Advanced Search (OLGA)

Gene: Nploc4 (NPL4 homolog, ubiquitin recognition factor) Rattus norvegicus

Analyze

Symbol:

Nploc4

Name:

NPL4 homolog, ubiquitin recognition factor

RGD ID:

620794

Description:

Enables ATPase binding activity; ubiquitin binding activity; and ubiquitin protein ligase binding activity. Contributes to K48-linked polyubiquitin modification-dependent protein binding activity and K63-linked polyubiquitin modification-dependent protein binding activity. Involved in Golgi organization and retrograde protein transport, ER to cytosol. Part of UFD1-NPL4 complex and VCP-NPL4-UFD1 AAA ATPase complex. Orthologous to human NPLOC4 (NPL4 homolog, ubiquitin recognition factor); PARTICIPATES IN Endoplasmic Reticulum-associated degradation pathway; INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 3-chloropropane-1,2-diol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

homolog of yeast nuclear protein localization 4; MGC124575; Npl4; nuclear protein localization 4; nuclear protein localization 4 homolog; nuclear protein localization 4 homolog (S. cerevisiae); nuclear protein localization protein 4 homolog

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	NPLOC4 (NPL4 homolog, ubiquitin recognition factor)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):	Nploc4 (NPL4 homolog, ubiquitin recognition factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Nploc4 (NPL4 homolog, ubiquitin recognition factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	NPLOC4 (NPL4 homolog, ubiquitin recognition factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	NPLOC4 (NPL4 homolog, ubiquitin recognition factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Nploc4 (NPL4 homolog, ubiquitin recognition factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	NPLOC4 (NPL4 homolog, ubiquitin recognition factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	NPLOC4 (NPL4 homolog, ubiquitin recognition factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Nploc4 (NPL4 homolog, ubiquitin recognition factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	NPLOC4 (NPL4 homolog, ubiquitin recognition factor)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Nploc4 (NPL4 homolog, ubiquitin recognition factor)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	nploc4 (NPL4 homolog, ubiquitin recognition factor)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	NPL4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Npl4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	npl-4.1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	npl-4.2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	nploc4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	nploc4	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	106,152,756 - 106,208,306 (-)	NCBI		GRCr8
GRCr8 Ensembl	10	106,153,173 - 106,208,264 (-)	Ensembl		GRCr8 Ensembl
mRatBN7.2	10	105,654,395 - 105,709,958 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	105,654,812 - 105,709,913 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	110,759,179 - 110,814,263 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	110,222,198 - 110,277,289 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	105,575,294 - 105,630,381 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	109,553,518 - 109,610,087 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	109,552,649 - 109,610,030 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	109,148,086 - 109,198,162 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	109,809,121 - 109,878,278 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	10	104,200,159 - 104,255,207 (-)	NCBI		Celera
RGSC_v3.1	10	109,825,236 - 109,862,213 (-)	NCBI
Cytogenetic Map	10	q32.3	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2-bromohexadecanoic acid (ISO)

2-hydroxypropanoic acid (ISO)

2-methylcholine (ISO)

3-chloropropane-1,2-diol (EXP)

4,4'-sulfonyldiphenol (ISO)

acetamide (EXP)

acrolein (ISO)

acrylamide (ISO)

aflatoxin B1 (ISO)

alpha-pinene (ISO)

ammonium chloride (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

beta-lapachone (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

butan-1-ol (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

CGP 52608 (ISO)

clozapine (ISO)

cobalt dichloride (EXP,ISO)

copper(II) sulfate (ISO)

curcumin (ISO)

cyproconazole (EXP)

diarsenic trioxide (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (ISO)

doxorubicin (ISO)

endosulfan (EXP,ISO)

epoxiconazole (EXP)

ethanol (ISO)

flutamide (EXP)

folic acid (ISO)

fulvestrant (ISO)

gold atom (ISO)

gold(0) (ISO)

isoniazide (ISO)

ivermectin (ISO)

lead(0) (ISO)

leflunomide (EXP)

mercury dichloride (EXP)

nefazodone (EXP)

nimesulide (EXP)

nitrates (ISO)

NMS-873 (ISO)

ozone (EXP,ISO)

paracetamol (ISO)

pentachlorophenol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phorbol 13-acetate 12-myristate (ISO)

prochloraz (EXP)

rac-lactic acid (ISO)

sodium arsenite (ISO)

temozolomide (ISO)

tetrachloromethane (EXP,ISO)

thapsigargin (EXP)

titanium dioxide (ISO)

tolcapone (EXP)

valdecoxib (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

ERAD pathway (IDA,ISO)

Golgi organization (IDA)

membrane fusion (IDA)

negative regulation of RIG-I signaling pathway (IEA,ISO,ISS)

negative regulation of type I interferon production (IEA,ISO,ISS)

proteasome-mediated ubiquitin-dependent protein catabolic process (IEA)

retrograde protein transport, ER to cytosol (EXP,IEA,ISO,ISS)

ubiquitin-dependent protein catabolic process (IBA,IEA,ISO,ISS)

Cellular Component

cytoplasm (IEA)

cytosol (IEA)

endoplasmic reticulum (IEA)

nucleus (IBA,IEA)

UFD1-NPL4 complex (IDA,IEA,ISO)

VCP-NPL4-UFD1 AAA ATPase complex (EXP,IDA,IEA,ISO,NAS)

Molecular Function

ATPase binding (IPI)

K48-linked polyubiquitin modification-dependent protein binding (IDA)

K63-linked polyubiquitin modification-dependent protein binding (IDA)

metal ion binding (IEA)

protein binding (IPI,ISO)

protein-containing complex binding (IPI)

ubiquitin binding (IBA,IDA)

ubiquitin protein ligase binding (IBA,IDA)

zinc ion binding (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

Endoplasmic Reticulum-associated degradation pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	UBXD7 binds multiple ubiquitin ligases and implicates p97 in HIF1alpha turnover.	Alexandru G, etal., Cell. 2008 Sep 5;134(5):804-16. doi: 10.1016/j.cell.2008.06.048.
2.	Involvement of the p97-Ufd1-Npl4 complex in the regulated endoplasmic reticulum-associated degradation of inositol 1,4,5-trisphosphate receptors.	Alzayady KJ, etal., J Biol Chem. 2005 Oct 14;280(41):34530-7. Epub 2005 Aug 15.
3.	Distinct conformations of the protein complex p97-Ufd1-Npl4 revealed by electron cryomicroscopy.	Bebeacua C, etal., Proc Natl Acad Sci U S A. 2012 Jan 24;109(4):1098-103. doi: 10.1073/pnas.1114341109. Epub 2012 Jan 9.
4.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.	A complex of mammalian ufd1 and npl4 links the AAA-ATPase, p97, to ubiquitin and nuclear transport pathways.	Meyer HH, etal., EMBO J 2000 May 15;19(10):2181-92.
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
8.	Structural insights into the p97-Ufd1-Npl4 complex.	Pye VE, etal., Proc Natl Acad Sci U S A. 2007 Jan 9;104(2):467-72. Epub 2007 Jan 3.
9.	GOA pipeline	RGD automated data pipeline
10.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
11.	Regulation of retrotranslocation by p97-associated deubiquitinating enzyme ataxin-3.	Wang Q, etal., J Cell Biol. 2006 Sep 25;174(7):963-71.
12.	Function of the p97-Ufd1-Npl4 complex in retrotranslocation from the ER to the cytosol: dual recognition of nonubiquitinated polypeptide segments and polyubiquitin chains.	Ye Y, etal., J Cell Biol. 2003 Jul 7;162(1):71-84.

Additional References at PubMed

PMID:11574150	PMID:11740563	PMID:11781570	PMID:12411482	PMID:12477932	PMID:12644454	PMID:14636562	PMID:15029239	PMID:19182904	PMID:21630459	PMID:25660456	PMID:26471729

Genomics

Comparative Map Data

Nploc4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	106,152,756 - 106,208,306 (-)	NCBI		GRCr8
GRCr8 Ensembl	10	106,153,173 - 106,208,264 (-)	Ensembl		GRCr8 Ensembl
mRatBN7.2	10	105,654,395 - 105,709,958 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	105,654,812 - 105,709,913 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	110,759,179 - 110,814,263 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	110,222,198 - 110,277,289 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	105,575,294 - 105,630,381 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	109,553,518 - 109,610,087 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	109,552,649 - 109,610,030 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	109,148,086 - 109,198,162 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	109,809,121 - 109,878,278 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	10	104,200,159 - 104,255,207 (-)	NCBI		Celera
RGSC_v3.1	10	109,825,236 - 109,862,213 (-)	NCBI
Cytogenetic Map	10	q32.3	NCBI

NPLOC4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	81,556,885 - 81,637,112 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	81,556,887 - 81,648,465 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	79,523,911 - 79,604,138 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	77,134,357 - 77,214,543 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	17	77,134,358 - 77,214,493	NCBI
Celera	17	76,168,272 - 76,249,182 (-)	NCBI		Celera
Cytogenetic Map	17	q25.3	NCBI
HuRef	17	74,971,514 - 75,050,623 (-)	NCBI		HuRef
CHM1_1	17	79,610,124 - 79,690,039 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	17	82,474,164 - 82,554,047 (-)	NCBI		T2T-CHM13v2.0

Nploc4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	120,270,624 - 120,328,526 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	120,271,196 - 120,328,534 (-)	Ensembl		GRCm39 Ensembl
GRCm38	11	120,379,798 - 120,437,700 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	120,380,370 - 120,437,708 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	120,241,685 - 120,298,982 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	120,196,461 - 120,253,758 (-)	NCBI		MGSCv36	mm8
Celera	11	132,115,124 - 132,172,461 (-)	NCBI		Celera
Cytogenetic Map	11	E2	NCBI
cM Map	11	84.09	NCBI

Nploc4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955506	1,451,337 - 1,513,455 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955506	1,451,337 - 1,513,455 (+)	NCBI	ChiLan1.0	ChiLan1.0

NPLOC4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	98,143,491 - 98,223,643 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	103,043,770 - 103,123,943 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	76,012,756 - 76,092,901 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	81,713,582 - 81,785,567 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	81,713,582 - 81,788,714 (-)	Ensembl	panpan1.1		panPan2

NPLOC4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	538,087 - 604,898 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	537,840 - 603,480 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	1,142,086 - 1,207,840 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	1,133,445 - 1,199,269 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	1,131,519 - 1,198,105 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	1,158,270 - 1,223,977 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	1,284,872 - 1,349,805 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	1,363,947 - 1,429,700 (+)	NCBI		UU_Cfam_GSD_1.0

Nploc4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	1,158,248 - 1,205,737 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936594	5,205,659 - 5,251,026 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936594	5,206,222 - 5,251,042 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NPLOC4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	1,251,053 - 1,285,666 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	12	1,251,377 - 1,285,668 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	1,102,565 - 1,128,796 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NPLOC4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	73,499,737 - 73,570,753 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	16	73,502,123 - 73,570,710 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666077	44,881,353 - 44,976,051 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Nploc4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624801	10,533,064 - 10,589,096 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624801	10,531,107 - 10,589,502 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Nploc4
232 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	199
Count of miRNA genes:	150
Interacting mature miRNAs:	163
Transcripts:	ENSRNOT00000054973
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
7387312	Bw125	Body weight QTL 125	3	0.0047	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight (CMO:0000356)	10	65390777	107713808	Rat
1354641	Bvd2	Brain ventricular dilatation QTL 2	6.36	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	10	93723381	107556066	Rat
8657410	Bp374	Blood pressure QTL 374			heart left ventricle size trait (VT:0002753)	heart left ventricle end-diastolic diameter (CMO:0000982)	10	67476608	107713808	Rat
61449	Ciaa2	CIA Autoantibody QTL 2	7.1		blood autoantibody amount (VT:0003725)	calculated serum anti-type 2 collagen antibody titer (CMO:0001279)	10	63719161	107713808	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	52269185	107713808	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42546145	107713808	Rat
12903252	Cm113	Cardiac mass QTL 113		0.047	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	66817119	107713808	Rat
61396	Bp9	Blood pressure QTL 9	4.8	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	68920187	107713808	Rat
2298548	Neuinf7	Neuroinflammation QTL 7	3.4		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	10	64939013	107713808	Rat
1358915	Stresp7	Stress response QTL 7	3.52		blood norepinephrine amount (VT:0005663)	plasma norepinephrine level (CMO:0001010)	10	65307813	107713808	Rat
1302404	Cia27	Collagen induced arthritis QTL 27	2.6	0.0045	joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	10	76951790	107713808	Rat
70168	Eae12	Experimental allergic encephalomyelitis QTL 12		0.0009	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	10	73599825	107713808	Rat
634320	Niddm49	Non-insulin dependent diabetes mellitus QTL 49	4.41		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	10	89039175	107713808	Rat
70171	Cari1	Carrageenan-induced inflammation QTL 1	4.9	0.0005	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	10	54296227	107713808	Rat
70363	Bp71	Blood pressure QTL 71		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	61843496	106843496	Rat
6893366	Bw106	Body weight QTL 106	0.3	0.47	body mass (VT:0001259)	body weight (CMO:0000012)	10	70698731	107713808	Rat
12903269	Am15	Aortic mass QTL 15		0.042	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	66817119	107713808	Rat
1576313	Pia25	Pristane induced arthritis QTL 25			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	96620293	107713808	Rat
12903266	Cm114	Cardiac mass QTL 114		0.02	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	10	66817119	107713808	Rat
1578672	Bmd16	Bone mineral density QTL 16	6.2		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	10	97202388	107556066	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
1576307	Cia28	Collagen induced arthritis QTL 28			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	96620293	107713808	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40535708	107713808	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40535708	107713808	Rat
2313103	Bss80	Bone structure and strength QTL 80	2	0.0001	tibia strength trait (VT:1000284)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	10	62556066	107556066	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14991535	107713808	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40535708	107713808	Rat
1581559	Eae18	Experimental allergic encephalomyelitis QTL 18		0.00002	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	10	66108888	107555881	Rat
12880372	Am12	Aortic mass QTL 12		0.003	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	66817119	107713808	Rat
70193	Mcs7	Mammary carcinoma susceptibility QTL 7	2.38		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	72724423	107713808	Rat
2313105	Bss79	Bone structure and strength QTL 79	1.8	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	62556066	107556066	Rat
12880375	Kidm66	Kidney mass QTL 66		0.009	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	10	66817119	107713808	Rat
61363	Oia3	Oil induced arthritis QTL 3		0.001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	87807758	107713808	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14991535	107556066	Rat
12880370	Cm105	Cardiac mass QTL 105		0.008	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	10	66817119	107713808	Rat
12880371	Cm106	Cardiac mass QTL 106		0.007	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	66817119	107713808	Rat
1600367	Mcs15	Mammary carcinoma susceptibility QTL 15	4.5		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	72724423	107713808	Rat
631537	Oia4	Oil induced arthritis QTL 4			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	76128947	107713808	Rat
1300137	Bp186	Blood pressure QTL 186	3.57		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	10	91127270	107556066	Rat
634354	Rends3	Renal damage susceptibility QTL 3		0.05	kidney blood vessel morphology trait (VT:0000530)	organ lesion measurement (CMO:0000677)	10	61997479	106997479	Rat
61436	Cia5	Collagen induced arthritis QTL 5	4.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	91727883	107713808	Rat
11565453	Kidm58	Kidney mass QTL 58		0.002	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	10	66817119	107713808	Rat
2301405	Cm69	Cardiac mass QTL 69		0.031	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	10	66817119	107713808	Rat
1578663	Bss18	Bone structure and strength QTL 18	3.6		femur width (VT:1000666)	femoral neck width (CMO:0001695)	10	97202388	107556066	Rat

Markers in Region

RH136692

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	105,763,147 - 105,763,222 (+)	MAPPER	mRatBN7.2
mRatBN7.2	10	105,763,147 - 105,763,267 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	109,662,770 - 109,662,889	NCBI	Rnor6.0
Rnor_6.0	10	109,662,770 - 109,662,844	NCBI	Rnor6.0
Rnor_5.0	10	109,256,038 - 109,256,157	UniSTS	Rnor5.0
Rnor_5.0	10	109,256,038 - 109,256,112	UniSTS	Rnor5.0
RGSC_v3.4	10	109,874,899 - 109,874,973	UniSTS	RGSC3.4
RGSC_v3.4	10	109,874,899 - 109,875,018	UniSTS	RGSC3.4
Celera	10	104,307,077 - 104,307,151	UniSTS
Celera	10	104,307,077 - 104,307,196	UniSTS
Cytogenetic Map	10	q32.3	UniSTS

RH141802

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	105,762,113 - 105,762,315 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	109,661,736 - 109,661,937	NCBI	Rnor6.0
Rnor_5.0	10	109,255,004 - 109,255,205	UniSTS	Rnor5.0
RGSC_v3.4	10	109,873,865 - 109,874,066	UniSTS	RGSC3.4
Celera	10	104,306,043 - 104,306,244	UniSTS
Cytogenetic Map	10	q32.3	UniSTS

UniSTS:236796

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	105,655,698 - 105,655,979 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	109,554,405 - 109,554,685	NCBI	Rnor6.0
Rnor_5.0	10	109,148,973 - 109,149,253	UniSTS	Rnor5.0
RGSC_v3.4	10	109,810,008 - 109,810,288	UniSTS	RGSC3.4
Celera	10	104,201,036 - 104,201,316	UniSTS
Cytogenetic Map	10	q32.3	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
9	11	49	113	91	90	59	25	59	6	218	97	11	93	45	60	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_080577	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085086	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF234600	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC101887	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000054973 ⟹ ENSRNOP00000051856

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	106,153,173 - 106,204,037 (-)	Ensembl
mRatBN7.2 Ensembl	10	105,654,812 - 105,705,684 (-)	Ensembl
Rnor_6.0 Ensembl	10	109,552,649 - 109,610,030 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000080188 ⟹ ENSRNOP00000068982

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	106,153,173 - 106,208,264 (-)	Ensembl
mRatBN7.2 Ensembl	10	105,654,812 - 105,709,913 (-)	Ensembl
Rnor_6.0 Ensembl	10	109,555,241 - 109,604,899 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000114737 ⟹ ENSRNOP00000082441

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	106,153,173 - 106,208,264 (-)	Ensembl
mRatBN7.2 Ensembl	10	105,654,812 - 105,709,913 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000168258 ⟹ ENSRNOP00000100116

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	106,153,173 - 106,208,264 (-)	Ensembl

RefSeq Acc Id:

NM_080577 ⟹ NP_542144

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	106,153,173 - 106,208,264 (-)	NCBI
mRatBN7.2	10	105,654,812 - 105,709,913 (-)	NCBI
Rnor_6.0	10	109,553,518 - 109,610,087 (-)	NCBI
Rnor_5.0	10	109,148,086 - 109,198,162 (-)	NCBI
RGSC_v3.4	10	109,809,121 - 109,878,278 (-)	RGD
Celera	10	104,200,159 - 104,255,207 (-)	RGD

Sequence:

show sequence

CGCTGGCGGAGCCGGGCGGCGAAGCTGGAGCGGCGGTGGCGGCGGCGGCGGGAGGCCGGGGCCG
GGGCTGAGGCCGAGGCCGGGGCTGCGAGGCCCTTGGGGAGACAGGCGGCGGCAGCCCGGGGCCC
GAGCCCGGAGGCAGGAGCGACCGCCATGGCCGAGAGCATCATAATCCGTGTCCAATCCCCCGAT
GGAGTGAAGAGGATCACAGCAACAAAGAGAGAAACAGCCGCAACATTTCTGAAAAAGGTTGCAA
AGGAGTTTGGCTTCCAAAACAACGGCTTCTCGGTTTACATCAATAGAAACAAGACTGGAGAGAT
AACAGCATCGTCCAGCAAATCCCTGCATTTGCTAAAAATCAAGCATGGCGATTTGTTGTTCCTG
TTCCCCTCAAGCCTTGCTGGACCCTCATCTGAAATGGAAACATCGACCTCAGTAGGGTTAAAGG
CCTTTGGTGCTCCTCACGTGGTTGAAGATGAGATTGATCAATACCTCAGCAAGCAGGATGGGAA
GATTTATAGGAGCCGAGACCCACAGTTATGCCGCCATGGTCCCTTGGGCAAGTGTGTGCATTGT
GTCCCACTGGAGCCATTTGATGAAGACTATCTGAACCACTTGGAGCCTCCTGTGAAGCACATGT
CCTTCCATGCCTACATCCGGAAGCTGACTGGAGGGGCTGACAAGGGGAAGTTCGTTGCCCTGGA
GAACATCAGCTGCAAGATTAAGTCAGGATGTGAGGGACACCTCCCTTGGCCAAATGGTATCTGT
ACCAAATGCCAGCCTAGTGCCATCACATTGAACAGACAGAAATATAGACATGTGGACAACATTA
TGTTTGAGAATCACACTGTTGCTGACCGTTTCCTTGACTTCTGGAGAAAGACAGGAAACCAACA
TTTCGGGTACTTATATGGACGGTACACAGAGCACAAAGACATTCCCCTTGGCATCAGGGCTGAA
GTGGCTGCAATTTATGAGCCTCCTCAGATTGGTACACAGAACAGCCTGGAGCTTCTGGAAGATC
CAAAAGCTGAGGTGGTTGACGAGATTGCCTCCAAACTTGGCCTGAGGAAGGTTGGATGGATATT
CACGGACCTTGTCTCAGAAGATACCCGAAAGGGTACAGTCCGATACAGTCGGAATAAGGACACC
TATTTCCTGAGTTCAGAAGAATGCATCACTGCAGGAGACTTTCAAAACAAGCACCCCAACATTT
GCCGGCTCTCTCCGGATGGTCATTTTGGATCCAAGTTTGTTACTGCAGTGGCCACAGGTGGTCC
TGATAACCAGGTTCACTTTGAAGGGTACCAGGTATCCAATCAGTGCATGGCACTGGTCCGAGAT
GAGTGTCTTCTACCTTGTAAGGATGCCCCTGAGCTCGGCTATGCCAAGGAGTCCAGCAGTGAAC
AATATGTTCCTGACGTGTTTTACAAGGACATAGACAAGTTTGGCAATGAGATCACCCAGCTGGC
CCGTCCCCTGCCTGTGGAGTATCTCATCATAGATATCACAACCACCTTCCCCAAGGATCCAGTT
TACACTTTTTCTATTTCTCAAAATCCGTTTCCTATTGAAAACCGGGATGTGCTGGGTGAGACAC
AGGACTTCCATAGTTTGGCCACCTACTTGTCCCAGAATACCTCATCTGTGTTCTTGGATACCAT
CTCCGACTTCCATCTCCTGTTGTTTCTGGTCACCAATGAAGTCATGCCACTGCAGGACAGTATC
AGCCTGCTGCTAGAAGCCGTCAGGACCAGAAACGAGGAGCTAGCACAGACATGGAAAAAGTCTG
AACAGTGGGCCACCATTGAGCAGCTGTGCAGCACTGTTGGTGTGCAGCTCCCAGGCCTCCATGA
GTTTGGTGCAGTCGGGGGCTCTGCACGCGCTGCTACCTCTGCCATGTGGGCTTGTCAGCACTGC
ACCTTCATGAACCAGCCTGGCACAGGCCACTGCGAGATGTGCAGCCTTCCCCGGACCTAGGGCT
CTGGACCTCTGCTGTGTAGGACTGGGCCTGTCCAGCCCTCTCTGAAGTCTGGAGTGCCATATGT
TCCCTATAAGGCCTGAAGCCCACAGCCCTGAAACAGTGGGGCCAGCTACCCTGGTATTCCAGAT
ATACTGAAGCGTCTCAGTGCAGATCTTGAAGAGAAAGAACCCCAACTGCTGTGCTGGGGTTGAA
CACAACCTCCCAACTGGAAAGGCAGAGCAGACTTGCCCAAGAGCACCCCACTTGCCTCACTTAG
TCAATAACTCCCCACTGTGTTGGAGGACTGGACACCTCCGACCAACCACCTGAAATCGGGGTGC
ACAGAGAGGGTGCTGCTGTCACCCAGCCATCTTTCCTTCCTCTATGATTTTTGTTTTCTGCCTT
CCCACCTTCTTCCCCAGTGTTTGGATGGATGCTCCTAGTTGTCTCTGTTCCCTTGTTGTGGGGC
TGTGTCCCTCCTTTGGGAGCATGTGTGGCTAGGGTGTGGTAGCCTTGGTCTGACATGCAGTGTA
GTACGTCCCTGCCCTTTACTTGTCTGAAATCAGCAGTTATCAGTAATTCCCACCCAGGAAACTT
TTATTTATTGTTTTTTTTTTGTTGTTGTTTGTTTTGTTTTGTTTTTTAAGATAAAACTGCACAG
ATGGAGTGAGATAGATTTAATTCTACTCTCTTTCCTCCTTTAGTGCAGCCCCTCTTGGGTGGTT
TATTGGGCAGGAGGCCACCATCTTTTCTCCTCTGAAGCAAACCTCAGTGCCTGAGACTTTCCTG
CCTGCCACGCTGCAGACAGTAGAGATTGGTAGCACAGGTGGTTCATCAGAGCAGTAGTGGCTCT
TGCCTCACAGACAGCCCCTTCAAGTCTAGGGCAGCCCTGGAGTTCTGGTCCCTAATGTGTCCCT
ACATTATGGCCTTCTTGCACGGTGCTGTGGCAGTTGAGAAAGCCTAGAAAAGGTGCCCCTGTGA
CCACTGTGAGGCATGTAGAAACAGTTTGAGGGTCCTGTGTGGCTGCGTTATGACAGCCCTTACC
CAGGTAAGATATGGATATCTTGATGCCTCGTTGCCTTAATGAGAGCTAAGTCAGCTGTCCTTCA
CCCTGGGAAAGGCCATGCCAACTGTGGACTGCTGGGAGCCATGCGTGTCACTTGAGTAGAGTGC
ACCCGTGCTTCCTTCCCCATCTTTGGCCCTATGGACAGAGCACTTGTTGCTAGGTTATCGTGTG
GCAGGGCTGGCCAGCACCGTCGGTCTCACCTGACATGAGATCTGAAGCTACAGCCCTGGAGCTG
AGGAGCCACTGTGCTTGGTTTGGTATTGACAGGGTCATCTTGGAGGGTTGGGAGTGGTGGAGAG
CAGGGCAAGCAATCTCTCCAGCTACCTGCCAACAGTATAGAGATAAAGTGCTGAGGGCTGTCTA
ACCTCCCTCCTGGTAGTGTCCCGGCTAGGGCTTCACCTTTCTGTTTTTTTCTGGTCCCTAAGTC
TGGTAGACTGGATGTCCTTGTATTTCTGTGTCTGCAACTAAGCTATGTTTCTGATGCCAATCAT
TCTAGCACTATTACTCACGTTGGGCAGGTGCTGGGCAGCACAGACTCTGGAGACCTGTTTGCTA
CTGCTTATTCCCCCATTCATCTTTGTCTACAAAGTTAATTACGTTCTCGAGTTCTGGCATCCAC
ATAATTCTTGTTTTTCTCTGACTTTTAGCTAAAGAAATTTTTTGTGATTTCTCTGAAAAAAAAA
AAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039085086 ⟹ XP_038941014

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	106,152,756 - 106,208,306 (-)	NCBI
mRatBN7.2	10	105,654,395 - 105,709,958 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_542144	(Get FASTA)	NCBI Sequence Viewer
	XP_038941014	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAG27534	(Get FASTA)	NCBI Sequence Viewer
	AAI01888	(Get FASTA)	NCBI Sequence Viewer
	EDM06830	(Get FASTA)	NCBI Sequence Viewer
	EDM06831	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000068982
	ENSRNOP00000068982.2
	ENSRNOP00000100116
GenBank Protein	Q9ES54	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_542144 ⟸ NM_080577

- UniProtKB:

Q3T1J3 (UniProtKB/Swiss-Prot), Q9ES54 (UniProtKB/Swiss-Prot), A6HLC6 (UniProtKB/TrEMBL), A0A0G2JU66 (UniProtKB/TrEMBL), F1LQX9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAESIIIRVQSPDGVKRITATKRETAATFLKKVAKEFGFQNNGFSVYINRNKTGEITASSSKSL
HLLKIKHGDLLFLFPSSLAGPSSEMETSTSVGLKAFGAPHVVEDEIDQYLSKQDGKIYRSRDPQ
LCRHGPLGKCVHCVPLEPFDEDYLNHLEPPVKHMSFHAYIRKLTGGADKGKFVALENISCKIKS
GCEGHLPWPNGICTKCQPSAITLNRQKYRHVDNIMFENHTVADRFLDFWRKTGNQHFGYLYGRY
TEHKDIPLGIRAEVAAIYEPPQIGTQNSLELLEDPKAEVVDEIASKLGLRKVGWIFTDLVSEDT
RKGTVRYSRNKDTYFLSSEECITAGDFQNKHPNICRLSPDGHFGSKFVTAVATGGPDNQVHFEG
YQVSNQCMALVRDECLLPCKDAPELGYAKESSSEQYVPDVFYKDIDKFGNEITQLARPLPVEYL
IIDITTTFPKDPVYTFSISQNPFPIENRDVLGETQDFHSLATYLSQNTSSVFLDTISDFHLLLF
LVTNEVMPLQDSISLLLEAVRTRNEELAQTWKKSEQWATIEQLCSTVGVQLPGLHEFGAVGGSA
RAATSAMWACQHCTFMNQPGTGHCEMCSLPRT

hide sequence

Ensembl Acc Id:

ENSRNOP00000068982 ⟸ ENSRNOT00000080188

Ensembl Acc Id:

ENSRNOP00000051856 ⟸ ENSRNOT00000054973

RefSeq Acc Id:	XP_038941014 ⟸ XM_039085086
- Peptide Label:	isoform X1
- UniProtKB:	A0A0G2JU66 (UniProtKB/TrEMBL), F1LQX9 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000082441 ⟸ ENSRNOT00000114737

Ensembl Acc Id:

ENSRNOP00000100116 ⟸ ENSRNOT00000168258

Protein Domains

MPN RanBP2-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9ES54-F1-model_v2	AlphaFold	Q9ES54	1-608	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13697955

Promoter ID:

EPDNEW_R8480

Type:

initiation region

Name:

Nploc4_1

Description:

NPL4 homolog, ubiquitin recognition factor

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	109,610,096 - 109,610,156	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620794	AgrOrtholog
BIND	130678
	130682
	130685
BioCyc Gene	G2FUF-22433	BioCyc
Ensembl Genes	ENSRNOG00000036698	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000080188	ENTREZGENE
	ENSRNOT00000080188.2	UniProtKB/Swiss-Prot
	ENSRNOT00000168258	ENTREZGENE
Gene3D-CATH	Cytidine Deaminase, domain 2	UniProtKB/Swiss-Prot
	Phosphatidylinositol 3-kinase Catalytic Subunit, Chain A, domain 1	UniProtKB/Swiss-Prot
	Zn-finger domain of Sec23/24	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7930738	IMAGE-MGC_LOAD
InterPro	MPN	UniProtKB/Swiss-Prot
	Npl4	UniProtKB/Swiss-Prot
	NPL4_C	UniProtKB/Swiss-Prot
	Npl4_Ub-like_dom	UniProtKB/Swiss-Prot
	NPL4_Zn-bd_put	UniProtKB/Swiss-Prot
	Ubiquitin-like_domsf	UniProtKB/Swiss-Prot
	Znf_RanBP2	UniProtKB/Swiss-Prot
	Znf_RanBP2_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:140639	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:124575	IMAGE-MGC_LOAD
NCBI Gene	140639	ENTREZGENE
PANTHER	NUCLEAR PROTEIN LOCALIZATION PROTEIN 4 HOMOLOG	UniProtKB/Swiss-Prot
	PTHR12710	UniProtKB/Swiss-Prot
Pfam	NPL4	UniProtKB/Swiss-Prot
	UN_NPL4	UniProtKB/Swiss-Prot
	zf-NPL4	UniProtKB/Swiss-Prot
PhenoGen	Nploc4	PhenoGen
PIRSF	Polyub_prc_Npl4	UniProtKB/Swiss-Prot
PROSITE	MPN	UniProtKB/Swiss-Prot
	ZF_RANBP2_1	UniProtKB/Swiss-Prot
	ZF_RANBP2_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000036698	RatGTEx
SMART	ZnF_RBZ	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF54236	UniProtKB/Swiss-Prot
	SSF90209	UniProtKB/Swiss-Prot
UniProt	A0A0G2JU66	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I5ZTJ3_RAT	UniProtKB/TrEMBL
	A6HLC5_RAT	UniProtKB/TrEMBL
	A6HLC6	ENTREZGENE, UniProtKB/TrEMBL
	F1LQX9	ENTREZGENE, UniProtKB/TrEMBL
	NPL4_RAT	UniProtKB/Swiss-Prot
	Q3T1J3	ENTREZGENE
	Q9ES54	ENTREZGENE
UniProt Secondary	Q3T1J3	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-07-09	Nploc4	NPL4 homolog, ubiquitin recognition factor	Nploc4	nuclear protein localization 4 homolog (S. cerevisiae)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Nploc4	nuclear protein localization 4 homolog (S. cerevisiae)	Npl4	nuclear protein localization 4	Symbol and Name updated	1299863	APPROVED
2005-01-20	Npl4	nuclear protein localization 4		homolog of yeast nuclear protein localization 4	Name updated	1299863	APPROVED
2002-08-07	Npl4	homolog of yeast nuclear protein localization 4			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_physical_interaction	forms a complex with Ufd1	633500

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Annotations - KEGG (archival)