Symbol:
Lss
Name:
lanosterol synthase
RGD ID:
620955
Description:
Enables lanosterol synthase activity. Involved in cholesterol biosynthetic process. Predicted to be located in endoplasmic reticulum membrane. Predicted to be active in lipid droplet. Human ortholog(s) of this gene implicated in alopecia-mental retardation syndrome 4; cataract; cataract 44; and hypotrichosis 14. Orthologous to human LSS (lanosterol synthase); PARTICIPATES IN cholesterol biosynthetic pathway; alendronate pharmacodynamics pathway; cholesterol ester storage disease pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
2,3-epoxysqualene--lanosterol cyclase; 2,3-oxidosqualene: lanosterol cyclase; lanosterol synthase (2,3-oxidosqualene-lanosterol cyclase); LOC103690153; OSC; oxidosqualene--lanosterol cyclase; uncharacterized LOC103690153
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
LSS (lanosterol synthase) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, Panther
Mus musculus (house mouse):
Lss (lanosterol synthase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Lss (lanosterol synthase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
LSS (lanosterol synthase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
LSS (lanosterol synthase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Lss (lanosterol synthase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
LSS (lanosterol synthase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
LSS (lanosterol synthase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Lss (lanosterol synthase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Lss (lanosterol synthase)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
LSS (lanosterol synthase)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
lss (lanosterol synthase (2,3-oxidosqualene-lanosterol cyclase))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
ERG7
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
lss
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Allele / Splice:
Lssem2Mcwi
Genetic Models:
SS-Lssem2Mcwi
Is Marker For:
Strains:
SCR/Sscr
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 12,090,641 - 12,118,230 (-) NCBI GRCr8 mRatBN7.2 20 12,091,138 - 12,118,858 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 12,092,774 - 12,118,762 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 12,789,080 - 12,815,472 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 12,150,002 - 12,176,395 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 12,621,780 - 12,648,174 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 12,844,522 - 12,870,474 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 12,842,884 - 12,870,497 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 15,337,114 - 15,338,473 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Rnor_5.0 20 15,000,298 - 15,027,581 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 12,507,575 - 12,534,612 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 20 12,507,801 - 12,534,839 (-) NCBI Celera 20 13,590,952 - 13,616,816 (-) NCBI Celera Cytogenetic Map 20 p12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Lss Rat (+/-)-Aegeline multiple interactions ISO RGD:733768 6480464 [Caffeine co-treated with coclaurine co-treated with aegeline co-treated with higenamine co-treated with Yohimbine co-treated with more ... CTD PMID:28843594 Lss Rat (RS)-coclaurine multiple interactions ISO RGD:733768 6480464 [Caffeine co-treated with coclaurine co-treated with aegeline co-treated with higenamine co-treated with Yohimbine co-treated with more ... CTD PMID:28843594 Lss Rat (RS)-norcoclaurine multiple interactions ISO RGD:733768 6480464 [Caffeine co-treated with coclaurine co-treated with aegeline co-treated with higenamine co-treated with Yohimbine co-treated with more ... CTD PMID:28843594 Lss Rat (S)-coclaurine multiple interactions ISO RGD:733768 6480464 [Caffeine co-treated with coclaurine co-treated with aegeline co-treated with higenamine co-treated with Yohimbine co-treated with more ... CTD PMID:28843594 Lss Rat 1,2-dimethylhydrazine affects expression ISO RGD:733768 6480464 1,2-Dimethylhydrazine affects the expression of LSS mRNA CTD PMID:22206623 Lss Rat 1-[(4-chlorophenyl)-phenylmethyl]-4-methylpiperazine increases expression ISO RGD:736635 6480464 chlorcyclizine results in increased expression of LSS mRNA CTD PMID:15342952 Lss Rat 1-naphthyl isothiocyanate multiple interactions ISO RGD:736635 6480464 [1-Naphthylisothiocyanate co-treated with Cholic Acids] affects the expression of LSS mRNA CTD PMID:27344345 Lss Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of LSS mRNA CTD PMID:30723492 Lss Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of LSS mRNA CTD PMID:17351261 Lss Rat 17beta-estradiol multiple interactions ISO RGD:736635 6480464 [Estradiol co-treated with Progesterone] results in increased expression of LSS mRNA CTD PMID:20660070 Lss Rat 17beta-estradiol increases expression ISO RGD:733768 6480464 Estradiol results in increased expression of LSS mRNA CTD PMID:39298647 Lss Rat 17beta-estradiol affects expression EXP 6480464 Estradiol affects the expression of LSS mRNA CTD PMID:32145629 Lss Rat 17beta-estradiol decreases expression ISO RGD:733768 6480464 Estradiol results in decreased expression of LSS mRNA CTD PMID:19484750 Lss Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO RGD:733768 6480464 [Tetrachlorodibenzodioxin co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with Diethylhexyl Phthalate co-treated with bisphenol A] results in decreased more ... CTD PMID:28433925 Lss Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO RGD:736635 6480464 2,2',4,4'-tetrabromodiphenyl ether affects the expression of LSS mRNA CTD PMID:31173147 Lss Rat 2,2',5,5'-tetrachlorobiphenyl decreases expression EXP 6480464 2,5,2',5'-tetrachlorobiphenyl results in decreased expression of LSS mRNA CTD PMID:23829299 Lss Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:736635 6480464 Tetrachlorodibenzodioxin results in decreased expression of LSS mRNA CTD PMID:20106945 Lss Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of LSS mRNA CTD PMID:34747641 Lss Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:733768 6480464 [Tetrachlorodibenzodioxin co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with Diethylhexyl Phthalate co-treated with bisphenol A] results in decreased more ... CTD PMID:28433925 Lss Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:733768 6480464 Tetrachlorodibenzodioxin affects the expression of LSS mRNA CTD PMID:21570461|PMID:28922406 Lss Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of LSS mRNA CTD PMID:22298810 Lss Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:736635 6480464 Tetrachlorodibenzodioxin affects the expression of LSS mRNA CTD PMID:22298810 Lss Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2,3,7,8-tetrachlorodibenzofuran results in decreased expression of LSS mRNA CTD PMID:32109520 Lss Rat 2,4-dinitrotoluene affects expression EXP 6480464 2,4-dinitrotoluene affects the expression of LSS mRNA CTD PMID:21346803 Lss Rat 2,6-dimethoxyphenol multiple interactions ISO RGD:736635 6480464 [Furaldehyde co-treated with pyrogallol 1,3-dimethyl ether] results in decreased expression of LSS protein; [pyrogallol 1,3-dimethyl more ... CTD PMID:38598786 Lss Rat 2,6-dinitrotoluene affects expression EXP 6480464 2,6-dinitrotoluene affects the expression of LSS mRNA CTD PMID:21346803 Lss Rat 22-Hydroxycholesterol decreases expression ISO RGD:736635 6480464 22-hydroxycholesterol results in decreased expression of LSS mRNA CTD PMID:19426978 Lss Rat 3,3',4,4',5-pentachlorobiphenyl increases expression EXP 6480464 3,4,5,3',4'-pentachlorobiphenyl results in increased expression of LSS mRNA CTD PMID:23196670 Lss Rat 3,3',5-triiodo-L-thyronine increases expression EXP 6480464 Triiodothyronine results in increased expression of LSS mRNA CTD PMID:15953391 Lss Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin analog results in increased expression of LSS protein; alpha-Chlorohydrin results in increased expression of more ... CTD PMID:26597043 Lss Rat 3H-1,2-dithiole-3-thione decreases expression EXP 6480464 1,2-dithiol-3-thione results in decreased expression of LSS mRNA CTD PMID:19162173 Lss Rat 4,4'-sulfonyldiphenol affects expression ISO RGD:733768 6480464 bisphenol S affects the expression of LSS mRNA CTD PMID:39298647 Lss Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:733768 6480464 bisphenol S results in increased expression of LSS mRNA CTD PMID:34850234 Lss Rat 4-hydroxyphenyl retinamide decreases expression ISO RGD:733768 6480464 Fenretinide results in decreased expression of LSS mRNA CTD PMID:28973697 Lss Rat 5-fluorouracil affects response to substance ISO RGD:736635 6480464 LSS protein affects the susceptibility to Fluorouracil CTD PMID:16217747 Lss Rat 7,12-dimethyltetraphene decreases expression ISO RGD:733768 6480464 9,10-Dimethyl-1,2-benzanthracene metabolite results in decreased expression of LSS mRNA CTD PMID:32553695 Lss Rat 8-Br-cAMP decreases expression ISO RGD:736635 6480464 8-Bromo Cyclic Adenosine Monophosphate results in decreased expression of LSS mRNA CTD PMID:22079614 Lss Rat AB-Fubinaca affects expression EXP 6480464 AB-FUBINACA affects the expression of LSS mRNA CTD PMID:26517302 Lss Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of LSS mRNA CTD PMID:31881176 Lss Rat Acetyl tributyl citrate decreases expression ISO RGD:733768 6480464 2-acetyltributylcitrate results in decreased expression of LSS mRNA CTD PMID:37055963 Lss Rat acrylamide decreases expression ISO RGD:736635 6480464 Acrylamide results in decreased expression of LSS mRNA CTD PMID:32763439 Lss Rat afimoxifene increases expression ISO RGD:736635 6480464 afimoxifene results in increased expression of LSS mRNA CTD PMID:16849584 Lss Rat aflatoxin B1 affects expression ISO RGD:736635 6480464 Aflatoxin B1 affects the expression of LSS protein CTD PMID:20106945 Lss Rat aflatoxin B1 decreases expression ISO RGD:736635 6480464 Aflatoxin B1 results in decreased expression of LSS mRNA CTD PMID:21641981|PMID:22100608|PMID:27153756 Lss Rat aflatoxin B1 decreases methylation ISO RGD:736635 6480464 Aflatoxin B1 results in decreased methylation of LSS gene; Aflatoxin B1 results in decreased methylation more ... CTD PMID:27153756|PMID:30157460 Lss Rat aflatoxin B1 decreases expression ISO RGD:733768 6480464 Aflatoxin B1 results in decreased expression of LSS mRNA CTD PMID:19770486 Lss Rat aldrin increases expression ISO RGD:733768 6480464 Aldrin results in increased expression of LSS mRNA CTD PMID:18579281 Lss Rat amiodarone increases expression EXP 6480464 Amiodarone results in increased expression of LSS mRNA CTD PMID:19224547|PMID:22291062 Lss Rat amiodarone affects expression ISO RGD:736635 6480464 Amiodarone affects the expression of LSS mRNA CTD PMID:29248575 Lss Rat amiodarone increases expression ISO RGD:733768 6480464 Amiodarone results in increased expression of LSS mRNA CTD PMID:24489787 Lss Rat amiodarone increases expression ISO RGD:736635 6480464 Amiodarone results in increased expression of LSS mRNA CTD PMID:15342952|PMID:17567588 Lss Rat amitriptyline increases expression ISO RGD:736635 6480464 Amitriptyline results in increased expression of LSS mRNA CTD PMID:15342952|PMID:17175557|PMID:17567588 Lss Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of LSS mRNA CTD PMID:16483693 Lss Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of LSS mRNA CTD PMID:30779732 Lss Rat antimony(0) decreases expression ISO RGD:736635 6480464 Antimony results in decreased expression of LSS mRNA CTD PMID:17547211 Lss Rat arachidonic acid decreases expression ISO RGD:736635 6480464 Arachidonic Acid results in decreased expression of LSS mRNA CTD PMID:16704987 Lss Rat Archazolid B increases expression ISO RGD:736635 6480464 archazolid B results in increased expression of LSS mRNA CTD PMID:25218289 Lss Rat aristolochic acid A increases expression ISO RGD:736635 6480464 aristolochic acid I results in increased expression of LSS mRNA CTD PMID:33212167 Lss Rat Aroclor 1254 increases expression EXP 6480464 Chlorodiphenyl (54% Chlorine) results in increased expression of LSS mRNA CTD PMID:18178546 Lss Rat arsane decreases ubiquitination ISO RGD:736635 6480464 Arsenic results in decreased ubiquitination of LSS protein CTD PMID:35994080 Lss Rat arsane multiple interactions ISO RGD:736635 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Lss Rat arsenic atom decreases ubiquitination ISO RGD:736635 6480464 Arsenic results in decreased ubiquitination of LSS protein CTD PMID:35994080 Lss Rat arsenic atom multiple interactions ISO RGD:736635 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Lss Rat atrazine decreases expression EXP 6480464 Atrazine results in decreased expression of LSS mRNA CTD PMID:36841081 Lss Rat avobenzone increases expression ISO RGD:736635 6480464 avobenzone results in increased expression of LSS mRNA CTD PMID:31016361 Lss Rat azoxystrobin affects expression ISO RGD:736635 6480464 azoxystrobin affects the expression of LSS mRNA CTD PMID:33512557 Lss Rat benzatropine multiple interactions ISO RGD:736635 6480464 [Cuprizone co-treated with Benztropine] results in decreased expression of LSS protein CTD PMID:34122009 Lss Rat benzene-1,2,4-triol decreases expression ISO RGD:736635 6480464 hydroxyhydroquinone results in decreased expression of LSS mRNA CTD PMID:39245080 Lss Rat benzo[a]pyrene decreases expression ISO RGD:733768 6480464 Benzo(a)pyrene results in decreased expression of LSS mRNA CTD PMID:19770486|PMID:22228805 Lss Rat benzo[a]pyrene affects methylation ISO RGD:736635 6480464 Benzo(a)pyrene affects the methylation of LSS intron CTD PMID:30157460 Lss Rat benzo[a]pyrene decreases expression ISO RGD:736635 6480464 Benzo(a)pyrene results in decreased expression of LSS mRNA CTD PMID:20106945|PMID:21632981|PMID:21871943|PMID:26238291|PMID:32234424 Lss Rat benzo[a]pyrene increases expression ISO RGD:733768 6480464 Benzo(a)pyrene results in increased expression of LSS mRNA CTD PMID:21964900 Lss Rat benzo[a]pyrene multiple interactions ISO RGD:733768 6480464 AHR protein affects the reaction [Benzo(a)pyrene affects the expression of LSS mRNA] CTD PMID:22228805 Lss Rat benzo[b]fluoranthene decreases expression ISO RGD:733768 6480464 benzo(b)fluoranthene results in decreased expression of LSS mRNA CTD PMID:26377693 Lss Rat benzo[e]pyrene decreases methylation ISO RGD:736635 6480464 benzo(e)pyrene results in decreased methylation of LSS intron CTD PMID:30157460 Lss Rat beta-lapachone decreases expression ISO RGD:736635 6480464 beta-lapachone results in decreased expression of LSS mRNA CTD PMID:38218311 Lss Rat beta-naphthoflavone multiple interactions ISO RGD:733768 6480464 AHR protein affects the reaction [beta-Naphthoflavone results in decreased expression of LSS mRNA] CTD PMID:22234961 Lss Rat beta-naphthoflavone decreases expression ISO RGD:733768 6480464 beta-Naphthoflavone results in decreased expression of LSS mRNA CTD PMID:22234961 Lss Rat beta-naphthoflavone multiple interactions ISO RGD:736635 6480464 AHR protein affects the reaction [beta-Naphthoflavone results in decreased expression of LSS mRNA] CTD PMID:22234961 Lss Rat beta-naphthoflavone decreases expression ISO RGD:736635 6480464 beta-Naphthoflavone results in decreased expression of LSS mRNA CTD PMID:22234961 Lss Rat bis(2-ethylhexyl) phthalate increases expression ISO RGD:733768 6480464 Diethylhexyl Phthalate results in increased expression of LSS mRNA CTD PMID:19850644 Lss Rat bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of LSS mRNA CTD PMID:37560165 Lss Rat bis(2-ethylhexyl) phthalate multiple interactions ISO RGD:733768 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated more ... CTD PMID:19850644|PMID:28433925|PMID:35739755 Lss Rat bisphenol A increases expression ISO RGD:733768 6480464 bisphenol A results in increased expression of LSS mRNA CTD PMID:21932408|PMID:25168180|PMID:25270620 Lss Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of LSS mRNA CTD PMID:31771501 Lss Rat bisphenol A decreases expression ISO RGD:736635 6480464 bisphenol A results in decreased expression of LSS protein CTD PMID:37567409 Lss Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of LSS mRNA CTD PMID:32145629 Lss Rat bisphenol A affects expression ISO RGD:736635 6480464 bisphenol A affects the expression of LSS mRNA CTD PMID:30903817 Lss Rat bisphenol A multiple interactions ISO RGD:733768 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated more ... CTD PMID:28433925|PMID:35739755 Lss Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of LSS gene CTD PMID:28505145 Lss Rat bisphenol A increases expression ISO RGD:736635 6480464 bisphenol A results in increased expression of LSS mRNA; bisphenol A results in increased expression more ... CTD PMID:29275510|PMID:34186270 Lss Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of LSS mRNA CTD PMID:25181051|PMID:30816183 Lss Rat bisphenol AF increases expression ISO RGD:736635 6480464 bisphenol AF results in increased expression of LSS protein CTD PMID:34186270 Lss Rat Bisphenol B increases expression ISO RGD:736635 6480464 bisphenol B results in increased expression of LSS protein CTD PMID:34186270 Lss Rat bisphenol F increases expression ISO RGD:736635 6480464 bisphenol F results in increased expression of LSS protein CTD PMID:34186270 Lss Rat bisphenol F decreases expression ISO RGD:733768 6480464 bisphenol F results in decreased expression of LSS mRNA CTD PMID:38685157 Lss Rat buta-1,3-diene decreases expression ISO RGD:733768 6480464 1,3-butadiene results in decreased expression of LSS mRNA CTD PMID:21147608 Lss Rat Butylbenzyl phthalate multiple interactions ISO RGD:733768 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated more ... CTD PMID:35739755 Lss Rat cadmium dichloride decreases methylation EXP 6480464 Cadmium Chloride results in decreased methylation of LSS promoter CTD PMID:22457795 Lss Rat cadmium dichloride decreases expression ISO RGD:736635 6480464 Cadmium Chloride results in decreased expression of LSS mRNA CTD PMID:38568856 Lss Rat caffeine multiple interactions ISO RGD:733768 6480464 [Caffeine co-treated with coclaurine co-treated with aegeline co-treated with higenamine co-treated with Yohimbine co-treated with more ... CTD PMID:28843594 Lss Rat calcitriol increases expression ISO RGD:736635 6480464 Calcitriol results in increased expression of LSS mRNA CTD PMID:21592394 Lss Rat calcitriol multiple interactions ISO RGD:736635 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of LSS mRNA CTD PMID:21592394 Lss Rat cannabidiol increases expression ISO RGD:733768 6480464 Cannabidiol results in increased expression of LSS mRNA CTD PMID:31052254 Lss Rat cannabidiol multiple interactions ISO RGD:736635 6480464 [Cuprizone co-treated with Cannabidiol] results in decreased expression of LSS protein CTD PMID:34122009 Lss Rat carbon nanotube decreases expression ISO RGD:733768 6480464 Nanotubes, Carbon analog results in decreased expression of LSS mRNA; Nanotubes, Carbon results in decreased more ... CTD PMID:25620056 Lss Rat carbon nanotube increases expression ISO RGD:733768 6480464 Nanotubes, Carbon analog results in increased expression of LSS mRNA; Nanotubes, Carbon results in increased more ... CTD PMID:25554681 Lss Rat CGP 52608 multiple interactions ISO RGD:736635 6480464 CGP 52608 promotes the reaction [RORA protein binds to LSS gene] CTD PMID:28238834 Lss Rat chlorpromazine increases expression ISO RGD:736635 6480464 Chlorpromazine results in increased expression of LSS mRNA CTD PMID:15342952|PMID:17175557 Lss Rat chromium(6+) affects expression ISO RGD:733768 6480464 chromium hexavalent ion affects the expression of LSS mRNA CTD PMID:28472532 Lss Rat chromium(6+) multiple interactions ISO RGD:736635 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in decreased expression more ... CTD PMID:38479592 Lss Rat ciguatoxin CTX1B affects expression ISO RGD:733768 6480464 Ciguatoxins affects the expression of LSS mRNA CTD PMID:18353800 Lss Rat cisplatin decreases expression ISO RGD:736635 6480464 Cisplatin results in decreased expression of LSS mRNA CTD PMID:27594783 Lss Rat cisplatin multiple interactions ISO RGD:736635 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of LSS mRNA CTD PMID:27392435 Lss Rat clarithromycin decreases expression ISO RGD:736635 6480464 Clarithromycin results in decreased expression of LSS mRNA CTD PMID:15342952 Lss Rat clavulanic acid decreases expression ISO RGD:736635 6480464 Clavulanic Acid results in decreased expression of LSS mRNA CTD PMID:34767876 Lss Rat clofibric acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of LSS mRNA CTD PMID:17602206 Lss Rat clomipramine increases expression ISO RGD:736635 6480464 Clomipramine results in increased expression of LSS mRNA CTD PMID:15342952 Lss Rat clozapine increases expression ISO RGD:736635 6480464 Clozapine results in increased expression of LSS mRNA CTD PMID:15342952|PMID:17175557 Lss Rat clozapine multiple interactions ISO RGD:736635 6480464 [Cuprizone co-treated with Clozapine] results in decreased expression of LSS protein CTD PMID:34122009 Lss Rat cobalt dichloride decreases expression ISO RGD:736635 6480464 cobaltous chloride results in decreased expression of LSS mRNA CTD PMID:19320972|PMID:19376846 Lss Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of LSS mRNA CTD PMID:24386269 Lss Rat copper atom multiple interactions ISO RGD:736635 6480464 [NSC 689534 binds to Copper] which results in decreased expression of LSS mRNA CTD PMID:20971185 Lss Rat copper atom decreases expression ISO RGD:733768 6480464 Copper results in decreased expression of LSS mRNA CTD PMID:17205981 Lss Rat copper(0) multiple interactions ISO RGD:736635 6480464 [NSC 689534 binds to Copper] which results in decreased expression of LSS mRNA CTD PMID:20971185 Lss Rat copper(0) decreases expression ISO RGD:733768 6480464 Copper results in decreased expression of LSS mRNA CTD PMID:17205981 Lss Rat copper(II) chloride decreases expression ISO RGD:736635 6480464 cupric chloride results in decreased expression of LSS mRNA CTD PMID:38568856 Lss Rat copper(II) sulfate decreases expression ISO RGD:736635 6480464 Copper Sulfate results in decreased expression of LSS mRNA CTD PMID:19549813 Lss Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of LSS mRNA CTD PMID:26577399 Lss Rat Cuprizon multiple interactions ISO RGD:736635 6480464 [Cuprizone co-treated with Benztropine] results in decreased expression of LSS protein; [Cuprizone co-treated with Cannabidiol] more ... CTD PMID:34122009 Lss Rat curcumin affects expression ISO RGD:733768 6480464 Curcumin affects the expression of LSS mRNA CTD PMID:27208389 Lss Rat curcumin decreases expression EXP 6480464 Curcumin results in decreased expression of LSS mRNA CTD PMID:27208389 Lss Rat cyclosporin A decreases expression ISO RGD:733768 6480464 Cyclosporine results in decreased expression of LSS mRNA CTD PMID:19770486 Lss Rat cyclosporin A decreases expression ISO RGD:736635 6480464 Cyclosporine results in decreased expression of LSS mRNA CTD PMID:20106945|PMID:25562108 Lss Rat cyclosporin A multiple interactions ISO RGD:736635 6480464 [Cyclosporine co-treated with Cholic Acids] affects the expression of LSS mRNA CTD PMID:27344345 Lss Rat cyproconazole multiple interactions EXP 6480464 [cyproconazole co-treated with epoxiconazole] results in increased expression of LSS mRNA CTD PMID:29038839 Lss Rat DDE decreases expression ISO RGD:736635 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of LSS mRNA CTD PMID:38568856 Lss Rat deguelin decreases expression ISO RGD:736635 6480464 deguelin results in decreased expression of LSS mRNA CTD PMID:33512557 Lss Rat dexamethasone affects expression EXP 6480464 Dexamethasone affects the expression of LSS mRNA CTD PMID:15102944 Lss Rat Di-n-octyl phthalate multiple interactions ISO RGD:733768 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated more ... CTD PMID:35739755 Lss Rat diazinon increases methylation ISO RGD:736635 6480464 Diazinon results in increased methylation of LSS gene CTD PMID:22964155 Lss Rat dibenzo[a,l]pyrene decreases expression ISO RGD:733768 6480464 dibenzo(a,l)pyrene results in decreased expression of LSS mRNA CTD PMID:25908611 Lss Rat Dibutyl phosphate affects expression ISO RGD:736635 6480464 di-n-butylphosphoric acid affects the expression of LSS mRNA CTD PMID:37042841 Lss Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of LSS mRNA CTD PMID:21266533 Lss Rat dibutyl phthalate multiple interactions ISO RGD:733768 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated more ... CTD PMID:35739755 Lss Rat dibutyl phthalate increases expression ISO RGD:733768 6480464 Dibutyl Phthalate results in increased expression of LSS mRNA CTD PMID:17361019|PMID:21266533 Lss Rat dichloromethane affects expression ISO RGD:733768 6480464 Methylene Chloride affects the expression of LSS mRNA CTD PMID:28392392 Lss Rat diethyl phthalate multiple interactions ISO RGD:733768 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated more ... CTD PMID:35739755 Lss Rat Diisodecyl phthalate multiple interactions ISO RGD:733768 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated more ... CTD PMID:35739755 Lss Rat diisononyl phthalate multiple interactions ISO RGD:733768 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated more ... CTD PMID:35739755 Lss Rat dimethylarsinic acid multiple interactions ISO RGD:733768 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results more ... CTD PMID:34876320 Lss Rat dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate decreases expression ISO RGD:736635 6480464 Antimony Potassium Tartrate results in decreased expression of LSS mRNA CTD PMID:17547211 Lss Rat doxepin increases expression ISO RGD:736635 6480464 Doxepin results in increased expression of LSS mRNA CTD PMID:17567588 Lss Rat doxorubicin decreases expression ISO RGD:736635 6480464 Doxorubicin results in decreased expression of LSS mRNA CTD PMID:29803840 Lss Rat epoxiconazole multiple interactions EXP 6480464 [cyproconazole co-treated with epoxiconazole] results in increased expression of LSS mRNA CTD PMID:29038839 Lss Rat epoxiconazole increases expression ISO RGD:736635 6480464 epoxiconazole results in increased expression of LSS mRNA CTD PMID:34182286 Lss Rat epoxiconazole decreases expression ISO RGD:733768 6480464 epoxiconazole results in decreased expression of LSS mRNA CTD PMID:35436446 Lss Rat erythromycin A increases expression ISO RGD:736635 6480464 Erythromycin results in increased expression of LSS mRNA CTD PMID:17175557 Lss Rat ethanol increases expression ISO RGD:733768 6480464 Ethanol results in increased expression of LSS mRNA CTD PMID:19167417|PMID:30319688 Lss Rat ethanol affects splicing ISO RGD:733768 6480464 Ethanol affects the splicing of LSS mRNA CTD PMID:30319688 Lss Rat ethanol multiple interactions ISO RGD:736635 6480464 [[Gasoline co-treated with Ethanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic more ... CTD PMID:29432896 Lss Rat ethyl methanesulfonate decreases expression ISO RGD:736635 6480464 Ethyl Methanesulfonate results in decreased expression of LSS mRNA CTD PMID:23649840 Lss Rat Febrifugine decreases expression ISO RGD:736635 6480464 febrifugine results in decreased expression of LSS mRNA CTD PMID:38431229 Lss Rat fenofibrate increases expression ISO RGD:733768 6480464 Fenofibrate results in increased expression of LSS mRNA CTD PMID:23063693 Lss Rat fenofibrate multiple interactions ISO RGD:733768 6480464 NR1H2 gene mutant form inhibits the reaction [Fenofibrate results in increased expression of LSS mRNA]; more ... CTD PMID:23063693 Lss Rat fenthion increases expression ISO RGD:733768 6480464 Fenthion results in increased expression of LSS mRNA CTD PMID:34813904 Lss Rat fipronil increases expression EXP 6480464 fipronil results in increased expression of LSS mRNA CTD PMID:34044035 Lss Rat flecainide increases expression ISO RGD:736635 6480464 Flecainide results in increased expression of LSS mRNA CTD PMID:17175557 Lss Rat fluoranthene decreases expression ISO RGD:733768 6480464 fluoranthene results in decreased expression of LSS mRNA CTD PMID:28329830 Lss Rat fluoranthene multiple interactions ISO RGD:733768 6480464 [1-methylanthracene co-treated with fluoranthene] results in decreased expression of LSS mRNA CTD PMID:28329830 Lss Rat fluoxetine increases expression ISO RGD:736635 6480464 Fluoxetine results in increased expression of LSS mRNA CTD PMID:15342952|PMID:17567588|PMID:37386098 Lss Rat flusilazole affects expression ISO RGD:733768 6480464 flusilazole affects the expression of LSS mRNA CTD PMID:21195148 Lss Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of LSS mRNA CTD PMID:19299419 Lss Rat folpet increases expression ISO RGD:733768 6480464 folpet results in increased expression of LSS mRNA CTD PMID:31558096 Lss Rat formaldehyde decreases expression ISO RGD:736635 6480464 Formaldehyde results in decreased expression of LSS mRNA CTD PMID:23649840 Lss Rat furfural multiple interactions ISO RGD:736635 6480464 [Furaldehyde co-treated with pyrogallol 1,3-dimethyl ether] results in decreased expression of LSS protein; [pyrogallol 1,3-dimethyl more ... CTD PMID:38598786 Lss Rat Ganoderic acid A decreases expression ISO RGD:736635 6480464 ganoderic acid A results in decreased expression of LSS mRNA CTD PMID:29852127 Lss Rat gold atom multiple interactions ISO RGD:736635 6480464 [Polyethyleneimine binds to Gold] which results in decreased expression of LSS mRNA CTD PMID:28433809 Lss Rat gold(0) multiple interactions ISO RGD:736635 6480464 [Polyethyleneimine binds to Gold] which results in decreased expression of LSS mRNA CTD PMID:28433809 Lss Rat hexaconazole affects expression ISO RGD:733768 6480464 hexaconazole affects the expression of LSS mRNA CTD PMID:21195148 Lss Rat hydroquinone decreases expression ISO RGD:736635 6480464 hydroquinone results in decreased expression of LSS mRNA CTD PMID:31256213 Lss Rat imipramine increases expression ISO RGD:736635 6480464 Imipramine results in increased expression of LSS mRNA CTD PMID:15342952|PMID:17567588 Lss Rat indometacin affects expression ISO RGD:733768 6480464 Indomethacin affects the expression of LSS mRNA CTD PMID:17546600 Lss Rat isoflavones increases expression ISO RGD:736635 6480464 Isoflavones results in increased expression of LSS mRNA CTD PMID:17374662 Lss Rat ivermectin decreases expression ISO RGD:736635 6480464 Ivermectin results in decreased expression of LSS protein CTD PMID:32959892 Lss Rat ketoconazole increases expression ISO RGD:736635 6480464 Ketoconazole results in increased expression of LSS mRNA CTD PMID:15342952|PMID:17175557|PMID:17567588 Lss Rat lead(0) affects splicing ISO RGD:736635 6480464 Lead affects the splicing of LSS mRNA CTD PMID:28903495 Lss Rat loperamide increases expression ISO RGD:733768 6480464 Loperamide results in increased expression of LSS mRNA CTD PMID:35926757 Lss Rat loratadine increases expression ISO RGD:736635 6480464 Loratadine results in increased expression of LSS mRNA CTD PMID:15342952 Lss Rat luteolin decreases expression EXP 6480464 Luteolin results in decreased expression of LSS mRNA CTD PMID:31201582 Lss Rat manganese atom multiple interactions ISO RGD:736635 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Lss Rat manganese(0) multiple interactions ISO RGD:736635 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Lss Rat manganese(II) chloride multiple interactions ISO RGD:736635 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Lss Rat metformin increases expression EXP 6480464 Metformin results in increased expression of LSS mRNA CTD PMID:31324951 Lss Rat methapyrilene decreases methylation ISO RGD:736635 6480464 Methapyrilene results in decreased methylation of LSS intron CTD PMID:30157460 Lss Rat methidathion increases expression ISO RGD:733768 6480464 methidathion results in increased expression of LSS mRNA CTD PMID:34813904 Lss Rat methyl methanesulfonate decreases expression ISO RGD:736635 6480464 Methyl Methanesulfonate results in decreased expression of LSS mRNA CTD PMID:23649840 Lss Rat methylarsonic acid multiple interactions ISO RGD:733768 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results more ... CTD PMID:34876320 Lss Rat methyltestosterone multiple interactions ISO RGD:736635 6480464 [Methyltestosterone co-treated with Cholic Acids] affects the expression of LSS mRNA CTD PMID:27344345 Lss Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of LSS mRNA CTD PMID:17602206 Lss Rat N-nitrosodiethylamine increases expression ISO RGD:733768 6480464 Diethylnitrosamine results in increased expression of LSS mRNA CTD PMID:24535843 Lss Rat N-nitrosodimethylamine decreases expression ISO RGD:736635 6480464 Dimethylnitrosamine results in decreased expression of LSS mRNA CTD PMID:17547211 Lss Rat nickel atom decreases expression ISO RGD:736635 6480464 Nickel results in decreased expression of LSS mRNA CTD PMID:24768652|PMID:25583101 Lss Rat nickel dichloride decreases expression ISO RGD:736635 6480464 nickel chloride results in decreased expression of LSS mRNA CTD PMID:17547211 Lss Rat obeticholic acid decreases expression ISO RGD:736635 6480464 obeticholic acid results in decreased expression of LSS mRNA CTD PMID:27939613 Lss Rat ouabain increases abundance ISO RGD:736635 6480464 LSS protein results in increased abundance of Ouabain CTD PMID:21106941 Lss Rat ozone decreases expression EXP 6480464 Ozone results in decreased expression of LSS mRNA CTD PMID:25838073 Lss Rat ozone multiple interactions ISO RGD:733768 6480464 [Air Pollutants results in increased abundance of Ozone] which results in increased expression of LSS more ... CTD PMID:34911549 Lss Rat paracetamol increases expression ISO RGD:733768 6480464 Acetaminophen results in increased expression of LSS mRNA CTD PMID:11264010|PMID:29246445 Lss Rat paracetamol multiple interactions ISO RGD:733768 6480464 PANX1 gene mutant form inhibits the reaction [Acetaminophen results in increased expression of LSS mRNA] CTD PMID:29246445 Lss Rat paracetamol decreases expression ISO RGD:736635 6480464 Acetaminophen results in decreased expression of LSS mRNA CTD PMID:21420995 Lss Rat PCB138 decreases expression EXP 6480464 2,2',3',4,4',5-hexachlorobiphenyl results in decreased expression of LSS mRNA CTD PMID:23829299 Lss Rat pentamidine decreases expression ISO RGD:736635 6480464 Pentamidine results in decreased expression of LSS mRNA CTD PMID:15342952 Lss Rat perfluorobutyric acid increases expression ISO RGD:733768 6480464 perfluorobutyric acid results in increased expression of LSS mRNA CTD PMID:34474067 Lss Rat perfluorononanoic acid decreases expression ISO RGD:736635 6480464 perfluoro-n-nonanoic acid results in decreased expression of LSS mRNA CTD PMID:32588087 Lss Rat perfluorooctane-1-sulfonic acid increases expression ISO RGD:733768 6480464 perfluorooctane sulfonic acid results in increased expression of LSS mRNA CTD PMID:19429403|PMID:20936131 Lss Rat perfluorooctane-1-sulfonic acid decreases expression ISO RGD:736635 6480464 perfluorooctane sulfonic acid results in decreased expression of LSS mRNA CTD PMID:32588087|PMID:36864359|PMID:38199259 Lss Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:733768 6480464 PPARA protein promotes the reaction [perfluorooctane sulfonic acid results in increased expression of LSS mRNA] CTD PMID:20936131 Lss Rat perfluorooctanoic acid multiple interactions ISO RGD:733768 6480464 PPARA protein inhibits the reaction [perfluorooctanoic acid results in increased expression of LSS mRNA] CTD PMID:20936131 Lss Rat perfluorooctanoic acid decreases expression ISO RGD:733768 6480464 perfluorooctanoic acid results in decreased expression of LSS mRNA CTD PMID:30508572 Lss Rat perfluorooctanoic acid decreases expression ISO RGD:736635 6480464 perfluorooctanoic acid results in decreased expression of LSS mRNA; perfluorooctanoic acid results in decreased expression more ... CTD PMID:26879310|PMID:36864359 Lss Rat perfluorooctanoic acid increases expression ISO RGD:733768 6480464 perfluorooctanoic acid results in increased expression of LSS mRNA CTD PMID:17681415|PMID:19429403|PMID:20936131 Lss Rat perhexiline increases expression ISO RGD:736635 6480464 Perhexiline results in increased expression of LSS mRNA CTD PMID:15342952|PMID:17175557 Lss Rat phenobarbital multiple interactions ISO RGD:733768 6480464 NR1I3 protein affects the reaction [Phenobarbital results in increased expression of LSS mRNA] CTD PMID:19482888 Lss Rat phenobarbital affects expression ISO RGD:733768 6480464 Phenobarbital affects the expression of LSS mRNA CTD PMID:19136022|PMID:23091169 Lss Rat phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of LSS mRNA CTD PMID:19162173 Lss Rat phenobarbital increases expression ISO RGD:733768 6480464 Phenobarbital results in increased expression of LSS mRNA CTD PMID:19482888 Lss Rat phenylpropanolamine increases expression ISO RGD:736635 6480464 Phenylpropanolamine results in increased expression of LSS mRNA CTD PMID:27756839 Lss Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of LSS mRNA CTD PMID:19162173 Lss Rat pirinixic acid increases expression ISO RGD:733768 6480464 pirinixic acid results in increased expression of LSS mRNA CTD PMID:20936131 Lss Rat pirinixic acid affects expression ISO RGD:733768 6480464 pirinixic acid affects the expression of LSS mRNA CTD PMID:19136022 Lss Rat potassium dichromate increases expression ISO RGD:736635 6480464 Potassium Dichromate results in increased expression of LSS protein CTD PMID:23718831 Lss Rat pravastatin increases expression EXP 6480464 Pravastatin results in increased expression of LSS mRNA CTD PMID:27225895 Lss Rat pravastatin increases expression ISO RGD:733768 6480464 Pravastatin results in increased expression of LSS mRNA CTD PMID:27225895 Lss Rat pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of LSS mRNA CTD PMID:19162173 Lss Rat pregnenolone 16alpha-carbonitrile decreases expression ISO RGD:733768 6480464 Pregnenolone Carbonitrile results in decreased expression of LSS mRNA CTD PMID:28903501 Lss Rat progesterone increases expression ISO RGD:736635 6480464 Progesterone results in increased expression of LSS mRNA CTD PMID:18070364 Lss Rat progesterone multiple interactions ISO RGD:736635 6480464 [Estradiol co-treated with Progesterone] results in increased expression of LSS mRNA CTD PMID:20660070 Lss Rat propiconazole increases expression ISO RGD:736635 6480464 propiconazole results in increased expression of LSS mRNA CTD PMID:36291160 Lss Rat quercetin decreases expression ISO RGD:736635 6480464 Quercetin results in decreased expression of LSS mRNA CTD PMID:21632981 Lss Rat rotenone affects expression EXP 6480464 Rotenone affects the expression of LSS mRNA CTD PMID:28374803 Lss Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of LSS protein CTD PMID:35544339 Lss Rat rotenone increases expression ISO RGD:733768 6480464 Rotenone results in increased expression of LSS mRNA CTD PMID:32937126 Lss Rat rotenone increases expression ISO RGD:736635 6480464 Rotenone results in increased expression of LSS mRNA CTD PMID:29955902 Lss Rat sertraline increases expression ISO RGD:736635 6480464 Sertraline results in increased expression of LSS mRNA CTD PMID:15342952|PMID:17567588 Lss Rat silver atom decreases expression ISO RGD:733768 6480464 Silver results in decreased expression of LSS mRNA CTD PMID:27131904 Lss Rat silver(0) decreases expression ISO RGD:733768 6480464 Silver results in decreased expression of LSS mRNA CTD PMID:27131904 Lss Rat sodium arsenate increases expression ISO RGD:733768 6480464 sodium arsenate results in increased expression of LSS mRNA CTD PMID:21795629 Lss Rat sodium arsenate multiple interactions ISO RGD:733768 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results more ... CTD PMID:34876320 Lss Rat sodium arsenite increases expression ISO RGD:736635 6480464 sodium arsenite results in increased expression of LSS mRNA CTD PMID:25524072 Lss Rat sodium arsenite multiple interactions ISO RGD:733768 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results more ... CTD PMID:34876320 Lss Rat sodium arsenite multiple interactions ISO RGD:736635 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Lss Rat sodium arsenite affects expression ISO RGD:736635 6480464 sodium arsenite affects the expression of LSS mRNA CTD PMID:34032870 Lss Rat sodium arsenite decreases expression ISO RGD:736635 6480464 sodium arsenite results in decreased expression of LSS mRNA CTD PMID:38568856 Lss Rat sodium arsenite increases expression ISO RGD:733768 6480464 sodium arsenite results in increased expression of LSS mRNA CTD PMID:31532247 Lss Rat sodium chloride multiple interactions ISO RGD:736635 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of LSS protein; [Sodium Chloride co-treated more ... CTD PMID:38598786 Lss Rat sotalol decreases expression ISO RGD:736635 6480464 Sotalol results in decreased expression of LSS mRNA CTD PMID:15342952 Lss Rat succimer multiple interactions ISO RGD:733768 6480464 [Succimer binds to Magnetite Nanoparticles] which results in decreased expression of LSS mRNA CTD PMID:21641980 Lss Rat sulforaphane decreases expression ISO RGD:736635 6480464 sulforaphane results in decreased expression of LSS mRNA CTD PMID:34767876 Lss Rat sunitinib increases expression ISO RGD:736635 6480464 Sunitinib results in increased expression of LSS mRNA CTD PMID:31533062 Lss Rat tamoxifen decreases expression ISO RGD:736635 6480464 Tamoxifen results in decreased expression of LSS mRNA CTD PMID:15590111 Lss Rat tamoxifen increases expression ISO RGD:736635 6480464 Tamoxifen results in increased expression of LSS mRNA CTD PMID:15342952|PMID:17567588 Lss Rat tebuconazole increases expression ISO RGD:736635 6480464 tebuconazole results in increased expression of LSS mRNA CTD PMID:30458266|PMID:36291160 Lss Rat temozolomide decreases expression ISO RGD:736635 6480464 Temozolomide results in decreased expression of LSS mRNA CTD PMID:31758290 Lss Rat tert-butyl hydroperoxide decreases expression ISO RGD:733768 6480464 tert-Butylhydroperoxide results in decreased expression of LSS mRNA CTD PMID:14729362 Lss Rat testosterone multiple interactions ISO RGD:736635 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of LSS mRNA CTD PMID:21592394 Lss Rat testosterone decreases expression ISO RGD:733768 6480464 Testosterone deficiency results in decreased expression of LSS mRNA CTD PMID:33848595 Lss Rat testosterone increases expression ISO RGD:736635 6480464 Testosterone results in increased expression of LSS mRNA CTD PMID:21592394 Lss Rat tetrachloromethane affects expression ISO RGD:733768 6480464 Carbon Tetrachloride affects the expression of LSS mRNA CTD PMID:17484886 Lss Rat tetrachloromethane decreases expression ISO RGD:733768 6480464 Carbon Tetrachloride results in decreased expression of LSS mRNA CTD PMID:31919559 Lss Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of LSS mRNA CTD PMID:19224547|PMID:31150632 Lss Rat thimerosal decreases expression ISO RGD:736635 6480464 Thimerosal results in decreased expression of LSS mRNA CTD PMID:27188386 Lss Rat thioridazine increases expression ISO RGD:736635 6480464 Thioridazine results in increased expression of LSS mRNA CTD PMID:15342952|PMID:17175557 Lss Rat thiram decreases expression ISO RGD:736635 6480464 Thiram results in decreased expression of LSS mRNA CTD PMID:38568856 Lss Rat titanium dioxide increases expression ISO RGD:733768 6480464 titanium dioxide results in increased expression of LSS mRNA CTD PMID:27760801 Lss Rat titanium dioxide increases methylation ISO RGD:733768 6480464 titanium dioxide results in increased methylation of LSS gene CTD PMID:35295148 Lss Rat triacsin C decreases expression ISO RGD:736635 6480464 triacsin C results in decreased expression of LSS mRNA CTD PMID:16704987 Lss Rat triadimefon affects expression ISO RGD:733768 6480464 triadimefon affects the expression of LSS mRNA CTD PMID:21195148 Lss Rat trichostatin A affects expression ISO RGD:736635 6480464 trichostatin A affects the expression of LSS mRNA CTD PMID:28542535 Lss Rat trimellitic anhydride increases expression ISO RGD:733768 6480464 trimellitic anhydride results in increased expression of LSS mRNA CTD PMID:19042947 Lss Rat triphenyl phosphate affects expression EXP 6480464 triphenyl phosphate affects the expression of LSS mRNA CTD PMID:30589522 Lss Rat triphenyl phosphate affects expression ISO RGD:736635 6480464 triphenyl phosphate affects the expression of LSS mRNA CTD PMID:37042841 Lss Rat troglitazone increases expression EXP 6480464 troglitazone results in increased expression of LSS protein CTD PMID:21315101 Lss Rat troglitazone decreases expression ISO RGD:736635 6480464 troglitazone results in decreased expression of LSS mRNA CTD PMID:25572481 Lss Rat tunicamycin decreases expression ISO RGD:736635 6480464 Tunicamycin results in decreased expression of LSS mRNA CTD PMID:22378314 Lss Rat valdecoxib increases expression EXP 6480464 valdecoxib results in increased expression of LSS mRNA CTD PMID:24136188 Lss Rat valproic acid affects expression ISO RGD:733768 6480464 Valproic Acid affects the expression of LSS mRNA CTD PMID:17292431 Lss Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of LSS mRNA CTD PMID:23034163 Lss Rat vitamin K affects expression EXP 6480464 Vitamin K affects the expression of LSS mRNA CTD PMID:16844298 Lss Rat vorinostat decreases expression ISO RGD:736635 6480464 vorinostat results in decreased expression of LSS mRNA CTD PMID:27188386 Lss Rat Yessotoxin increases expression ISO RGD:736635 6480464 yessotoxin analog results in increased expression of LSS mRNA CTD PMID:30679557 Lss Rat yohimbine multiple interactions ISO RGD:733768 6480464 [Caffeine co-treated with coclaurine co-treated with aegeline co-treated with higenamine co-treated with Yohimbine co-treated with more ... CTD PMID:28843594 Lss Rat zaragozic acid A increases expression ISO RGD:733768 6480464 squalestatin 1 results in increased expression of LSS mRNA CTD PMID:27225895 Lss Rat zaragozic acid A increases expression EXP 6480464 squalestatin 1 results in increased expression of LSS mRNA CTD PMID:27225895 Lss Rat zimeldine increases expression ISO RGD:736635 6480464 Zimeldine results in increased expression of LSS mRNA CTD PMID:17175557 Lss Rat zoledronic acid increases expression ISO RGD:736635 6480464 zoledronic acid results in increased expression of LSS mRNA CTD PMID:24714768 Lss Rat zoledronic acid increases expression EXP 6480464 zoledronic acid results in increased expression of LSS mRNA CTD PMID:18325729
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
(+/-)-Aegeline (ISO) (RS)-coclaurine (ISO) (RS)-norcoclaurine (ISO) (S)-coclaurine (ISO) 1,2-dimethylhydrazine (ISO) 1-[(4-chlorophenyl)-phenylmethyl]-4-methylpiperazine (ISO) 1-naphthyl isothiocyanate (EXP,ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP,ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,2',5,5'-tetrachlorobiphenyl (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4-dinitrotoluene (EXP) 2,6-dimethoxyphenol (ISO) 2,6-dinitrotoluene (EXP) 22-Hydroxycholesterol (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3,3',5-triiodo-L-thyronine (EXP) 3-chloropropane-1,2-diol (EXP) 3H-1,2-dithiole-3-thione (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 5-fluorouracil (ISO) 7,12-dimethyltetraphene (ISO) 8-Br-cAMP (ISO) AB-Fubinaca (EXP) acetamide (EXP) Acetyl tributyl citrate (ISO) acrylamide (ISO) afimoxifene (ISO) aflatoxin B1 (ISO) aldrin (ISO) amiodarone (EXP,ISO) amitriptyline (ISO) ammonium chloride (EXP) amphetamine (EXP) antimony(0) (ISO) arachidonic acid (ISO) Archazolid B (ISO) aristolochic acid A (ISO) Aroclor 1254 (EXP) arsane (ISO) arsenic atom (ISO) atrazine (EXP) avobenzone (ISO) azoxystrobin (ISO) benzatropine (ISO) benzene-1,2,4-triol (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) benzo[e]pyrene (ISO) beta-lapachone (ISO) beta-naphthoflavone (ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) buta-1,3-diene (ISO) Butylbenzyl phthalate (ISO) cadmium dichloride (EXP,ISO) caffeine (ISO) calcitriol (ISO) cannabidiol (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chlorpromazine (ISO) chromium(6+) (ISO) ciguatoxin CTX1B (ISO) cisplatin (ISO) clarithromycin (ISO) clavulanic acid (ISO) clofibric acid (EXP) clomipramine (ISO) clozapine (ISO) cobalt dichloride (EXP,ISO) copper atom (ISO) copper(0) (ISO) copper(II) chloride (ISO) copper(II) sulfate (ISO) Cuprizon (EXP,ISO) curcumin (EXP,ISO) cyclosporin A (ISO) cyproconazole (EXP) DDE (ISO) deguelin (ISO) dexamethasone (EXP) Di-n-octyl phthalate (ISO) diazinon (ISO) dibenzo[a,l]pyrene (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) dichloromethane (ISO) diethyl phthalate (ISO) Diisodecyl phthalate (ISO) diisononyl phthalate (ISO) dimethylarsinic acid (ISO) dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate (ISO) doxepin (ISO) doxorubicin (ISO) epoxiconazole (EXP,ISO) erythromycin A (ISO) ethanol (ISO) ethyl methanesulfonate (ISO) Febrifugine (ISO) fenofibrate (ISO) fenthion (ISO) fipronil (EXP) flecainide (ISO) fluoranthene (ISO) fluoxetine (ISO) flusilazole (ISO) flutamide (EXP) folpet (ISO) formaldehyde (ISO) furfural (ISO) Ganoderic acid A (ISO) gold atom (ISO) gold(0) (ISO) hexaconazole (ISO) hydroquinone (ISO) imipramine (ISO) indometacin (ISO) isoflavones (ISO) ivermectin (ISO) ketoconazole (ISO) lead(0) (ISO) loperamide (ISO) loratadine (ISO) luteolin (EXP) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) metformin (EXP) methapyrilene (ISO) methidathion (ISO) methyl methanesulfonate (ISO) methylarsonic acid (ISO) methyltestosterone (ISO) N-nitrosodiethylamine (EXP,ISO) N-nitrosodimethylamine (ISO) nickel atom (ISO) nickel dichloride (ISO) obeticholic acid (ISO) ouabain (ISO) ozone (EXP,ISO) paracetamol (ISO) PCB138 (EXP) pentamidine (ISO) perfluorobutyric acid (ISO) perfluorononanoic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) perhexiline (ISO) phenobarbital (EXP,ISO) phenylpropanolamine (ISO) pirinixic acid (EXP,ISO) potassium dichromate (ISO) pravastatin (EXP,ISO) pregnenolone 16alpha-carbonitrile (EXP,ISO) progesterone (ISO) propiconazole (ISO) quercetin (ISO) rotenone (EXP,ISO) sertraline (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sodium chloride (ISO) sotalol (ISO) succimer (ISO) sulforaphane (ISO) sunitinib (ISO) tamoxifen (ISO) tebuconazole (ISO) temozolomide (ISO) tert-butyl hydroperoxide (ISO) testosterone (ISO) tetrachloromethane (EXP,ISO) thimerosal (ISO) thioridazine (ISO) thiram (ISO) titanium dioxide (ISO) triacsin C (ISO) triadimefon (ISO) trichostatin A (ISO) trimellitic anhydride (ISO) triphenyl phosphate (EXP,ISO) troglitazone (EXP,ISO) tunicamycin (ISO) valdecoxib (EXP) valproic acid (ISO) vinclozolin (EXP) vitamin K (EXP) vorinostat (ISO) Yessotoxin (ISO) yohimbine (ISO) zaragozic acid A (EXP,ISO) zimeldine (ISO) zoledronic acid (EXP,ISO)
1.
Molecular cloning, characterization, and functional expression of rat oxidosqualene cyclase cDNA.
Abe I and Prestwich GD, Proc Natl Acad Sci U S A 1995 Sep 26;92(20):9274-8.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
4.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
5.
Molecular cloning of cDNA encoding rat 2,3-oxidosqualene: lanosterol cyclase.
Kusano M, etal., Biol Pharm Bull 1995 Jan;18(1):195-7.
6.
Adverse effects of long-term exposure to bisphenol A during adulthood leading to hyperglycaemia and hypercholesterolemia in mice.
Marmugi A, etal., Toxicology. 2014 Nov 5;325:133-43. doi: 10.1016/j.tox.2014.08.006. Epub 2014 Aug 26.
7.
Purification of 2,3-oxidosqualene cyclase from rat liver.
Moore WR and Schatzman GL, J Biol Chem. 1992 Nov 5;267(31):22003-6.
8.
Lanosterol synthase mutations cause cholesterol deficiency-associated cataracts in the Shumiya cataract rat.
Mori M, etal., J Clin Invest. 2006 Feb;116(2):395-404. Epub 2006 Jan 26.
9.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
10.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
11.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
12.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
13.
GOA pipeline
RGD automated data pipeline
14.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
15.
Defects of cholesterol biosynthesis.
Waterham HR FEBS Lett. 2006 Oct 9;580(23):5442-9. Epub 2006 Jul 20.
16.
Lanosterol reverses protein aggregation in cataracts.
Zhao L, etal., Nature. 2015 Jul 30;523(7562):607-11. doi: 10.1038/nature14650. Epub 2015 Jul 22.
Lss Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 12,090,641 - 12,118,230 (-) NCBI GRCr8 mRatBN7.2 20 12,091,138 - 12,118,858 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 12,092,774 - 12,118,762 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 12,789,080 - 12,815,472 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 12,150,002 - 12,176,395 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 12,621,780 - 12,648,174 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 12,844,522 - 12,870,474 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 12,842,884 - 12,870,497 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 15,337,114 - 15,338,473 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Rnor_5.0 20 15,000,298 - 15,027,581 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 12,507,575 - 12,534,612 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 20 12,507,801 - 12,534,839 (-) NCBI Celera 20 13,590,952 - 13,616,816 (-) NCBI Celera Cytogenetic Map 20 p12 NCBI
LSS Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 21 46,188,446 - 46,228,774 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 21 46,188,141 - 46,228,824 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 21 47,608,360 - 47,648,688 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 21 46,432,788 - 46,473,119 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 21 46,433,466 - 46,473,119 NCBI Celera 21 32,720,748 - 32,761,140 (-) NCBI Celera Cytogenetic Map 21 q22.3 NCBI HuRef 21 32,990,213 - 33,031,026 (-) NCBI HuRef CHM1_1 21 47,167,889 - 47,208,226 (-) NCBI CHM1_1 T2T-CHM13v2.0 21 44,570,708 - 44,611,332 (-) NCBI T2T-CHM13v2.0
Lss Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 76,367,303 - 76,392,973 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 76,367,422 - 76,392,972 (+) Ensembl GRCm39 Ensembl GRCm38 10 76,531,565 - 76,557,139 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 76,531,588 - 76,557,138 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 75,994,372 - 76,016,679 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 75,975,343 - 75,997,650 (+) NCBI MGSCv36 mm8 Celera 10 77,576,142 - 77,598,449 (+) NCBI Celera Cytogenetic Map 10 C1 NCBI cM Map 10 39.1 NCBI
Lss Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955407 42,633,658 - 42,653,399 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955407 42,633,658 - 42,653,399 (-) NCBI ChiLan1.0 ChiLan1.0
LSS Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 22 42,290,120 - 42,328,031 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 21 37,162,576 - 37,201,020 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 21 32,535,564 - 32,571,379 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 21 45,787,252 - 45,822,181 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 21 45,787,252 - 45,822,181 (-) Ensembl panpan1.1 panPan2
LSS Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 31 39,479,255 - 39,502,439 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 31 39,480,581 - 39,503,042 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 31 38,707,040 - 38,730,234 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 31 39,120,352 - 39,143,563 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 31 39,120,357 - 39,143,585 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 31 38,982,033 - 39,005,248 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 31 38,942,696 - 38,965,462 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 31 39,460,908 - 39,484,125 (-) NCBI UU_Cfam_GSD_1.0
Lss
LSS Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa10.2 13 218,517,444 - 218,539,989 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
LSS Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 2 89,809,065 - 89,846,295 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 2 89,811,698 - 89,846,242 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666054 18,194,151 - 18,231,629 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Lss
.
Predicted Target Of
Count of predictions: 84 Count of miRNA genes: 68 Interacting mature miRNAs: 80 Transcripts: ENSRNOT00000042499 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
4889870 Pur30 Proteinuria QTL 30 19 0.005 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 20 8042410 29322208 Rat 1354642 Despr15 Despair related QTL 15 0.0027 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 20 1 24159021 Rat 4889857 Pur27 Proteinuria QTL 27 12.2 0.001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 20 4606607 17617956 Rat 70154 Insul2 Insulin level QTL 2 3.75 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 20 6691706 17489458 Rat 9590109 Sffal8 Serum free fatty acids level QTL 8 5.32 0.01 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 20 1 29191651 Rat 9590275 Scort15 Serum corticosterone level QTL 15 3.48 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 20 1 29191651 Rat 1581577 Pur15 Proteinuria QTL 15 4.38 0.0002 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 20 8042410 17617956 Rat 6893685 Bw111 Body weight QTL 111 2.7 0.004 body mass (VT:0001259) body weight (CMO:0000012) 20 1 32578807 Rat 9590092 Insglur9 Insulin/glucose ratio QTL 9 18.38 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 20 11757515 54435887 Rat 1641915 Colcr9 Colorectal carcinoma resistance QTL 9 2.97 0.0024 intestine integrity trait (VT:0010554) benign colorectal tumor number (CMO:0001795) 20 1530655 46530655 Rat 2317057 Aia27 Adjuvant induced arthritis QTL 27 2.83 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 20 2892597 26381954 Rat 7387283 Uae44 Urinary albumin excretion QTL 44 0.1712 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 20 1 26123605 Rat 7411668 Foco32 Food consumption QTL 32 8 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 20 1 36600972 Rat 2305926 Iddm37 Insulin dependent diabetes mellitus QTL 37 6 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 20 1527842 46527842 Rat 1600382 Edcs3 Endometrial carcinoma susceptibility QTL3 3.5 0.003 uterus morphology trait (VT:0001120) percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759) 20 1 25159026 Rat 1558640 Prcs2 Prostate cancer susceptibility QTL 2 3.3 prostate integrity trait (VT:0010571) percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943) 20 4606607 17617956 Rat 631265 Iresp1 Immunoglobin response QTL1 8.3 blood anti-double stranded DNA antibody amount (VT:0004762) serum anti-DNA antibody level (CMO:0001533) 20 9039719 13461775 Rat 8694189 Bw153 Body weight QTL 153 3.13 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 20 1 29191651 Rat 9589155 Insul32 Insulin level QTL 32 6.38 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 20 1 29191651 Rat 7411650 Foco23 Food consumption QTL 23 20.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 20 1 29191651 Rat 7411652 Foco24 Food consumption QTL 24 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 20 11757515 54435887 Rat 2317851 Alcrsp22 Alcohol response QTL 22 3.2 0.05 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 20 1 27339237 Rat 1598816 Memor12 Memory QTL 12 2.4 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 20 2606836 47606836 Rat 61432 Cia1 Collagen induced arthritis QTL 1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 20 3621656 14101050 Rat 1641893 Alcrsp7 Alcohol response QTL 7 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 20 1 27339237 Rat 9590252 Scort12 Serum corticosterone level QTL 12 20.46 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 20 1 36600972 Rat
RH140502
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 20 12,092,914 - 12,093,040 (+) MAPPER mRatBN7.2 Rnor_6.0 20 13,183,368 - 13,183,493 NCBI Rnor6.0 Rnor_6.0 20 12,844,661 - 12,844,786 NCBI Rnor6.0 Rnor_5.0 20 15,337,253 - 15,337,378 UniSTS Rnor5.0 Rnor_5.0 20 15,002,073 - 15,002,198 UniSTS Rnor5.0 RGSC_v3.4 20 12,507,714 - 12,507,839 UniSTS RGSC3.4 Celera 20 13,591,091 - 13,591,216 UniSTS RH 3.4 Map 20 154.34 UniSTS Cytogenetic Map 20 p12 UniSTS
This gene Lss is modified in the following models/strains:
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000078412 ⟹ ENSRNOP00000069432
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 20 12,092,775 - 12,118,762 (-) Ensembl Rnor_6.0 Ensembl 20 12,842,918 - 12,870,496 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000081903 ⟹ ENSRNOP00000070074
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 20 12,092,775 - 12,118,762 (-) Ensembl Rnor_6.0 Ensembl 20 12,861,228 - 12,870,497 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000084053 ⟹ ENSRNOP00000069968
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 20 12,842,884 - 12,855,891 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000085270 ⟹ ENSRNOP00000070008
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 20 12,856,483 - 12,858,096 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000107519 ⟹ ENSRNOP00000093002
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 20 12,092,774 - 12,118,747 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000113267 ⟹ ENSRNOP00000090987
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 20 12,095,754 - 12,118,739 (-) Ensembl
RefSeq Acc Id:
NM_031049 ⟹ NP_112311
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 12,092,275 - 12,118,230 (-) NCBI mRatBN7.2 20 12,092,776 - 12,118,739 (-) NCBI Rnor_6.0 20 12,844,522 - 12,870,474 (-) NCBI Rnor_5.0 20 15,337,114 - 15,338,473 (-) NCBI RGSC_v3.4 20 12,507,575 - 12,534,612 (-) RGD Celera 20 13,590,952 - 13,616,816 (-) RGD
Sequence:
GGTAAAGGGCTGGCCGGCCGGTGGTCCAGAGCTGTGCTGTCATGACCGAGGGCACGTGTCTGCGGCGTCGTGGGGGACCCTATAAAACTGAGCCCGCCACCGATCTCACCCGCTGGCGGCTCCATAAT
hide sequence
RefSeq Acc Id:
XM_039099122 ⟹ XP_038955050
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 12,090,641 - 12,113,625 (-) NCBI mRatBN7.2 20 12,091,138 - 12,114,142 (-) NCBI
RefSeq Acc Id:
NP_112311 ⟸ NM_031049
- UniProtKB:
Q62811 (UniProtKB/Swiss-Prot), P48450 (UniProtKB/Swiss-Prot), A0A0G2JVC8 (UniProtKB/TrEMBL), A6JKC8 (UniProtKB/TrEMBL)
- Sequence:
MTEGTCLRRRGGPYKTEPATDLTRWRLHNELGRQRWTYYQAEEDPGREQTGLEAHSLGLDTTSYFKNLPKAQTAHEGALNGVTFYAKLQAEDGHWAGDYGGPLFLLPGLLITCHIAHIPLPAGYREEM
hide sequence
Ensembl Acc Id:
ENSRNOP00000070008 ⟸ ENSRNOT00000085270
Ensembl Acc Id:
ENSRNOP00000069432 ⟸ ENSRNOT00000078412
Ensembl Acc Id:
ENSRNOP00000070074 ⟸ ENSRNOT00000081903
Ensembl Acc Id:
ENSRNOP00000069968 ⟸ ENSRNOT00000084053
RefSeq Acc Id:
XP_038955050 ⟸ XM_039099122
- Peptide Label:
isoform X1
Ensembl Acc Id:
ENSRNOP00000093002 ⟸ ENSRNOT00000107519
Ensembl Acc Id:
ENSRNOP00000090987 ⟸ ENSRNOT00000113267
RGD ID: 13701516 Promoter ID: EPDNEW_R12040 Type: initiation region Name: Lss_1 Description: lanosterol synthase SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 20 12,870,479 - 12,870,539 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2021-03-09
Lss
lanosterol synthase
LOC103690153
uncharacterized LOC103690153
Data merged from RGD:9143348
737654 PROVISIONAL
2014-08-25
LOC103690153
uncharacterized LOC103690153
Symbol and Name status set to provisional
70820 PROVISIONAL
2008-09-18
Lss
lanosterol synthase (2,3-oxidosqualene-lanosterol cyclase)
Lss
lanosterol synthase
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-20
Lss
lanosterol synthase
2,3-oxidosqualene: lanosterol cyclase
Name updated
1299863 APPROVED
2002-08-07
Lss
2,3-oxidosqualene: lanosterol cyclase
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_domains
contains five QW motifs
728996
