,781,451 - 39,975,518 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936471 39,781,451 - 39,856,766 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
GABRA5 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 140,486,104 - 140,567,894 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 140,486,107 - 140,568,204 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 156,791,330 - 156,874,272 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
GABRA5 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 26 55,147,512 - 55,227,801 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 26 55,147,511 - 55,227,297 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666054 37,978,006 - 38,060,544 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Gabra5
.
Predicted Target Of
Count of predictions: 250 Count of miRNA genes: 202 Interacting mature miRNAs: 221 Transcripts: ENSMUST00000068456 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
25314307 Mlh1fc2_m MLH1 foci count 2 (mouse) 7 6502999 133501729 Mouse 1301969 Lbw5_m lupus NZB x NZW 5 (mouse) Not determined 7 26847615 60851775 Mouse 27226778 Femd11_m femur midshaft diameter 11, 16 week (mouse) 7 56949748 134001729 Mouse 1357586 Mdmsc3_m modifier of muscularity 3 (mouse) Not determined 7 34447869 68448018 Mouse 38501068 Tip1_m tuberculosis immunophenotype 1, spleen CFU (mouse) 7 3602999 72549748 Mouse 39128210 Lwq19_m liver weight QTL 19 (mouse) 7 33497727 58148965 Mouse 11252140 Fdr1_m fat response to dietary restriction 1 (mouse) 7 41148820 75148965 Mouse 25823170 Hrsq7_m host response to SARS QTL 7, log titer (mouse) 7 54819589 116822815 Mouse 1357469 Kidq5_m kidney weight QTL 5 (mouse) Not determined 7 33497727 58148965 Mouse 1301082 Bbaa16_m B.burgdorferi-associated arthritis 16 (mouse) Not determined 7 36280015 116416877 Mouse 4142003 W3q10_m weight 3 weeks QTL 10 (mouse) Not determined 33497727 58148965 Mouse 12790989 Tgl6_m triglyceride 6 (mouse) 7 27540549 61540549 Mouse 1559000 Ossc1_m osteosarcoma susceptibility 1 (mouse) Not determined 7 34053025 68053223 Mouse 10043926 Bw1n_m body weight 1 in NSY (mouse) Not determined 7 45161966 118693530 Mouse 12792978 Fbmd3_m femoral bone mineral density 3, females only (mouse) 7 7050288 142367832 Mouse 4141805 Sle19_m systematic lupus erythematosus susceptibility 19 (mouse) Not determined 30032485 81135653 Mouse 1357634 Splq7_m spleen weight QTL 7 (mouse) Not determined 7 33497727 58148965 Mouse 4141929 Chlq18_m circulating hormone level QTL 18 (mouse) Not determined 7 41148820 75148965 Mouse 1300996 Aorls2_m aortic lesion size 2 (mouse) Not determined 7 32394532 66394681 Mouse 1301514 Rigs1_m radiation induced gastroschisis 1 (mouse) Not determined 7 36280015 92394346 Mouse 1300878 Skts1_m skin tumor susceptibility 1 (mouse) Not determined 7 37891386 71891582 Mouse 11565101 Tsve1_m variable short tail (Tsv) enhancer 1 (mouse) 7 55889508 87142720 Mouse 27226751 Femd5_m femur midshaft diameter 5, 10 week (mouse) 7 53249748 143153737 Mouse 1300722 Sle3_m systemic lupus erythmatosus susceptibility 3 (mouse) Not determined 7 3511728 87142720 Mouse 13208555 Lgth10_m body length 10 (mouse) 7 51649748 125599172 Mouse 1301175 Ap7q_m alcohol preference 7 QTL (mouse) Not determined 7 31714845 65715077 Mouse 1300791 Abbp3_m A/J and C57BL/6 blood pressure 3 (mouse) Not determined 7 39673887 103510010 Mouse 11354952 Pdcc1_m plasmacytoid dentritic cell compartment 1 (mouse) 7 23066531 57066531 Mouse 12880417 V125Dq5_m vitamin D active form serum level QTL 5 (mouse) 7 45249748 79249748 Mouse 10402488 Dipa2_m drug induced psychomotor activation 2 (mouse) Not determined 7 38421548 72421684 Mouse 12880418 V125Dq6_m vitamin D active form serum level QTL 6 (mouse) 7 52149748 86149748 Mouse 4142102 Tailq5_m tail length QTL 5 (mouse) Not determined 33497727 58148965 Mouse 10054064 Bwq11_m body weight QTL 11 (mouse) Not determined 7 51124954 85125093 Mouse 4141909 W10q18_m weight 10 weeks QTL 18 (mouse) Not determined 33497727 58148965 Mouse 11532741 Tbrs5_m tuberculosis resistance 5 (mouse) 7 49159227 83235415 Mouse 1357752 Tabw_m tally ho asscoiated body weight (mouse) Not determined 7 49193278 83193390 Mouse 10053685 Eae43_m experimental allergic encephalomyelitis susceptibility 43 (mouse) Not determined 7 51124954 85125093 Mouse 26884404 Huml1_m humerus length 1, 5 week (mouse) 7 30199425 108999207 Mouse 1302141 Fcsa6_m femoral cross-sectional area 6 (mouse) Not determined 7 48384461 82384607 Mouse 1357883 Epfq5_m epididymal fat pad weight QTL 5 (mouse) Not determined 7 33497727 58148965 Mouse 10045622 Heal20_m wound healing/regeneration 20 (mouse) Not determined 7 34316887 68317043 Mouse 1301158 Eae4_m susceptibility to experimental allergic encephalomyelitis 4 (mouse) Not determined 7 19147398 141919804 Mouse 4142218 W6q17_m weight 6 weeks QTL 17 (mouse) Not determined 33497727 58148965 Mouse 12738423 Lfibq6_m liver fibrosis QTL 6 (mouse) 7 47694378 66704862 Mouse 10412199 Sst2_m susceptibility to tuberculosis 2 (mouse) Not determined 7 18728794 119485380 Mouse 25314302 Vmm2_m variable multisystem mineralization 2, heart (mouse) 7 47149748 74149748 Mouse 25314303 Vmm4_m variable multisystem mineralization 4, kidney (mouse) 7 37299425 87049208 Mouse 25314301 Vmm3_m variable multisystem mineralization 3, lung (mouse) 7 37299425 72049748 Mouse
AW046005
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 7 57,407,922 - 57,408,009 UniSTS GRCm38 MGSCv37 7 64,663,292 - 64,663,379 UniSTS GRCm37 Celera 7 54,720,775 - 54,720,862 UniSTS Cytogenetic Map 7 C UniSTS cM Map 7 28.5 UniSTS Whitehead/MRC_RH 7 682.38 UniSTS
14.MMHAP22FRE8.seq
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 7 57,417,953 - 57,418,107 UniSTS GRCm38 MGSCv37 7 64,673,323 - 64,673,477 UniSTS GRCm37 Cytogenetic Map 7 C UniSTS cM Map 7 28.5 UniSTS Whitehead_YAC 7 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000068456 ⟹ ENSMUSP00000063276
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 7 57,057,420 - 57,159,757 (-) Ensembl GRCm38.p6 Ensembl 7 57,407,672 - 57,510,009 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000206382 ⟹ ENSMUSP00000146238
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 7 57,057,467 - 57,159,119 (-) Ensembl GRCm38.p6 Ensembl 7 57,407,719 - 57,509,371 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000206734 ⟹ ENSMUSP00000145685
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 7 57,057,653 - 57,159,807 (-) Ensembl GRCm38.p6 Ensembl 7 57,407,905 - 57,510,059 (-) Ensembl
RefSeq Acc Id:
NM_001362161 ⟹ NP_001349090
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 7 57,057,417 - 57,159,807 (-) NCBI GRCm38 7 57,407,669 - 57,510,059 (-) NCBI
Sequence:
GCCTAGGCAGAGGGACGTTCCTCAAACCCAGAGACGACATGTGGCGCTTTGGAGAGCGTCAAGATCAAGTTGGAGGCAAGAACAGTTTTTCTTCCAAATTCATCTGCTTCGACTATTATTCTTACTGG
hide sequence
RefSeq Acc Id:
NM_001362162 ⟹ NP_001349091
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 7 57,057,417 - 57,159,757 (-) NCBI GRCm38 7 57,407,669 - 57,510,009 (-) NCBI
Sequence:
GGAGAGGTGAGAGCGAGCGCGAGTCCGCCGGGGGCGCTGGGGGAATCTGCAGCGGGGCAACGCG
hide sequence
RefSeq Acc Id:
NM_176942 ⟹ NP_795916
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 7 57,057,417 - 57,159,757 (-) NCBI GRCm38 7 57,407,669 - 57,510,009 (-) NCBI MGSCv37 7 64,663,039 - 64,765,379 (-) RGD Celera 7 54,720,522 - 54,830,242 (-) RGD cM Map 7 ENTREZGENE
Sequence:
GGAGAGGTGAGAGCGAGCGCGAGTCCGCCGGGGGCGCTGGGGGAATCTGCAGCGGGGCAACGCGCGGCCTCAGGCGCGGCGCGGAACAGAGCCGCAAGGCGGCAGCGGGAGCGCAGGGCTCCGGGGCT
hide sequence
RefSeq Acc Id:
XM_006540556 ⟹ XP_006540619
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 7 57,057,420 - 57,159,381 (-) NCBI GRCm38 7 57,407,672 - 57,509,637 (-) NCBI
Sequence:
GACTGCGGAGGCCACCAGCACGGAGGGCAGGGGATCCGGTGGCGCGGCTGGACGGGGCTGTGGGCGCAGCGCCTCCTGGTTCGCGGTGGACAGCAGAGAGCTGCTGCTTGCGGCCGTCGTGGAGCTCG
hide sequence
RefSeq Acc Id:
XM_006540557 ⟹ XP_006540620
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 7 57,057,420 - 57,159,382 (-) NCBI GRCm38 7 57,407,683 - 57,509,638 (-) NCBI
Sequence:
AGACTGCGGAGGCCACCAGCACGGAGGGCAGGGGATCCGGTGGCGCGGCTGGACGGGGCTGTGGGCGCAGCGCCTCCTGGTTCGCGGTGGACAGCAGAGAGCTGCTGCTTGCGGCCGTCGTGGAGCTC
hide sequence
RefSeq Acc Id:
XM_006540560 ⟹ XP_006540623
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 7 57,057,420 - 57,159,856 (-) NCBI GRCm38 7 57,407,672 - 57,510,103 (-) NCBI
Sequence:
GGGGCCGGGGGCCGTGCATTTGATGAGAGTCTGGCGGCCTCTACCGGGCGCCTAGGCAGAGGGA
hide sequence
RefSeq Acc Id:
XM_030241988 ⟹ XP_030097848
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 7 57,057,420 - 57,240,808 (-) NCBI GRCm38 7 57,407,672 - 57,591,016 (-) NCBI
Sequence:
ACAAGAACAGCACCCGCCCCCTATGGGTCCGCGGTCGCTCCGGGGCGCCGGCGCCCTCCCAAGCCGCGGCAGCGGCCGCACCGGACTCCCGGGGAAGGGCTTGCGTGCGGCCGCAGATCCGCGCTGGA
hide sequence
RefSeq Acc Id:
NP_795916 ⟸ NM_176942
- Peptide Label:
precursor
- UniProtKB:
Q8BHJ7 (UniProtKB/Swiss-Prot)
- Sequence:
MDNGMLSRFIMTQTLLVFCISMTLSSHFGFSQMPTSSVQDETNDNITIFTRILDGLLDGYDNRLRPGLGERITQVRTDIYVTSFGPVSDTEMEYTIDVFFRQSWKDERLRFKGPMQRLPLNNLLASKI
hide sequence
RefSeq Acc Id:
XP_006540623 ⟸ XM_006540560
- Peptide Label:
isoform X1
- UniProtKB:
Q8BHJ7 (UniProtKB/Swiss-Prot)
- Sequence:
MDNGMLSRFIMTQTLLVFCISMTLSSHFGFSQMPTSSVQDETNDNITIFTRILDGLLDGYDNRLRPGLGERITQVRTDIYVTSFGPVSDTEMEYTIDVFFRQSWKDERLRFKGPMQRLPLNNLLASKI
hide sequence
RefSeq Acc Id:
XP_006540620 ⟸ XM_006540557
- Peptide Label:
isoform X1
- UniProtKB:
Q8BHJ7 (UniProtKB/Swiss-Prot)
- Sequence:
MDNGMLSRFIMTQTLLVFCISMTLSSHFGFSQMPTSSVQDETNDNITIFTRILDGLLDGYDNRLRPGLGERITQVRTDIYVTSFGPVSDTEMEYTIDVFFRQSWKDERLRFKGPMQRLPLNNLLASKI
hide sequence
RefSeq Acc Id:
XP_006540619 ⟸ XM_006540556
- Peptide Label:
isoform X1
- UniProtKB:
Q8BHJ7 (UniProtKB/Swiss-Prot)
- Sequence:
MDNGMLSRFIMTQTLLVFCISMTLSSHFGFSQMPTSSVQDETNDNITIFTRILDGLLDGYDNRLRPGLGERITQVRTDIYVTSFGPVSDTEMEYTIDVFFRQSWKDERLRFKGPMQRLPLNNLLASKI
hide sequence
RefSeq Acc Id:
NP_001349090 ⟸ NM_001362161
- Peptide Label:
precursor
- UniProtKB:
Q8BHJ7 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
NP_001349091 ⟸ NM_001362162
- Peptide Label:
precursor
- UniProtKB:
Q8BHJ7 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_030097848 ⟸ XM_030241988
- Peptide Label:
isoform X1
- UniProtKB:
Q8BHJ7 (UniProtKB/Swiss-Prot)
Ensembl Acc Id:
ENSMUSP00000145685 ⟸ ENSMUST00000206734
Ensembl Acc Id:
ENSMUSP00000146238 ⟸ ENSMUST00000206382
Ensembl Acc Id:
ENSMUSP00000063276 ⟸ ENSMUST00000068456
RGD ID: 8664267 Promoter ID: EPDNEW_M10165 Type: initiation region Name: Gabra5_1 Description: Mus musculus gamma-aminobutyric acid A receptor, subunit alpha5 , transcript variant 2, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 7 57,509,922 - 57,509,982 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2024-08-21
Gabra5
gamma-aminobutyric acid type A receptor subunit alpha 5
Gabra5
gamma-aminobutyric acid (GABA-A) receptor, subunit alpha 5
Symbol and/or name change
5135510 APPROVED
2024-08-21
Gabra5
gamma-aminobutyric acid (GABA-A) receptor, subunit alpha 5
Gabra5
gamma-aminobutyric acid type A receptor subunit alpha 5
Symbol and/or name change
5135510 APPROVED
2023-07-04
Gabra5
gamma-aminobutyric acid type A receptor subunit alpha 5
Gabra5
gamma-aminobutyric acid (GABA) A receptor, subunit alpha 5
Symbol and/or name change
5135510 APPROVED
