Advanced Search (OLGA)

Gene: Rassf9 (Ras association domain family member 9) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Rassf9

Name:

Ras association domain family member 9

RGD ID:

621329

Description:

Enables enzyme binding activity and protein domain specific binding activity. Involved in intracellular transport. Located in cytosol; recycling endosome; and trans-Golgi network transport vesicle membrane. Orthologous to human RASSF9 (Ras association domain family member 9); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3,3',4,4',5-pentachlorobiphenyl; ammonium chloride.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

P-cip1; PAM COOH-terminal interactor protein 1; Pamci; peptidylglycine alpha-amidating monooxygenase COOH-terminal interactor; Ras association (RalGDS/AF-6) domain family (N-terminal) member 9; ras association domain-containing protein 9

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	39,486,257 - 39,518,090 (+)	NCBI		GRCr8
mRatBN7.2	7	37,599,720 - 37,631,553 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	37,599,720 - 37,635,245 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	39,526,586 - 39,558,388 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	41,729,658 - 41,761,461 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	41,504,624 - 41,536,422 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	44,146,345 - 44,178,179 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	44,146,237 - 44,181,201 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	44,175,398 - 44,207,232 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	40,509,837 - 40,541,671 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	40,530,107 - 40,561,942 (+)	NCBI
Celera	7	34,562,208 - 34,594,055 (+)	NCBI		Celera
Cytogenetic Map	7	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rassf9	Rat	17beta-estradiol	increases expression	ISO	RASSF9 (Homo sapiens)	6480464	Estradiol results in increased expression of RASSF9 mRNA	CTD	PMID:21795739
Rassf9	Rat	17beta-estradiol	multiple interactions	ISO	RASSF9 (Homo sapiens)	6480464	Progesterone inhibits the reaction [Estradiol results in increased expression of RASSF9 mRNA]	CTD	PMID:21795739
Rassf9	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of RASSF9 mRNA	CTD	PMID:32109520 and PMID:34747641
Rassf9	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of RASSF9 mRNA	CTD	PMID:33387578
Rassf9	Rat	2,4-dibromophenyl 2,4,5-tribromophenyl ether	affects expression	ISO	Rassf9 (Mus musculus)	6480464	2 more ...	CTD	PMID:38648751
Rassf9	Rat	2-hydroxypropanoic acid	decreases expression	ISO	RASSF9 (Homo sapiens)	6480464	Lactic Acid results in decreased expression of RASSF9 mRNA	CTD	PMID:30851411
Rassf9	Rat	3,3',4,4',5-pentachlorobiphenyl	increases expression	EXP		6480464	3 more ...	CTD	PMID:23196670
Rassf9	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	Rassf9 (Mus musculus)	6480464	bisphenol S results in increased expression of RASSF9 mRNA	CTD	PMID:30951980
Rassf9	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of RASSF9 mRNA	CTD	PMID:16483693
Rassf9	Rat	benzo[a]pyrene	multiple interactions	ISO	Rassf9 (Mus musculus)	6480464	AHR protein affects the reaction [Benzo(a)pyrene affects the expression of RASSF9 mRNA]	CTD	PMID:22228805
Rassf9	Rat	benzo[a]pyrene	affects methylation	ISO	RASSF9 (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of RASSF9 promoter	CTD	PMID:27901495
Rassf9	Rat	benzo[a]pyrene	decreases methylation	ISO	RASSF9 (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased methylation of RASSF9 5' UTR	CTD	PMID:27901495
Rassf9	Rat	benzo[a]pyrene	increases expression	ISO	RASSF9 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased expression of RASSF9 mRNA	CTD	PMID:22316170
Rassf9	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of RASSF9 mRNA	CTD	PMID:25181051 more ...
Rassf9	Rat	bisphenol A	increases expression	ISO	Rassf9 (Mus musculus)	6480464	bisphenol A results in increased expression of RASSF9 mRNA	CTD	PMID:32156529
Rassf9	Rat	bisphenol A	decreases methylation	ISO	Rassf9 (Mus musculus)	6480464	bisphenol A results in decreased methylation of RASSF9 promoter	CTD	PMID:27312807
Rassf9	Rat	bisphenol F	increases expression	ISO	Rassf9 (Mus musculus)	6480464	bisphenol F results in increased expression of RASSF9 mRNA	CTD	PMID:30951980
Rassf9	Rat	butanal	decreases expression	ISO	RASSF9 (Homo sapiens)	6480464	butyraldehyde results in decreased expression of RASSF9 mRNA	CTD	PMID:26079696
Rassf9	Rat	carbon nanotube	decreases expression	ISO	Rassf9 (Mus musculus)	6480464	Nanotubes and Carbon analog results in decreased expression of RASSF9 mRNA	CTD	PMID:25554681
Rassf9	Rat	choline	multiple interactions	ISO	Rassf9 (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of RASSF9 mRNA	CTD	PMID:20938992
Rassf9	Rat	Cuprizon	increases expression	EXP		6480464	Cuprizone results in increased expression of RASSF9 mRNA	CTD	PMID:26577399
Rassf9	Rat	diethylstilbestrol	increases expression	EXP		6480464	Diethylstilbestrol results in increased expression of RASSF9 mRNA	CTD	PMID:21658437
Rassf9	Rat	diuron	decreases expression	EXP		6480464	Diuron results in decreased expression of RASSF9 mRNA	CTD	PMID:21551480
Rassf9	Rat	endosulfan	decreases expression	EXP		6480464	Endosulfan results in decreased expression of RASSF9 mRNA	CTD	PMID:29391264
Rassf9	Rat	flavonoids	increases expression	EXP		6480464	Flavonoids results in increased expression of RASSF9 mRNA	CTD	PMID:18035473
Rassf9	Rat	folic acid	multiple interactions	ISO	Rassf9 (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of RASSF9 mRNA	CTD	PMID:20938992
Rassf9	Rat	formaldehyde	decreases expression	ISO	RASSF9 (Homo sapiens)	6480464	Formaldehyde results in decreased expression of RASSF9 mRNA	CTD	PMID:20655997
Rassf9	Rat	FR900359	increases phosphorylation	ISO	RASSF9 (Homo sapiens)	6480464	FR900359 results in increased phosphorylation of RASSF9 protein	CTD	PMID:37730182
Rassf9	Rat	furan	increases expression	EXP		6480464	furan results in increased expression of RASSF9 mRNA	CTD	PMID:27387713
Rassf9	Rat	inulin	multiple interactions	ISO	Rassf9 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of RASSF9 mRNA	CTD	PMID:36331819
Rassf9	Rat	L-methionine	multiple interactions	ISO	Rassf9 (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of RASSF9 mRNA	CTD	PMID:20938992
Rassf9	Rat	Licochalcone B	decreases expression	ISO	RASSF9 (Homo sapiens)	6480464	licochalcone B results in decreased expression of RASSF9 mRNA	CTD	PMID:33647349
Rassf9	Rat	methamphetamine	decreases expression	EXP		6480464	Methamphetamine results in decreased expression of RASSF9 mRNA	CTD	PMID:19564919
Rassf9	Rat	methamphetamine	multiple interactions	EXP		6480464	[Methamphetamine co-treated with SCH 23390] results in decreased expression of RASSF9 mRNA	CTD	PMID:19564919
Rassf9	Rat	Muraglitazar	decreases expression	EXP		6480464	muraglitazar results in decreased expression of RASSF9 mRNA	CTD	PMID:21515302
Rassf9	Rat	N-nitrosodiethylamine	decreases expression	EXP		6480464	Diethylnitrosamine results in decreased expression of RASSF9 mRNA	CTD	PMID:20360939
Rassf9	Rat	nickel atom	decreases expression	ISO	RASSF9 (Homo sapiens)	6480464	Nickel results in decreased expression of RASSF9 mRNA	CTD	PMID:24768652 and PMID:25583101
Rassf9	Rat	paracetamol	decreases expression	ISO	RASSF9 (Homo sapiens)	6480464	Acetaminophen results in decreased expression of RASSF9 mRNA	CTD	PMID:26690555 and PMID:29067470
Rassf9	Rat	paracetamol	decreases expression	EXP		6480464	Acetaminophen results in decreased expression of RASSF9 mRNA	CTD	PMID:33387578
Rassf9	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	Rassf9 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of RASSF9 mRNA	CTD	PMID:36331819
Rassf9	Rat	pirinixic acid	increases expression	ISO	Rassf9 (Mus musculus)	6480464	pirinixic acid results in increased expression of RASSF9 mRNA	CTD	PMID:20813756
Rassf9	Rat	progesterone	multiple interactions	ISO	RASSF9 (Homo sapiens)	6480464	Progesterone inhibits the reaction [Estradiol results in increased expression of RASSF9 mRNA]	CTD	PMID:21795739
Rassf9	Rat	progesterone	decreases expression	ISO	Rassf9 (Mus musculus)	6480464	Progesterone results in decreased expression of RASSF9 mRNA	CTD	PMID:22238285
Rassf9	Rat	rac-lactic acid	decreases expression	ISO	RASSF9 (Homo sapiens)	6480464	Lactic Acid results in decreased expression of RASSF9 mRNA	CTD	PMID:30851411
Rassf9	Rat	SCH 23390	multiple interactions	EXP		6480464	[Methamphetamine co-treated with SCH 23390] results in decreased expression of RASSF9 mRNA	CTD	PMID:19564919
Rassf9	Rat	silicon dioxide	decreases expression	ISO	RASSF9 (Homo sapiens)	6480464	Silicon Dioxide analog results in decreased expression of RASSF9 mRNA	CTD	PMID:25895662
Rassf9	Rat	silicon dioxide	increases expression	ISO	RASSF9 (Homo sapiens)	6480464	Silicon Dioxide analog results in increased expression of RASSF9 mRNA and Silicon Dioxide results in increased expression of RASSF9 mRNA	CTD	PMID:23806026 and PMID:25351596
Rassf9	Rat	sotorasib	multiple interactions	ISO	RASSF9 (Homo sapiens)	6480464	[sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in decreased expression of RASSF9 mRNA	CTD	PMID:36139627
Rassf9	Rat	sunitinib	decreases expression	ISO	RASSF9 (Homo sapiens)	6480464	Sunitinib results in decreased expression of RASSF9 mRNA	CTD	PMID:31533062
Rassf9	Rat	thalidomide	decreases expression	ISO	Rassf9 (Mus musculus)	6480464	Thalidomide results in decreased expression of RASSF9 mRNA	CTD	PMID:26217789
Rassf9	Rat	titanium dioxide	decreases expression	ISO	Rassf9 (Mus musculus)	6480464	titanium dioxide results in decreased expression of RASSF9 mRNA	CTD	PMID:23557971
Rassf9	Rat	trametinib	multiple interactions	ISO	RASSF9 (Homo sapiens)	6480464	[sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in decreased expression of RASSF9 mRNA	CTD	PMID:36139627
Rassf9	Rat	trichostatin A	increases expression	ISO	RASSF9 (Homo sapiens)	6480464	trichostatin A results in increased expression of RASSF9 mRNA	CTD	PMID:24935251
Rassf9	Rat	troglitazone	decreases expression	EXP		6480464	troglitazone results in decreased expression of RASSF9 mRNA	CTD	PMID:21515302
Rassf9	Rat	vinclozolin	decreases expression	EXP		6480464	vinclozolin results in decreased expression of RASSF9 mRNA	CTD	PMID:22615374

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rassf9	Rat	endosomal transport	involved_in	NAS		633607	PMID:9837933	UniProt
Rassf9	Rat	intracellular transport	involved_in	IBA	PANTHER:PTN000392667 and Rassf9 (Rattus norvegicus)	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Rassf9	Rat	intracellular transport		IDA		633607		RGD
Rassf9	Rat	protein targeting	involved_in	NAS		633607	PMID:9837933	UniProt
Rassf9	Rat	signal transduction	involved_in	IEA	InterPro:IPR000159	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rassf9	Rat	cytosol	located_in	ISO	RASSF9 (Homo sapiens)	1624291	PMID:9837933	RGD	PMID:9837933
Rassf9	Rat	cytosol	is_active_in	IBA	PANTHER:PTN000392667 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Rassf9	Rat	cytosol	located_in	IDA		633607	PMID:9837933	UniProt
Rassf9	Rat	cytosol	located_in	IEA	UniProtKB:O75901 and ensembl:ENSP00000354884	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Rassf9	Rat	endosome		IDA		633607		RGD
Rassf9	Rat	endosome	located_in	IEA	UniProtKB-KW:KW-0967	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Rassf9	Rat	endosome	located_in	IEA	UniProtKB-SubCell:SL-0101	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Rassf9	Rat	endosome	located_in	IDA		633607	PMID:9837933	UniProt
Rassf9	Rat	endosome	located_in	ISO	RASSF9 (Homo sapiens)	1624291	PMID:9837933	RGD	PMID:9837933
Rassf9	Rat	endosome	located_in	IEA	UniProtKB:O75901 and ensembl:ENSP00000354884	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Rassf9	Rat	recycling endosome		IDA		633607		RGD
Rassf9	Rat	recycling endosome	is_active_in	IBA	PANTHER:PTN000392667 and Rassf9 (Rattus norvegicus)	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Rassf9	Rat	trans-Golgi network transport vesicle membrane	located_in	IEA	UniProtKB:O75901 and ensembl:ENSP00000354884	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Rassf9	Rat	trans-Golgi network transport vesicle membrane	is_active_in	IBA	PANTHER:PTN000392667 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Rassf9	Rat	trans-Golgi network transport vesicle membrane	located_in	ISO	RASSF9 (Homo sapiens)	1624291	PMID:9837933	RGD	PMID:9837933
Rassf9	Rat	trans-Golgi network transport vesicle membrane	located_in	IDA		633607	PMID:9837933	UniProt

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rassf9	Rat	enzyme binding		IPI	Pam (Rattus norvegicus)	633607		RGD
Rassf9	Rat	protein binding	enables	IPI	UniProtKB:P14925	728662	PMID:8910496	IntAct
Rassf9	Rat	protein binding	enables	ISO	RASSF9 (Homo sapiens)	1624291	UniProtKB:P19021 and PMID:9837933	RGD	PMID:9837933
Rassf9	Rat	protein binding	enables	IPI	UniProtKB:P14925	633607	PMID:9837933	IntAct
Rassf9	Rat	protein domain specific binding		IPI	Pam (Rattus norvegicus)	633607		RGD

#	Reference Title	Reference Citation
1.	Novel proteins that interact with the COOH-terminal cytosolic routing determinants of an integral membrane peptide-processing enzyme.	Alam MR, etal., J Biol Chem 1996 Nov 8;271(45):28636-40.
2.	P-CIP1, a novel protein that interacts with the cytosolic domain of peptidylglycine alpha-amidating monooxygenase, is associated with endosomes.	Chen L, etal., J Biol Chem 1998 Dec 11;273(50):33524-32.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	GOA pipeline	RGD automated data pipeline
8.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:18570454

Rassf9
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	39,486,257 - 39,518,090 (+)	NCBI		GRCr8
mRatBN7.2	7	37,599,720 - 37,631,553 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	37,599,720 - 37,635,245 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	39,526,586 - 39,558,388 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	41,729,658 - 41,761,461 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	41,504,624 - 41,536,422 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	44,146,345 - 44,178,179 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	44,146,237 - 44,181,201 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	44,175,398 - 44,207,232 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	40,509,837 - 40,541,671 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	40,530,107 - 40,561,942 (+)	NCBI
Celera	7	34,562,208 - 34,594,055 (+)	NCBI		Celera
Cytogenetic Map	7	q21	NCBI

RASSF9
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	85,800,703 - 85,836,409 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	85,800,703 - 85,836,409 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	12	86,194,481 - 86,230,187 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	84,722,462 - 84,754,449 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	12	84,700,798 - 84,732,551	NCBI
Celera	12	85,861,052 - 85,893,065 (-)	NCBI		Celera
Cytogenetic Map	12	q21.31	NCBI
HuRef	12	83,254,816 - 83,286,827 (-)	NCBI		HuRef
CHM1_1	12	86,163,121 - 86,195,108 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	12	85,781,370 - 85,817,046 (-)	NCBI		T2T-CHM13v2.0

Rassf9
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	102,348,083 - 102,385,598 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	102,348,083 - 102,385,597 (+)	Ensembl		GRCm39 Ensembl
GRCm38	10	102,512,222 - 102,549,737 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	102,512,222 - 102,549,736 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	101,974,856 - 102,009,194 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	10	101,941,910 - 101,976,248 (+)	NCBI		MGSCv36	mm8
Celera	10	104,446,473 - 104,480,811 (+)	NCBI		Celera
Cytogenetic Map	10	D1	NCBI
cM Map	10	53.56	NCBI

Rassf9
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955405	23,677,319 - 23,711,542 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955405	23,677,319 - 23,711,542 (-)	NCBI	ChiLan1.0	ChiLan1.0

RASSF9
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	93,854,026 - 93,898,013 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	93,857,294 - 93,894,411 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	83,331,750 - 83,367,348 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	86,574,486 - 86,606,877 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	86,574,635 - 86,575,918 (-)	Ensembl	panpan1.1		panPan2

RASSF9
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	15	27,304,618 - 27,331,876 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	15	27,308,088 - 27,309,347 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	15	27,747,833 - 27,775,420 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	15	27,917,941 - 27,945,543 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	15	27,920,198 - 27,945,729 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	15	27,270,333 - 27,297,925 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	15	27,311,017 - 27,338,600 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	15	27,600,327 - 27,627,944 (-)	NCBI		UU_Cfam_GSD_1.0

Rassf9
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	32,938,009 - 32,970,745 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936507	3,262,493 - 3,297,571 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936507	3,265,356 - 3,297,495 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RASSF9
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	96,297,661 - 96,341,750 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	5	96,296,580 - 96,341,751 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

RASSF9
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	81,199,766 - 81,233,027 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	81,200,262 - 81,231,842 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666037	164,098,405 - 164,127,114 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rassf9
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624837	4,975,321 - 5,005,418 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624837	4,975,582 - 5,005,419 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Rassf9
209 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	62
Count of miRNA genes:	50
Interacting mature miRNAs:	53
Transcripts:	ENSRNOT00000058842
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354644	Spl4	Serum phospholipid level QTL 4	4.9		blood phospholipid amount (VT:0006084)	blood phospholipid level (CMO:0001169)	7	19654317	49753746	Rat
7411569	Bw137	Body weight QTL 137		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	7	21921195	66921195	Rat
9590102	Sffal5	Serum free fatty acids level QTL 5	8.62	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	7	5329019	50329019	Rat
1578652	Bmd15	Bone mineral density QTL 15	5.2		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	7	9866467	60460686	Rat
1641885	Alcrsp9	Alcohol response QTL 9			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	7	24099606	69099606	Rat
631503	Bp102	Blood pressure QTL 102	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	1	44822433	Rat
1549840	Bss5	Bone structure and strength QTL 5	9.8		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	7	24751841	69751841	Rat
10755438	Coatc9	Coat color QTL 9		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	3529280	48529280	Rat
1300127	Srn1	Serum renin concentration QTL 1	3.87		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	7	29409683	84928080	Rat
2298547	Neuinf5	Neuroinflammation QTL 5	3.7		nervous system integrity trait (VT:0010566)	spinal cord Cd74 protein level (CMO:0002131)	7	9462246	58265113	Rat
10059592	Kidm45	Kidney mass QTL 45	3.95	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	7	7573985	52573985	Rat
10755440	Coatc10	Coat color QTL 10		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	7496499	52496499	Rat
1354637	Scl30	Serum cholesterol level QTL 30	3.7		blood cholesterol amount (VT:0000180)	blood total cholesterol level (CMO:0000051)	7	19654317	49753746	Rat
10755453	Coatc12	Coat color QTL 12		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	31112832	76112832	Rat
1354639	Spl5	Serum phospholipid level QTL 5	3.9		blood LDL phospholipid amount (VT:0010505)	blood low density lipoprotein phospholipid level (CMO:0001568)	7	19654317	52888450	Rat
10755451	Coatc11	Coat color QTL 11		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	17944357	62944357	Rat
2317059	Aia15	Adjuvant induced arthritis QTL 15	2.46		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	7	17004598	62004598	Rat
61410	Bw19	Body weight QTL 19	6.2	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	7	1	44782185	Rat
7411605	Foco14	Food consumption QTL 14	24.1	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	34293282	79293282	Rat
1643004	Pain2	Pain QTL 2	1		mechanical nociception trait (VT:0002734)	self mutilation severity score (CMO:0002145)	7	9462246	98011544	Rat
631534	Lnnr1	Liver neoplastic nodule remodeling QTL 1	3.85	0.001	liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705)	7	34293282	79293282	Rat
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	924703	115097879	Rat
1582260	Bw72	Body weight QTL 72	3.2	0.0043	body mass (VT:0001259)	body weight (CMO:0000012)	7	15795565	38073970	Rat
1582261	Bw69	Body weight QTL 69	3.2	0.0048	body mass (VT:0001259)	body weight (CMO:0000012)	7	15795565	38073970	Rat
1582262	Bw75	Body weight QTL 75	3	0.0038	body mass (VT:0001259)	body weight (CMO:0000012)	7	15795565	38073970	Rat
70190	Mcs6	Mammary carcinoma susceptibility QTL 6	2.29		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	7	26737401	63902784	Rat
1300132	Bp182	Blood pressure QTL 182	3.49		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	7	19654317	84928080	Rat
1300138	Hrtrt9	Heart rate QTL 9	4.72		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	7	29409683	53612950	Rat
10402855	Bp379	Blood pressure QTL 379		0.21	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	29409683	74409683	Rat
738033	Anxrr6	Anxiety related response QTL 6	4.1		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	7	15573889	60573889	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	59	31


RefSeq Transcripts	NM_022959	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF056208	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473960	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000058842 ⟹ ENSRNOP00000055632

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	37,603,099 - 37,635,245 (+)	Ensembl
Rnor_6.0 Ensembl	7	44,146,237 - 44,181,201 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000108456 ⟹ ENSRNOP00000095461

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	37,599,720 - 37,631,553 (+)	Ensembl

RefSeq Acc Id:

NM_022959 ⟹ NP_075248

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	39,486,257 - 39,518,090 (+)	NCBI
mRatBN7.2	7	37,599,720 - 37,631,553 (+)	NCBI
Rnor_6.0	7	44,146,345 - 44,178,179 (+)	NCBI
Rnor_5.0	7	44,175,398 - 44,207,232 (+)	NCBI
RGSC_v3.4	7	40,509,837 - 40,541,671 (+)	RGD
Celera	7	34,562,208 - 34,594,055 (+)	RGD

Sequence:

show sequence

ATCCTCCCTTCCTCCCTCTCTGACTCTCCCTCTGCCTCTCTCCGTCTCTCTCTTCTCTTCTGTCTTTGGAGCTTCTAAACACCTTCTTCCTGGCTGAAGCTGGGCTGGTTTCCCTAGACACAGCAGCC
ACAACAATTTGGCAGTTCAAAGTTGGACAGCAATTGCACAACTTCTAGCAACTCTCTCAGCCAGCTGCTAATGAGCTTGAAAGCAAGGAACATCTGAGGAGCTGAAAAGGAAGCCTCCAGCCTTCCTC
CTTTCACCAGAGAGACCAGACACCCCTCCCAGGGCCCAGATTACTTTGAGATAAGGACTGTGTTATTTGCCTGTCCTGCCGGACAGACAGACCATGGCTCCCTTTGGAAGAAACTTGCTGAAGACGCG
GCATAAGAACAGATCTCCAACTAAAGACATGGATCCTGAAGAGAAGGAAATTGTGGTTTGGGTTTGCCAGGAGGAGAAGATTGTCTGCGGATTAACTAAACGCACCACCTCCATCGATGTCATCCAGG
CTTTGCTTGAAGAACATGAAGCTACATTTGGAGAAAAGCGATTTCTGTTGGGTAAGGCCAGTGACTACTGCATCGTCGAAAAGTGGAGGGGCTCAGAGCGAGCTCTTCCTCCCCTGACCAGGATCTTG
AAGCTGTGGAAGGCTTGGGGAGATGAACAGCCCAACATGCAGTTTGTTTTGGTTAAAACAGACGCCTTCCTCCCAGTTCCACTGTGGCGGACAGCTGAAACCAAACTAGTGCAAAATAATGAAAAACC
TTGGGAGCTCAGCCCGGCGAATTACATGAAGACTTTACCACCAGATAAACAAAAACGAATCGTCAGGAAAACCTTCCGGAAACTGGCTAAAATTAGACAGGACACAGGTTCTCATGATCGGGACAATA
TGGAGTGTTTAGTTCATCTGATTATTTCTCAGGACCACACGATCCACCAGCAAGTACAAAGAATGAAAGAGTTAGATATGGAAATTGAAAAATGTGAAGCCAAGATCCATTTGGACCGGATAGGGAAT
GATGGGGCTGATTATGTCCAGGAGGCGTATTTAATGCCCAGGTCCAGTGAAGAAGAGCAAAAGCTAGACTTTCAATCTGAGGACAACCAGACCCTAGAGGATCTGAACGACGGCGAGGGGGTGTCACA
GCTGGAGGAACAGCTGCAATACTACAGAGCGCTCATCGATAAGCTGTCTGCTGAGATTGAGAGAGAGGTGAAGGGTGCGGGCACTGACGGGAGTGAGGACATGGAGGGAGCAGCTGCATGTGAGCTGG
AAAACTCGGATTTGGAAAGCGTTAAGTGCGATTTGGAGAAAAGTATGAAAGCTGGTTTGAAAATCCACTCTCACTTGAGTGGCATCCAGAGAGAGATTAAATACAGTGACTCACTGCTTCAGATGAAA
GCGAGGGAGTACGAACTCCTAGCCAAGGAGTTCAGCTCACTTCATATTAGCAGCAAAGATGGATGTCAGGGAAAAGAAAACAGAGGAAAGGAAGCCGAGGCTTCCAGCAGCAATGGGGAGATCCCTCC
ATTAACTCAAAGGGTGTTTAACACATATACAAATGACACGGATTCAGATACTGGCATCAGTTCCAACCACAGTCAGGATTCTGAAACGACTTTGGGAGATGTGCTACTGCTGGCAACTTAATTCTGAT
GGCTTCTTTCTGACCTTTAATGATACTTTGTGTGGTTTACCAAGGAACTCTATTCTGTATACAACTTTGTGAAAGTGTAAACCATGCTGAAGTACTCGGTAGTTAATAAAAACTAGTGGCC

hide sequence


Protein RefSeqs	NP_075248	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAD03249	(Get FASTA)	NCBI Sequence Viewer
	EDM16789	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000095461
GenBank Protein	O88869	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_075248 ⟸ NM_022959

- UniProtKB:

O88869 (UniProtKB/Swiss-Prot), A0A8I6ANH4 (UniProtKB/TrEMBL), A6IGA9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAPFGRNLLKTRHKNRSPTKDMDPEEKEIVVWVCQEEKIVCGLTKRTTSIDVIQALLEEHEATFGEKRFLLGKASDYCIVEKWRGSERALPPLTRILKLWKAWGDEQPNMQFVLVKTDAFLPVPLWRT
AETKLVQNNEKPWELSPANYMKTLPPDKQKRIVRKTFRKLAKIRQDTGSHDRDNMECLVHLIISQDHTIHQQVQRMKELDMEIEKCEAKIHLDRIGNDGADYVQEAYLMPRSSEEEQKLDFQSEDNQT
LEDLNDGEGVSQLEEQLQYYRALIDKLSAEIEREVKGAGTDGSEDMEGAAACELENSDLESVKCDLEKSMKAGLKIHSHLSGIQREIKYSDSLLQMKAREYELLAKEFSSLHISSKDGCQGKENRGKE
AEASSSNGEIPPLTQRVFNTYTNDTDSDTGISSNHSQDSETTLGDVLLLAT

hide sequence

Ensembl Acc Id:

ENSRNOP00000055632 ⟸ ENSRNOT00000058842

Ensembl Acc Id:

ENSRNOP00000095461 ⟸ ENSRNOT00000108456

Protein Domains

Ras-associating

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O88869-F1-model_v2	AlphaFold	O88869	1-435	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13695177

Promoter ID:

EPDNEW_R5702

Type:

initiation region

Name:

Rassf9_1

Description:

Ras association domain family member 9

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	7	44,146,326 - 44,146,386	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-34222	BioCyc
Ensembl Genes	ENSRNOG00000038574	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000108456	ENTREZGENE
Gene3D-CATH	Phosphatidylinositol 3-kinase Catalytic Subunit, Chain A, domain 1	UniProtKB/Swiss-Prot
InterPro	N-RASSF	UniProtKB/Swiss-Prot
	RA_dom	UniProtKB/Swiss-Prot
	RASSF9_RA	UniProtKB/Swiss-Prot
	Ubiquitin-like_domsf	UniProtKB/Swiss-Prot
KEGG Report	rno:65053	UniProtKB/Swiss-Prot
NCBI Gene	65053	ENTREZGENE
PANTHER	PTHR15286	UniProtKB/Swiss-Prot
	PTHR15286:SF10	UniProtKB/Swiss-Prot
PhenoGen	Rassf9	PhenoGen
PROSITE	PS50200	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000038574	RatGTEx
SMART	SM00314	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF54236	UniProtKB/Swiss-Prot
UniProt	A0A8I6ANH4	ENTREZGENE, UniProtKB/TrEMBL
	A6IGA9	ENTREZGENE, UniProtKB/TrEMBL
	F1LNM7_RAT	UniProtKB/TrEMBL
	O88869	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-02-03	Rassf9	Ras association domain family member 9	Rassf9	Ras association (RalGDS/AF-6) domain family (N-terminal) member 9	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-25	Rassf9	Ras association (RalGDS/AF-6) domain family (N-terminal) member 9	Pamci	peptidylglycine alpha-amidating monooxygenase COOH-terminal interactor	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-02-11	Pamci	peptidylglycine alpha-amidating monooxygenase COOH-terminal interactor	P-cip1	PAM COOH-terminal interactor protein 1	Symbol and Name updated to reflect Human and Mouse nomenclature	625702	APPROVED
2002-08-07	P-cip1	PAM COOH-terminal interactor protein 1			Symbol and Name status set to provisional	70820	PROVISIONAL

Note Type	Note	Reference
gene_domains	contains several potential serine/threonine phosphorylation sites and a predicted C-terminal coiled-coil domain	633607

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message