Symbol:
Atp5f1e
Name:
ATP synthase F1 subunit epsilon
RGD ID:
621374
Description:
Contributes to ATP hydrolysis activity. Predicted to be involved in proton motive force-driven mitochondrial ATP synthesis. Located in mitochondrial inner membrane. Part of proton-transporting ATP synthase complex. Human ortholog(s) of this gene implicated in mitochondrial complex V (ATP synthase) deficiency nuclear type 3. Orthologous to several human genes including ATP5F1E (ATP synthase F1 subunit epsilon); PARTICIPATES IN electron transport chain pathway; Alzheimer's disease pathway; Huntington's disease pathway; INTERACTS WITH 2,3',4,4',5-Pentachlorobiphenyl; 2,3,7,8-tetrachlorodibenzodioxine; 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
ATP synthase subunit epsilon, mitochondrial; ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit; Atp5e; ATPase subunit epsilon
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 183,677,270 - 183,680,172 (-) NCBI GRCr8 mRatBN7.2 3 163,259,072 - 163,261,974 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 163,260,476 - 163,261,450 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 167,057,815 - 167,060,717 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 175,554,247 - 175,557,149 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 173,298,673 - 173,301,575 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 172,563,105 - 172,566,007 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 172,563,105 - 172,566,010 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 178,609,111 - 178,612,013 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Celera 3 162,432,456 - 162,435,358 (-) NCBI Celera Cytogenetic Map 3 q43 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Atp5f1e Rat (+)-dexrazoxane increases expression ISO Atp5f1e (Mus musculus) 6480464 Dexrazoxane results in increased expression of ATP5F1E mRNA CTD PMID:26873546 Atp5f1e Rat (S)-nicotine increases splicing ISO ATP5F1E (Homo sapiens) 6480464 Nicotine results in increased splicing of ATP5F1E mRNA alternative form CTD PMID:23825647 Atp5f1e Rat 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene multiple interactions ISO Atp5f1e (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Atp5f1e Rat 1,2-dimethylhydrazine multiple interactions ISO Atp5f1e (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of ATP5F1E mRNA CTD PMID:22206623 Atp5f1e Rat 17alpha-ethynylestradiol multiple interactions ISO Atp5f1e (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of ATP5F1E mRNA CTD PMID:17942748 Atp5f1e Rat 17alpha-ethynylestradiol increases expression ISO Atp5f1e (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of ATP5F1E mRNA CTD PMID:17942748 Atp5f1e Rat 17beta-estradiol decreases expression ISO ATP5F1E (Homo sapiens) 6480464 Estradiol results in decreased expression of ATP5F1E mRNA CTD PMID:23019147 Atp5f1e Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Atp5f1e (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Atp5f1e Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Atp5f1e (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Atp5f1e Rat 2,3',4,4',5-Pentachlorobiphenyl decreases expression EXP 6480464 2 more ... CTD PMID:36450500 Atp5f1e Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of ATP5F1E mRNA CTD PMID:32109520 and PMID:34747641 Atp5f1e Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Atp5f1e (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of ATP5F1E mRNA CTD PMID:21570461 Atp5f1e Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Atp5f1e (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of ATP5F1E mRNA CTD PMID:17942748 Atp5f1e Rat 2,4,4'-trichlorobiphenyl multiple interactions ISO Atp5f1e (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Atp5f1e Rat 2-hydroxypropanoic acid decreases expression ISO ATP5F1E (Homo sapiens) 6480464 Lactic Acid results in decreased expression of ATP5F1E mRNA CTD PMID:30851411 Atp5f1e Rat 4,4'-diaminodiphenylmethane increases expression ISO Atp5f1e (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of ATP5F1E mRNA CTD PMID:18648102 Atp5f1e Rat 4,4'-sulfonyldiphenol increases expression ISO Atp5f1e (Mus musculus) 6480464 bisphenol S results in increased expression of ATP5F1E mRNA CTD PMID:39298647 Atp5f1e Rat 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole affects expression EXP 6480464 Omeprazole affects the expression of ATP5F1E mRNA CTD PMID:19483382 Atp5f1e Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of ATP5F1E mRNA CTD PMID:19483382 Atp5f1e Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of ATP5F1E mRNA CTD PMID:30047161 Atp5f1e Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of ATP5F1E mRNA CTD PMID:31881176 Atp5f1e Rat acetylsalicylic acid increases expression ISO ATP5F1E (Homo sapiens) 6480464 Aspirin results in increased expression of ATP5F1E mRNA CTD PMID:15928584 Atp5f1e Rat acrylamide increases expression ISO ATP5F1E (Homo sapiens) 6480464 Acrylamide results in increased expression of ATP5F1E mRNA CTD PMID:32763439 Atp5f1e Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of ATP5F1E mRNA CTD PMID:35163327 Atp5f1e Rat amiodarone affects expression EXP 6480464 Amiodarone affects the expression of ATP5F1E mRNA CTD PMID:19483382 Atp5f1e Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of ATP5F1E mRNA CTD PMID:30047161 Atp5f1e Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of ATP5F1E mRNA CTD PMID:16483693 Atp5f1e Rat aristolochic acid A decreases expression ISO ATP5F1E (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of ATP5F1E mRNA CTD PMID:33212167 Atp5f1e Rat arsenite(3-) multiple interactions ISO ATP5F1E (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to ATP5F1E mRNA] CTD PMID:32406909 Atp5f1e Rat astemizole increases expression EXP 6480464 Astemizole results in increased expression of ATP5F1E mRNA CTD PMID:20221588 Atp5f1e Rat atrazine decreases expression ISO ATP5F1E (Homo sapiens) 6480464 Atrazine results in decreased expression of ATP5F1E mRNA CTD PMID:22378314 Atp5f1e Rat benzalkonium chloride decreases expression ISO Atp5f1e (Mus musculus) 6480464 Benzalkonium Compounds results in decreased expression of ATP5F1E mRNA CTD PMID:31199489 Atp5f1e Rat benzbromarone affects expression EXP 6480464 Benzbromarone affects the expression of ATP5F1E mRNA CTD PMID:19483382 Atp5f1e Rat benzo[a]pyrene increases expression ISO Atp5f1e (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of ATP5F1E mRNA CTD PMID:22228805 Atp5f1e Rat benzo[a]pyrene increases methylation ISO ATP5F1E (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of ATP5F1E 3' UTR CTD PMID:27901495 Atp5f1e Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Atp5f1e (Mus musculus) 6480464 PPARA protein inhibits the reaction [Diethylhexyl Phthalate results in decreased expression of ATP5F1E mRNA] CTD PMID:19850644 Atp5f1e Rat bis(2-ethylhexyl) phthalate decreases expression ISO Atp5f1e (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of ATP5E mRNA and Diethylhexyl Phthalate results in decreased expression of ATP5F1E mRNA CTD PMID:19850644 and PMID:35550907 Atp5f1e Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of ATP5F1E mRNA CTD PMID:25181051 and PMID:30903817 Atp5f1e Rat bisphenol A decreases expression ISO ATP5F1E (Homo sapiens) 6480464 bisphenol A results in decreased expression of ATP5F1E mRNA and bisphenol A results in decreased expression of ATP5F1E protein CTD PMID:34186270 and PMID:38568856 Atp5f1e Rat bisphenol A multiple interactions ISO ATP5F1E (Homo sapiens) 6480464 [ginger extract results in increased abundance of Oils and Volatile] inhibits the reaction [bisphenol A results in increased expression of ATP5F1E protein] CTD PMID:33376534 Atp5f1e Rat bisphenol A increases expression ISO ATP5F1E (Homo sapiens) 6480464 bisphenol A results in increased expression of ATP5F1E protein CTD PMID:33376534 Atp5f1e Rat bisphenol A affects expression ISO ATP5F1E (Homo sapiens) 6480464 bisphenol A affects the expression of ATP5F1E mRNA CTD PMID:30903817 Atp5f1e Rat bisphenol A increases expression ISO Atp5f1e (Mus musculus) 6480464 bisphenol A results in increased expression of ATP5F1E mRNA CTD PMID:33221593 and PMID:38074096 Atp5f1e Rat bisphenol A decreases expression ISO Atp5f1e (Mus musculus) 6480464 bisphenol A results in decreased expression of ATP5F1E mRNA CTD PMID:35598803 Atp5f1e Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ATP5F1E mRNA CTD PMID:32145629 Atp5f1e Rat bisphenol AF increases expression ISO ATP5F1E (Homo sapiens) 6480464 bisphenol AF results in increased expression of ATP5F1E protein CTD PMID:34186270 Atp5f1e Rat Bisphenol B increases expression ISO ATP5F1E (Homo sapiens) 6480464 bisphenol B results in increased expression of ATP5F1E protein CTD PMID:34186270 Atp5f1e Rat bisphenol F decreases expression ISO Atp5f1e (Mus musculus) 6480464 bisphenol F results in decreased expression of ATP5F1E mRNA CTD PMID:38685157 Atp5f1e Rat butanal increases expression ISO ATP5F1E (Homo sapiens) 6480464 butyraldehyde results in increased expression of ATP5F1E mRNA CTD PMID:26079696 Atp5f1e Rat cadmium dichloride increases expression ISO ATP5F1E (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of ATP5F1E mRNA CTD PMID:38568856 Atp5f1e Rat captan increases expression ISO Atp5f1e (Mus musculus) 6480464 Captan results in increased expression of ATP5F1E mRNA CTD PMID:31558096 Atp5f1e Rat CGP 52608 multiple interactions ISO ATP5F1E (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to ATP5F1E gene] CTD PMID:28238834 Atp5f1e Rat chloropicrin affects expression ISO ATP5F1E (Homo sapiens) 6480464 chloropicrin affects the expression of ATP5F1E mRNA CTD PMID:26352163 Atp5f1e Rat clofibrate affects expression EXP 6480464 Clofibrate affects the expression of ATP5F1E mRNA CTD PMID:19483382 Atp5f1e Rat clofibrate decreases expression ISO Atp5f1e (Mus musculus) 6480464 Clofibrate results in decreased expression of ATP5F1E mRNA CTD PMID:17585979 Atp5f1e Rat cocaine affects expression EXP 6480464 Cocaine affects the expression of ATP5F1E mRNA CTD PMID:20187946 Atp5f1e Rat copper(II) sulfate increases expression ISO ATP5F1E (Homo sapiens) 6480464 Copper Sulfate results in increased expression of ATP5F1E mRNA CTD PMID:20599845 Atp5f1e Rat corosolic acid decreases expression ISO ATP5F1E (Homo sapiens) 6480464 corosolic acid results in decreased expression of ATP5F1E mRNA CTD PMID:37939859 Atp5f1e Rat dibutyl phthalate decreases expression ISO Atp5f1e (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of ATP5F1E mRNA CTD PMID:21266533 Atp5f1e Rat dicrotophos decreases expression ISO ATP5F1E (Homo sapiens) 6480464 dicrotophos results in decreased expression of ATP5F1E mRNA CTD PMID:28302478 Atp5f1e Rat diquat increases expression ISO Atp5f1e (Mus musculus) 6480464 Diquat results in increased expression of ATP5F1E protein CTD PMID:36851058 Atp5f1e Rat disodium selenite increases expression ISO ATP5F1E (Homo sapiens) 6480464 Sodium Selenite results in increased expression of ATP5F1E mRNA CTD PMID:18175754 Atp5f1e Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of ATP5F1E mRNA CTD PMID:21551480 Atp5f1e Rat diuron decreases expression ISO ATP5F1E (Homo sapiens) 6480464 Diuron results in decreased expression of ATP5F1E mRNA CTD PMID:35967413 Atp5f1e Rat doxorubicin increases expression ISO ATP5F1E (Homo sapiens) 6480464 Doxorubicin results in increased expression of ATP5F1E mRNA CTD PMID:29803840 Atp5f1e Rat epoxiconazole increases expression ISO Atp5f1e (Mus musculus) 6480464 epoxiconazole results in increased expression of ATP5F1E mRNA CTD PMID:35436446 Atp5f1e Rat ethanol affects expression ISO Atp5f1e (Mus musculus) 6480464 Ethanol affects the expression of ATP5F1E mRNA CTD PMID:30319688 Atp5f1e Rat folic acid multiple interactions ISO Atp5f1e (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of ATP5F1E mRNA CTD PMID:22206623 Atp5f1e Rat folpet increases expression ISO Atp5f1e (Mus musculus) 6480464 folpet results in increased expression of ATP5F1E mRNA CTD PMID:31558096 Atp5f1e Rat genistein increases expression ISO ATP5F1E (Homo sapiens) 6480464 Genistein results in increased expression of ATP5F1E mRNA CTD PMID:16705744 Atp5f1e Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of ATP5F1E mRNA CTD PMID:22061828 Atp5f1e Rat hydralazine multiple interactions ISO ATP5F1E (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of ATP5F1E mRNA CTD PMID:17183730 Atp5f1e Rat L-ethionine affects expression EXP 6480464 Ethionine affects the expression of ATP5F1E mRNA CTD PMID:19483382 Atp5f1e Rat lipopolysaccharide multiple interactions ISO ATP5F1E (Homo sapiens) 6480464 [Acetaminophen co-treated with Lipopolysaccharides] results in decreased expression of ATP5F1E mRNA CTD PMID:31059760 Atp5f1e Rat methidathion affects expression ISO Atp5f1e (Mus musculus) 6480464 methidathion affects the expression of ATP5F1E mRNA CTD PMID:34813904 Atp5f1e Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of ATP5F1E mRNA CTD PMID:30047161 Atp5f1e Rat methyl methanesulfonate decreases expression ISO ATP5F1E (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of ATP5F1E mRNA CTD PMID:23649840 Atp5f1e Rat methylparaben decreases expression ISO ATP5F1E (Homo sapiens) 6480464 methylparaben results in decreased expression of ATP5F1E mRNA CTD PMID:38568856 Atp5f1e Rat Monobutylphthalate decreases expression ISO Atp5f1e (Mus musculus) 6480464 monobutyl phthalate results in decreased expression of ATP5E mRNA CTD PMID:35278568 Atp5f1e Rat nicotine increases splicing ISO ATP5F1E (Homo sapiens) 6480464 Nicotine results in increased splicing of ATP5F1E mRNA alternative form CTD PMID:23825647 Atp5f1e Rat nitrates multiple interactions ISO Atp5f1e (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of ATP5F1E mRNA CTD PMID:35964746 Atp5f1e Rat omeprazole affects expression EXP 6480464 Omeprazole affects the expression of ATP5F1E mRNA CTD PMID:19483382 Atp5f1e Rat ozone multiple interactions ISO Atp5f1e (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of ATP5F1E mRNA CTD PMID:34911549 Atp5f1e Rat paracetamol decreases expression ISO ATP5F1E (Homo sapiens) 6480464 Acetaminophen results in decreased expression of ATP5F1E mRNA CTD PMID:25704631 more ... Atp5f1e Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of ATP5F1E mRNA CTD PMID:33387578 Atp5f1e Rat paracetamol increases expression ISO Atp5f1e (Mus musculus) 6480464 Acetaminophen results in increased expression of ATP5F1E protein CTD PMID:21329376 Atp5f1e Rat paracetamol multiple interactions ISO ATP5F1E (Homo sapiens) 6480464 [Acetaminophen co-treated with Lipopolysaccharides] results in decreased expression of ATP5F1E mRNA CTD PMID:31059760 Atp5f1e Rat PCB138 multiple interactions ISO Atp5f1e (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Atp5f1e Rat perfluorohexanesulfonic acid decreases expression ISO ATP5F1E (Homo sapiens) 6480464 perfluorohexanesulfonic acid results in decreased expression of ATP5F1E mRNA CTD PMID:25812627 Atp5f1e Rat perfluorooctane-1-sulfonic acid decreases expression EXP 6480464 perfluorooctane sulfonic acid results in decreased expression of ATP5F1E mRNA and perfluorooctane sulfonic acid results in decreased expression of ATP5F1E protein CTD PMID:21251948 Atp5f1e Rat perfluorooctane-1-sulfonic acid increases expression ISO ATP5F1E (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in increased expression of ATP5F1E mRNA CTD PMID:25812627 Atp5f1e Rat perfluorooctane-1-sulfonic acid decreases expression ISO Atp5f1e (Mus musculus) 6480464 perfluorooctane sulfonic acid results in decreased expression of ATP5F1E mRNA CTD PMID:20936131 Atp5f1e Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Atp5f1e (Mus musculus) 6480464 PPARA protein inhibits the reaction [perfluorooctane sulfonic acid results in decreased expression of ATP5F1E mRNA] CTD PMID:20936131 Atp5f1e Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of ATP5F1E mRNA CTD PMID:35163327 Atp5f1e Rat perfluorooctanoic acid increases expression ISO ATP5F1E (Homo sapiens) 6480464 perfluorooctanoic acid results in increased expression of ATP5F1E mRNA CTD PMID:25812627 Atp5f1e Rat perfluoroundecanoic acid multiple interactions ISO ATP5F1E (Homo sapiens) 6480464 [perfluoroundecanoic acid affects the methylation of ATP5F1E gene] which affects the expression of ATP5F1E mRNA CTD PMID:32653021 Atp5f1e Rat pirinixic acid affects expression EXP 6480464 pirinixic acid affects the expression of ATP5F1E mRNA CTD PMID:19483382 Atp5f1e Rat rac-lactic acid decreases expression ISO ATP5F1E (Homo sapiens) 6480464 Lactic Acid results in decreased expression of ATP5F1E mRNA CTD PMID:30851411 Atp5f1e Rat resveratrol increases expression ISO Atp5f1e (Mus musculus) 6480464 Resveratrol results in increased expression of ATP5F1E mRNA CTD PMID:22610192 Atp5f1e Rat rotenone increases expression ISO ATP5F1E (Homo sapiens) 6480464 Rotenone results in increased expression of ATP5F1E mRNA CTD PMID:18191903 Atp5f1e Rat rotenone decreases expression ISO ATP5F1E (Homo sapiens) 6480464 Rotenone results in decreased expression of ATP5F1E mRNA CTD PMID:29955902 Atp5f1e Rat silicon dioxide increases expression EXP 6480464 Silicon Dioxide results in increased expression of ATP5F1E mRNA CTD PMID:18685790 Atp5f1e Rat sodium arsenite increases expression ISO ATP5F1E (Homo sapiens) 6480464 sodium arsenite results in increased expression of ATP5F1E mRNA CTD PMID:38568856 Atp5f1e Rat sodium dichromate increases expression ISO Atp5f1e (Mus musculus) 6480464 sodium bichromate results in increased expression of ATP5F1E mRNA CTD PMID:31558096 Atp5f1e Rat stavudine decreases expression EXP 6480464 Stavudine results in decreased expression of ATP5F1E mRNA CTD PMID:18299183 Atp5f1e Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of ATP5F1E mRNA CTD PMID:30047161 Atp5f1e Rat sunitinib decreases expression ISO ATP5F1E (Homo sapiens) 6480464 Sunitinib results in decreased expression of ATP5F1E mRNA CTD PMID:31533062 Atp5f1e Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of ATP5F1E mRNA CTD PMID:33387578 Atp5f1e Rat thapsigargin decreases expression EXP 6480464 Thapsigargin results in decreased expression of ATP5F1E protein CTD PMID:35544339 Atp5f1e Rat thimerosal increases expression ISO ATP5F1E (Homo sapiens) 6480464 Thimerosal results in increased expression of ATP5F1E mRNA CTD PMID:27188386 Atp5f1e Rat thioacetamide affects expression EXP 6480464 Thioacetamide affects the expression of ATP5F1E mRNA CTD PMID:19483382 Atp5f1e Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of ATP5F1E mRNA CTD PMID:34492290 Atp5f1e Rat titanium dioxide increases methylation ISO Atp5f1e (Mus musculus) 6480464 titanium dioxide results in increased methylation of ATP5E promoter CTD PMID:35295148 Atp5f1e Rat titanium dioxide decreases expression ISO Atp5f1e (Mus musculus) 6480464 titanium dioxide analog results in decreased expression of ATP5F1E mRNA CTD PMID:25111187 Atp5f1e Rat tolcapone decreases expression EXP 6480464 tolcapone results in decreased expression of ATP5F1E mRNA CTD PMID:24136188 Atp5f1e Rat toluene decreases expression EXP 6480464 Toluene results in decreased expression of ATP5F1E mRNA CTD PMID:22166486 and PMID:22967744 Atp5f1e Rat triphenyl phosphate affects expression ISO ATP5F1E (Homo sapiens) 6480464 triphenyl phosphate affects the expression of ATP5F1E mRNA CTD PMID:37042841 Atp5f1e Rat Triptolide decreases expression EXP 6480464 triptolide results in decreased expression of ATP5F1E protein CTD PMID:32519852 Atp5f1e Rat tungsten increases expression ISO Atp5f1e (Mus musculus) 6480464 Tungsten results in increased expression of ATP5F1E mRNA CTD PMID:30912803 Atp5f1e Rat valproic acid multiple interactions ISO ATP5F1E (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of ATP5F1E mRNA CTD PMID:17183730 Atp5f1e Rat valproic acid decreases methylation ISO ATP5F1E (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of ATP5F1E gene CTD PMID:29154799 Atp5f1e Rat valproic acid increases expression ISO ATP5F1E (Homo sapiens) 6480464 Valproic Acid results in increased expression of ATP5F1E mRNA CTD PMID:23179753 and PMID:27188386 Atp5f1e Rat valproic acid affects expression ISO ATP5F1E (Homo sapiens) 6480464 Valproic Acid affects the expression of ATP5F1E mRNA CTD PMID:25979313 Atp5f1e Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of ATP5F1E mRNA CTD PMID:23034163 and PMID:23555832 Atp5f1e Rat vorinostat increases expression ISO ATP5F1E (Homo sapiens) 6480464 vorinostat results in increased expression of ATP5F1E mRNA CTD PMID:27188386
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
(+)-dexrazoxane (ISO) (S)-nicotine (ISO) 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3',4,4',5-Pentachlorobiphenyl (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,4'-trichlorobiphenyl (ISO) 2-hydroxypropanoic acid (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP) 6-propyl-2-thiouracil (EXP) acetamide (EXP) acetylsalicylic acid (ISO) acrylamide (ISO) alpha-Zearalanol (EXP) amiodarone (EXP) amitrole (EXP) ammonium chloride (EXP) aristolochic acid A (ISO) arsenite(3-) (ISO) astemizole (EXP) atrazine (ISO) benzalkonium chloride (ISO) benzbromarone (EXP) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) butanal (ISO) cadmium dichloride (ISO) captan (ISO) CGP 52608 (ISO) chloropicrin (ISO) clofibrate (EXP,ISO) cocaine (EXP) copper(II) sulfate (ISO) corosolic acid (ISO) dibutyl phthalate (ISO) dicrotophos (ISO) diquat (ISO) disodium selenite (ISO) diuron (EXP,ISO) doxorubicin (ISO) epoxiconazole (ISO) ethanol (ISO) folic acid (ISO) folpet (ISO) genistein (ISO) gentamycin (EXP) hydralazine (ISO) L-ethionine (EXP) lipopolysaccharide (ISO) methidathion (ISO) methimazole (EXP) methyl methanesulfonate (ISO) methylparaben (ISO) Monobutylphthalate (ISO) nicotine (ISO) nitrates (ISO) omeprazole (EXP) ozone (ISO) paracetamol (EXP,ISO) PCB138 (ISO) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (EXP,ISO) perfluorooctanoic acid (EXP,ISO) perfluoroundecanoic acid (ISO) pirinixic acid (EXP) rac-lactic acid (ISO) resveratrol (ISO) rotenone (ISO) silicon dioxide (EXP) sodium arsenite (ISO) sodium dichromate (ISO) stavudine (EXP) sulfadimethoxine (EXP) sunitinib (ISO) tetrachloromethane (EXP) thapsigargin (EXP) thimerosal (ISO) thioacetamide (EXP) titanium dioxide (ISO) tolcapone (EXP) toluene (EXP) triphenyl phosphate (ISO) Triptolide (EXP) tungsten (ISO) valproic acid (ISO) vinclozolin (EXP) vorinostat (ISO)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
3.
A simple, rapid method for purification of epsilon-subunit, coupling factor 6, subunit d, and subunit e from rat liver H(+)-ATP synthase and determination of the complete amino acid sequence of epsilon-subunit.
Higuti T, etal., J Biol Chem. 1992 Nov 5;267(31):22658-61.
4.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
5.
Mitochondrial F(0)F(1) ATP synthase. Subunit regions on the F1 motor shielded by F(0), Functional significance, and evidence for an involvement of the unique F(0) subunit F(6).
Ko YH, etal., J Biol Chem. 2000 Oct 20;275(42):32931-9.
6.
Identification of two proteins associated with mammalian ATP synthase.
Meyer B, etal., Mol Cell Proteomics. 2007 Oct;6(10):1690-9. Epub 2007 Jun 17.
7.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
8.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
10.
Mitochondrial ATP synthase: dramatic Mg2+-induced alterations in the structure and function of the F1-ATPase moiety.
Pedersen PL, etal., Biochemistry. 1987 Dec 29;26(26):8631-7.
11.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
12.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
13.
GOA pipeline
RGD automated data pipeline
14.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
15.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
16.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
17.
Cloning, characterization and mapping of the human ATP5E gene, identification of pseudogene ATP5EP1, and definition of the ATP5E motif.
Tu Q, etal., Biochem J 2000 Apr 1;347 Pt 1:17-21.
18.
PFOS prenatal exposure induce mitochondrial injury and gene expression change in hearts of weaned SD rats.
Xia W, etal., Toxicology. 2011 Mar 28;282(1-2):23-9. Epub 2011 Jan 18.
Atp5f1e Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 183,677,270 - 183,680,172 (-) NCBI GRCr8 mRatBN7.2 3 163,259,072 - 163,261,974 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 163,260,476 - 163,261,450 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 167,057,815 - 167,060,717 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 175,554,247 - 175,557,149 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 173,298,673 - 173,301,575 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 172,563,105 - 172,566,007 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 172,563,105 - 172,566,010 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 178,609,111 - 178,612,013 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Celera 3 162,432,456 - 162,435,358 (-) NCBI Celera Cytogenetic Map 3 q43 NCBI
ATP5F1E Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 20 59,025,475 - 59,032,335 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 20 59,025,475 - 59,032,345 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 20 57,600,530 - 57,607,390 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 20 57,037,128 - 57,040,817 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 20 57,037,127 - 57,040,795 NCBI Celera 20 54,344,154 - 54,347,843 (-) NCBI Celera Cytogenetic Map 20 q13.32 NCBI HuRef 20 54,390,650 - 54,394,339 (-) NCBI HuRef CHM1_1 20 57,505,121 - 57,508,810 (-) NCBI CHM1_1 T2T-CHM13v2.0 20 60,808,588 - 60,815,448 (-) NCBI T2T-CHM13v2.0
Atp5f1e Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 174,302,868 - 174,305,894 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 174,302,865 - 174,305,898 (-) Ensembl GRCm39 Ensembl GRCm38 2 174,461,075 - 174,464,101 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 174,461,072 - 174,464,105 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 174,286,576 - 174,289,602 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 174,085,123 - 174,107,033 (-) NCBI MGSCv36 mm8 Celera 2 180,421,820 - 180,424,850 (-) NCBI Celera Cytogenetic Map 2 H4 NCBI cM Map 2 97.95 NCBI
Atp5f1e Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955445 563,315 - 567,865 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955445 563,642 - 567,865 (+) NCBI ChiLan1.0 ChiLan1.0
ATP5F1E Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 21 64,791,968 - 64,795,667 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 20 64,785,090 - 64,789,412 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 20 55,379,615 - 55,383,316 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 20 56,740,739 - 56,744,429 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 20 56,740,739 - 56,744,431 (-) Ensembl panpan1.1 panPan2
ATP5F1E Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 24 43,770,646 - 43,772,278 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 24 43,772,120 - 43,772,680 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 24 43,016,498 - 43,019,991 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 24 44,636,529 - 44,640,022 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 24 44,636,530 - 44,639,979 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 24 43,740,041 - 43,743,522 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 24 43,858,740 - 43,862,214 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 24 44,518,590 - 44,522,082 (-) NCBI UU_Cfam_GSD_1.0
Atp5f1e Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 181,793,162 - 181,796,616 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936530 1,509,605 - 1,513,175 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936530 1,509,605 - 1,513,033 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ATP5F1E
ATP5F1E Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 2 5,109,902 - 5,113,576 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 2 5,109,941 - 5,113,566 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666050 53,161,497 - 53,165,188 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Atp5f1e
.
Predicted Target Of
Count of predictions: 101 Count of miRNA genes: 89 Interacting mature miRNAs: 92 Transcripts: ENSRNOT00000071913 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
12879876 Bw182 Body weight QTL 182 0.003 body mass (VT:0001259) body weight (CMO:0000012) 3 145925360 166177555 Rat 2301411 Bp320 Blood pressure QTL 320 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 145925360 166177555 Rat 2312673 Scl63 Serum cholesterol level QTL 63 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 3 98535255 168026850 Rat 12879872 Cm97 Cardiac mass QTL 97 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 145925360 166177555 Rat 1598877 Bp285 Blood pressure QTL 285 1.5 0.03 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 120538241 165538241 Rat 1578653 Vnigr3 Vascular neointimal growth QTL 3 3.1 artery morphology trait (VT:0002191) artery neointimal hyperplastic lesion area (CMO:0001414) 3 130656562 169034231 Rat 12879873 Cm96 Cardiac mass QTL 96 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 3 145925360 166177555 Rat 12879874 Cm98 Cardiac mass QTL 98 0.005 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 3 145925360 166177555 Rat 1298068 Bp167 Blood pressure QTL 167 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 141074471 169034231 Rat 12879875 Kidm64 Kidney mass QTL 64 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 3 145925360 166177555 Rat 70216 Cm14 Cardiac mass QTL 14 2.1 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 31172320 163586636 Rat 2298477 Eau4 Experimental allergic uveoretinitis QTL 4 0.0011 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 3 137398739 169034231 Rat 1300161 Rf10 Renal function QTL 10 3.57 renal blood flow trait (VT:2000006) absolute change in renal vascular resistance (CMO:0001900) 3 161192952 169034231 Rat 8552791 Vie2 Viral induced encephalitis QTL 2 4.1 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 3 145956084 169034231 Rat 2317883 Alcrsp26 Alcohol response QTL 26 1.8 0.63 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 3 145526770 169034231 Rat 9589106 Insul23 Insulin level QTL 23 13.86 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 3 131635904 169034231 Rat 10755461 Coatc16 Coat color QTL 16 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 3 122438700 167438700 Rat 1559282 Emca5 Estrogen-induced mammary cancer QTL 5 3.9 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 3 43827364 169034231 Rat 2303620 Vencon4 Ventilatory control QTL 4 3.9 respiration trait (VT:0001943) tidal volume (CMO:0000222) 3 127162703 168026850 Rat 1576306 Schws3 Schwannoma susceptibility QTL 3 0.001 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 3 118839124 163839124 Rat 2312659 Slep7 Serum leptin concentration QTL 7 0.001 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 3 98535255 168026850 Rat 1578666 Vnigr1 Vascular neointimal growth QTL 1 4.6 artery morphology trait (VT:0002191) artery lumen area (CMO:0001409) 3 149040888 168026850 Rat 1578656 Vnigr2 Vascular neointimal growth QTL 2 4.2 artery morphology trait (VT:0002191) lesioned artery residual lumen area (CMO:0001417) 3 130656562 169034231 Rat 8552952 Pigfal13 Plasma insulin-like growth factor 1 level QTL 13 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 3 138799500 169034231 Rat 12879871 Am7 Aortic mass QTL 7 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 3 145925360 166177555 Rat 631541 Bp81 Blood pressure QTL 81 4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 124122556 169034231 Rat 2312670 Bw94 Body weight QTL 94 0.01 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 3 98535255 168026850 Rat
BI280365
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 77,863,644 - 77,863,825 (+) MAPPER mRatBN7.2 mRatBN7.2 3 163,259,116 - 163,260,557 (+) MAPPER mRatBN7.2 Rnor_6.0 3 172,563,150 - 172,564,590 NCBI Rnor6.0 Rnor_6.0 14 83,220,339 - 83,220,519 NCBI Rnor6.0 Rnor_5.0 14 83,907,181 - 83,907,361 UniSTS Rnor5.0 Rnor_5.0 3 178,609,156 - 178,610,596 UniSTS Rnor5.0 RGSC_v3.4 14 83,615,693 - 83,615,873 UniSTS RGSC3.4 Celera 14 76,779,231 - 76,779,411 UniSTS Celera 3 162,432,501 - 162,433,941 UniSTS RH 3.4 Map 14 514.17 UniSTS Cytogenetic Map 14 q21 UniSTS
RH141286
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 163,263,089 - 163,263,299 (+) MAPPER mRatBN7.2 Rnor_6.0 3 172,567,123 - 172,567,332 NCBI Rnor6.0 Rnor_5.0 3 178,613,129 - 178,613,338 UniSTS Rnor5.0 Celera 3 162,436,474 - 162,436,683 UniSTS RH 3.4 Map 3 1496.9 UniSTS Cytogenetic Map 14 q21 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000071913 ⟹ ENSRNOP00000067815
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 163,260,476 - 163,261,450 (-) Ensembl Rnor_6.0 Ensembl 3 172,563,105 - 172,566,010 (-) Ensembl
RefSeq Acc Id:
NM_139099 ⟹ NP_620799
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 183,677,270 - 183,680,172 (-) NCBI mRatBN7.2 3 163,259,072 - 163,261,974 (-) NCBI Rnor_6.0 3 172,563,105 - 172,566,007 (-) NCBI Rnor_5.0 3 178,609,111 - 178,612,013 (-) NCBI Celera 3 162,432,456 - 162,435,358 (-) NCBI
Sequence:
GGAATTCCGGGGCTCAGGCTACTCTGAAGCGACCCAGCGTTCTGCCTGACACGCCCCGCTCGAGACACCATGGTGGCGTACTGGCGACAGGCTGGACTCAGCTACATCCGGTTCTCCCAGATCTGTGC
hide sequence
RefSeq Acc Id:
NP_620799 ⟸ NM_139099
- UniProtKB:
P29418 (UniProtKB/Swiss-Prot), A6KL35 (UniProtKB/TrEMBL)
- Sequence:
MVAYWRQAGLSYIRFSQICAKAVRDALKTEFKANAEKTSGTSIKTVKIKKE
hide sequence
Ensembl Acc Id:
ENSRNOP00000067815 ⟸ ENSRNOT00000071913
RGD ID: 13692722 Promoter ID: EPDNEW_R3247 Type: initiation region Name: Atp5f1e_1 Description: ATP synthase F1 subunit epsilon SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 3 172,566,040 - 172,566,100 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2017-11-30
Atp5f1e
ATP synthase F1 subunit epsilon
Atp5e
ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-09-10
Atp5e
ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit
Symbol and Name status set to approved
1299863 APPROVED
2002-08-07
Atp5e
ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit
Symbol and Name status set to provisional
70820 PROVISIONAL
