Vcp (valosin-containing protein) - Rat Genome Database

Name: Vcp
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Vcp (valosin-containing protein) Rattus norvegicus

Analyze

Symbol:

Vcp

Name:

valosin-containing protein

RGD ID:

621595

Description:

Enables ATP hydrolysis activity; adenyl ribonucleotide binding activity; and identical protein binding activity. Involved in several processes, including ERAD pathway; endoplasmic reticulum to Golgi vesicle-mediated transport; and positive regulation of ubiquitin-dependent protein catabolic process. Located in cytosol. Part of VCP-NPL4-UFD1 AAA ATPase complex and VCP-NSFL1C complex. Is active in glutamatergic synapse. Human ortholog(s) of this gene implicated in several diseases, including Charcot-Marie-Tooth disease type 2Y; Paget's disease of bone; frontotemporal dementia and/or amyotrophic lateral sclerosis-6; inclusion body myopathy with early-onset Paget disease of bone with or without frontotemporal dementia 1; and inclusion body myositis. Orthologous to human VCP (valosin containing protein); PARTICIPATES IN ataxia telangiectasia-mutated (ATM) signaling pathway; Endoplasmic Reticulum-associated degradation pathway; INTERACTS WITH 1,2,4-trimethylbenzene; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dibromophenyl 2,4,5-tribromophenyl ether.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

15S Mg(2+)-ATPase p97 subunit; TER ATPase; transitional endoplasmic reticulum ATPase

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	VCP (valosin containing protein)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Vcp (valosin containing protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Vcp (valosin containing protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	VCP (valosin containing protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	VCP (valosin containing protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Vcp (valosin containing protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	VCP (valosin containing protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	VCP (valosin containing protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Vcp (valosin containing protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	SBK2 (SH3 domain binding kinase family member 2)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	VCP (valosin containing protein)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Vcp (valosin containing protein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	vcp (valosin containing protein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	CDC48	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	TER94	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	TER94	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	cdc-48.1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	cdc-48.2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	vcp	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Allele / Splice:

Vcp^em1Ionsz

Genetic Models:

SD-Vcp^em1Ionsz

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	5	57,210,167 - 57,229,571 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	57,210,168 - 57,229,571 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	59,183,339 - 59,202,747 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	5	61,002,153 - 61,021,561 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	5	60,987,322 - 61,006,704 (-)	NCBI	Rnor_WKY
Rnor_6.0	5	58,426,548 - 58,445,953 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	58,426,549 - 58,445,953 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	62,951,999 - 62,971,402 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	59,472,100 - 59,491,508 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	59,472,279 - 59,491,687 (-)	NCBI
Celera	5	55,799,589 - 55,818,873 (-)	NCBI		Celera
Cytogenetic Map	5	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

acromesomelic dysplasia, Maroteaux type (ISO)

Alzheimer's disease (ISO)

amyotrophic lateral sclerosis (ISO)

amyotrophic lateral sclerosis type 1 (ISO)

amyotrophic lateral sclerosis type 6 (ISO)

anauxetic dysplasia (ISO)

Animal Disease Models (ISO)

Charcot-Marie-Tooth disease type 2Y (ISO)

congenital myopathy 6 (ISO)

Cytomegalovirus Infections (ISO)

dementia (ISO)

Developmental Disabilities (ISO)

Disease Progression (ISO)

distal arthrogryposis type 1A (ISO)

distal spinal muscular atrophy 2 (ISO)

Fanconi anemia (ISO)

Fanconi anemia complementation group G (ISO)

frontotemporal dementia (ISS)

frontotemporal dementia and/or amyotrophic lateral sclerosis-6 (ISO)

galactosemia (ISO)

genetic disease (ISO)

Hyperphosphatasia with Mental Retardation Syndrome 2 (ISO)

inclusion body myopathy with early-onset Paget disease of bone with or without frontotemporal dementia 1 (ISO)

inclusion body myopathy with Paget disease of bone and frontotemporal dementia (ISO)

inclusion body myositis (ISO)

intellectual disability (ISO)

Lewy body dementia (ISO)

Muscle Weakness (ISO)

Paget's disease of bone (ISO)

paraplegia (ISO)

primary ciliary dyskinesia (ISO)

Prostatic Neoplasms (ISO)

Stevens-Johnson syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2,4-trimethylbenzene (EXP)

1,2-dimethylhydrazine (ISO)

1-chloro-2,4-dinitrobenzene (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO)

1H-pyrazole (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP,ISO)

2,6-dinitrotoluene (EXP)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

4-phenylbutyric acid (EXP)

7,12-dimethyltetraphene (EXP)

aflatoxin B1 (ISO)

aristolochic acid A (ISO)

Aroclor 1254 (EXP)

arsenous acid (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

bortezomib (ISO)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

caffeine (ISO)

calcidiol (EXP)

ceruletide (EXP)

chenodeoxycholic acid (ISO)

chloropicrin (ISO)

chloroquine (ISO)

chromium trinitrate (ISO)

copper(II) sulfate (ISO)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

deoxycholic acid (ISO)

diarsenic trioxide (ISO)

dichlorine (EXP)

diethylstilbestrol (ISO)

endosulfan (EXP)

enzyme inhibitor (ISO)

epoxiconazole (ISO)

ethanol (EXP,ISO)

fenthion (ISO)

fenvalerate (EXP)

finasteride (EXP)

flutamide (EXP)

folic acid (ISO)

glycochenodeoxycholic acid (ISO)

glycocholic acid (ISO)

glycodeoxycholic acid (ISO)

hyaluronic acid (EXP)

hydrazine (EXP)

hydrogen peroxide (EXP)

isoflavones (EXP)

ivermectin (ISO)

L-serine (ISO)

lactacystin (ISO)

lead(II) chloride (ISO)

leflunomide (ISO)

lipopolysaccharide (ISO)

lovastatin (ISO)

lycopene (ISO)

N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO)

naphthalene (ISO)

nefazodone (EXP)

ochratoxin A (ISO)

okadaic acid (ISO)

ozone (EXP)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

phenethyl isothiocyanate (ISO)

phenobarbital (EXP)

piroxicam (ISO)

potassium chromate (ISO)

prostaglandin A1 (ISO)

quartz (ISO)

quercetin (ISO)

resveratrol (ISO)

rotenone (EXP,ISO)

silicon dioxide (ISO)

sirolimus (ISO)

sodium arsenite (EXP,ISO)

sodium dichromate (EXP,ISO)

streptozocin (EXP)

sulforaphane (ISO)

sulindac (EXP)

sunitinib (ISO)

tamoxifen (ISO)

taurine (ISO)

temozolomide (ISO)

testosterone enanthate (ISO)

tetrachloromethane (EXP)

thapsigargin (EXP)

thimerosal (ISO)

trichloroethene (ISO)

trimellitic anhydride (ISO)

valdecoxib (EXP)

valproic acid (ISO)

vinclozolin (EXP)

vorinostat (ISO)

warfarin (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

activation of cysteine-type endopeptidase activity involved in apoptotic process (ISO)

aggresome assembly (ISO)

ATP metabolic process (ISO)

autophagosome maturation (IBA,ISO,ISS)

autophagy (ISO,ISS)

cellular response to arsenite ion (ISO,ISS)

cellular response to heat (ISO,ISS)

DNA damage response (ISO,ISS)

DNA repair (ISS)

double-strand break repair (ISO,ISS)

endoplasmic reticulum stress-induced pre-emptive quality control (ISO,ISS)

endoplasmic reticulum to Golgi vesicle-mediated transport (IMP)

endosome to lysosome transport via multivesicular body sorting pathway (ISO,ISS)

ER-associated misfolded protein catabolic process (IBA,ISO)

ERAD pathway (ISO,ISS)

flavin adenine dinucleotide catabolic process (ISO)

interstrand cross-link repair (ISS)

macroautophagy (ISO,ISS)

mitotic spindle disassembly (IBA)

NADH metabolic process (ISO)

negative regulation of protein localization to chromatin (ISO)

negative regulation of smoothened signaling pathway (ISO)

positive regulation of ATP biosynthetic process (ISO)

positive regulation of canonical Wnt signaling pathway (ISO)

positive regulation of Lys63-specific deubiquitinase activity (ISO)

positive regulation of mitochondrial membrane potential (ISO)

positive regulation of oxidative phosphorylation (ISO)

positive regulation of proteasomal ubiquitin-dependent protein catabolic process (ISO)

positive regulation of protein catabolic process (ISO)

positive regulation of protein K63-linked deubiquitination (ISO)

positive regulation of protein-containing complex assembly (ISO)

positive regulation of ubiquitin-dependent protein catabolic process (IMP)

proteasomal protein catabolic process (ISO,ISS)

proteasome-mediated ubiquitin-dependent protein catabolic process (ISO,ISS)

protein ubiquitination (ISO,ISS)

protein-DNA covalent cross-linking repair (ISO,ISS)

regulation of aerobic respiration (ISO)

regulation of protein localization to chromatin (ISO,ISS)

regulation of synapse organization (IDA,IMP)

retrograde protein transport, ER to cytosol (EXP,IBA,ISO)

stress granule disassembly (ISO,ISS)

translesion synthesis (ISO,ISS)

ubiquitin-dependent ERAD pathway (EXP,IBA,ISO,ISS)

ubiquitin-dependent protein catabolic process (ISO)

viral genome replication (ISO)

Cellular Component

ATPase complex (ISO)

cytoplasm (ISO,NAS)

cytoplasmic stress granule (ISO,ISS)

cytosol (IBA,IDA,ISO)

Derlin-1 retrotranslocation complex (ISO)

endoplasmic reticulum (ISO)

endoplasmic reticulum membrane (ISO)

glutamatergic synapse (IDA,IMP)

lipid droplet (ISO)

nucleoplasm (IEA,ISO)

nucleus (IBA,ISO)

perinuclear region of cytoplasm (ISO)

proteasome complex (ISO)

protein-containing complex (ISO)

site of double-strand break (ISO,ISS)

synapse (ISO)

VCP-NPL4-UFD1 AAA ATPase complex (EXP,IBA,IDA,ISO)

VCP-NSFL1C complex (IPI,ISO)

Molecular Function

ADP binding (IMP,ISO)

ATP binding (IDA,IMP,ISO)

ATP hydrolysis activity (IBA,IDA,IMP,ISO)

BAT3 complex binding (ISO)

deubiquitinase activator activity (ISO)

identical protein binding (IDA,IPI,ISO)

K48-linked polyubiquitin modification-dependent protein binding (ISO)

lipid binding (IEA)

MHC class I protein binding (ISO)

polyubiquitin modification-dependent protein binding (IBA,ISO)

protein binding (IPI,ISO)

protein domain specific binding (ISO)

protein phosphatase binding (ISO)

protein-containing complex binding (IPI)

ubiquitin protein ligase binding (ISO)

ubiquitin-dependent protein binding (ISO)

ubiquitin-like protein ligase binding (ISO)

ubiquitin-specific protease binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

ataxia telangiectasia-mutated (ATM) signaling pathway (ISO)

Endoplasmic Reticulum-associated degradation pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Involvement of the p97-Ufd1-Npl4 complex in the regulated endoplasmic reticulum-associated degradation of inositol 1,4,5-trisphosphate receptors.	Alzayady KJ, etal., J Biol Chem. 2005 Oct 14;280(41):34530-7. Epub 2005 Aug 15.
2.	Distinct conformations of the protein complex p97-Ufd1-Npl4 revealed by electron cryomicroscopy.	Bebeacua C, etal., Proc Natl Acad Sci U S A. 2012 Jan 24;109(4):1098-103. doi: 10.1073/pnas.1114341109. Epub 2012 Jan 9.
3.	Conformational changes in the AAA ATPase p97-p47 adaptor complex.	Beuron F, etal., EMBO J. 2006 May 3;25(9):1967-76. Epub 2006 Apr 6.
4.	Analysis of nucleotide binding to P97 reveals the properties of a tandem AAA hexameric ATPase.	Briggs LC, etal., J Biol Chem. 2008 May 16;283(20):13745-52. doi: 10.1074/jbc.M709632200. Epub 2008 Mar 10.
5.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
7.	Isolation of a point-mutated p47 lacking binding affinity to p97ATPase.	Kaneko Y, etal., FEBS Lett. 2010 Sep 24;584(18):3873-7. doi: 10.1016/j.febslet.2010.07.061. Epub 2010 Aug 6.
8.	Functional ATPase activity of p97/valosin-containing protein (VCP) is required for the quality control of endoplasmic reticulum in neuronally differentiated mammalian PC12 cells.	Kobayashi T, etal., J Biol Chem 2002 Dec 6;277(49):47358-65.
9.	p47 is a cofactor for p97-mediated membrane fusion.	Kondo H, etal., Nature 1997 Jul 3;388(6637):75-8.
10.	A complex of mammalian ufd1 and npl4 links the AAA-ATPase, p97, to ubiquitin and nuclear transport pathways.	Meyer HH, etal., EMBO J 2000 May 15;19(10):2181-92.
11.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
12.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
13.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
14.	Double-strand break repair: 53BP1 comes into focus.	Panier S and Boulton SJ, Nat Rev Mol Cell Biol. 2014 Jan;15(1):7-18. doi: 10.1038/nrm3719. Epub 2013 Dec 11.
15.	Push back to respond better: regulatory inhibition of the DNA double-strand break response.	Panier S and Durocher D, Nat Rev Mol Cell Biol. 2013 Oct;14(10):661-72. doi: 10.1038/nrm3659. Epub 2013 Sep 4.
16.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
17.	GOA pipeline	RGD automated data pipeline
18.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
19.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
20.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
21.	SDF2L1 interacts with the ER-associated degradation machinery and retards the degradation of mutant proinsulin in pancreatic beta-cells.	Tiwari A, etal., J Cell Sci. 2013 May 1;126(Pt 9):1962-8. doi: 10.1242/jcs.117374. Epub 2013 Feb 26.
22.	Valosin-containing protein and neurofibromin interact to regulate dendritic spine density.	Wang HF, etal., J Clin Invest. 2011 Dec;121(12):4820-37. doi: 10.1172/JCI45677. Epub 2011 Nov 21.
23.	Inclusion body myopathy associated with Paget disease of bone and frontotemporal dementia is caused by mutant valosin-containing protein.	Watts GD, etal., Nat Genet. 2004 Apr;36(4):377-81. Epub 2004 Mar 21.
24.	Function of the p97-Ufd1-Npl4 complex in retrotranslocation from the ER to the cytosol: dual recognition of nonubiquitinated polypeptide segments and polyubiquitin chains.	Ye Y, etal., J Cell Biol. 2003 Jul 7;162(1):71-84.
25.	Isolation and characterization of the principal ATPase associated with transitional endoplasmic reticulum of rat liver.	Zhang L, etal., J Cell Biol 1994 Dec;127(6 Pt 2):1871-83.

Additional References at PubMed

PMID:8413590	PMID:9452483	PMID:9506515	PMID:10364224	PMID:10715114	PMID:10855792	PMID:10930451	PMID:11483959	PMID:12146947	PMID:12411482	PMID:12473691	PMID:12810701
PMID:14561754	PMID:15215856	PMID:15362974	PMID:15489334	PMID:15740751	PMID:16140914	PMID:16186510	PMID:16275660	PMID:16635246	PMID:16810319	PMID:16854843	PMID:17000876
PMID:17141156	PMID:17550236	PMID:17584300	PMID:17634366	PMID:17785525	PMID:17872946	PMID:18462676	PMID:18775313	PMID:19056867	PMID:19182904	PMID:19335618	PMID:19666135
PMID:20104022	PMID:20410307	PMID:20458337	PMID:20512113	PMID:21107009	PMID:21186355	PMID:21630459	PMID:21636303	PMID:21733848	PMID:21822278	PMID:21983102	PMID:22051847
PMID:22102169	PMID:22120668	PMID:22206666	PMID:22379090	PMID:22590560	PMID:22607976	PMID:22681889	PMID:22871113	PMID:22970133	PMID:23042605	PMID:23297223	PMID:23349634
PMID:23376485	PMID:23498975	PMID:23533145	PMID:23737493	PMID:23747190	PMID:24055316	PMID:24089527	PMID:24534009	PMID:25002582	PMID:25088257	PMID:25125609	PMID:25660456
PMID:25878907	PMID:26265139	PMID:26316108	PMID:26565908	PMID:26692333	PMID:26712278	PMID:26754107	PMID:26822609	PMID:26842564	PMID:26849035	PMID:27000202	PMID:27753622
PMID:28689657	PMID:28799247	PMID:29804830

Genomics

Comparative Map Data

Vcp
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	5	57,210,167 - 57,229,571 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	57,210,168 - 57,229,571 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	59,183,339 - 59,202,747 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	5	61,002,153 - 61,021,561 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	5	60,987,322 - 61,006,704 (-)	NCBI	Rnor_WKY
Rnor_6.0	5	58,426,548 - 58,445,953 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	58,426,549 - 58,445,953 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	62,951,999 - 62,971,402 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	59,472,100 - 59,491,508 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	59,472,279 - 59,491,687 (-)	NCBI
Celera	5	55,799,589 - 55,818,873 (-)	NCBI		Celera
Cytogenetic Map	5	q22	NCBI

VCP
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	35,056,064 - 35,072,625 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	9	35,053,928 - 35,072,668 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	35,056,061 - 35,072,622 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	35,046,560 - 35,062,564 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	9	35,046,560 - 35,062,564	NCBI
Celera	9	34,988,041 - 35,004,706 (-)	NCBI		Celera
Cytogenetic Map	9	p13.3	NCBI
HuRef	9	35,011,651 - 35,028,327 (-)	NCBI		HuRef
CHM1_1	9	35,055,907 - 35,072,605 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	9	35,075,243 - 35,091,804 (-)	NCBI		T2T-CHM13v2.0

Vcp
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	42,979,964 - 43,000,507 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	42,979,963 - 43,000,507 (-)	Ensembl		GRCm39 Ensembl
GRCm38	4	42,979,964 - 43,000,507 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	42,979,963 - 43,000,507 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	42,992,836 - 43,013,379 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	43,001,064 - 43,021,534 (-)	NCBI		MGSCv36	mm8
Celera	4	43,010,123 - 43,030,659 (-)	NCBI		Celera
Cytogenetic Map	4	A5	NCBI
cM Map	4	22.95	NCBI

Vcp
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955472	1,107,164 - 1,124,076 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955472	1,111,649 - 1,124,076 (+)	NCBI	ChiLan1.0	ChiLan1.0

VCP
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	9	89,522,985 - 89,539,187 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	34,907,147 - 34,923,227 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	35,712,937 - 35,729,588 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	9	35,712,937 - 35,729,588 (-)	Ensembl	panpan1.1		panPan2

VCP
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	11	51,636,986 - 51,651,749 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	11	51,637,411 - 51,651,714 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	11	50,205,792 - 50,220,556 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	11	52,702,444 - 52,717,215 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	11	52,702,830 - 52,724,878 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	11	51,246,536 - 51,261,297 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	11	51,231,677 - 51,246,443 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	11	51,933,494 - 51,948,301 (-)	NCBI		UU_Cfam_GSD_1.0

Vcp
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	166,538,385 - 166,554,770 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936524	3,085,500 - 3,102,466 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936524	3,085,959 - 3,102,461 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

VCP
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	235,851,206 - 235,869,634 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	235,854,532 - 235,869,712 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	263,379,929 - 263,394,992 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

VCP
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	45,545,139 - 45,560,702 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	12	45,545,507 - 45,563,380 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	42,661,397 - 42,677,470 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Vcp
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624915	253,240 - 270,501 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624915	253,240 - 270,440 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Vcp
68 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	306
Count of miRNA genes:	196
Interacting mature miRNAs:	222
Transcripts:	ENSRNOT00000046102
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331756	Rf34	Renal function QTL 34	4.16275		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	1	90450412	Rat
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	1	131345958	Rat
1331771	Rf35	Renal function QTL 35	4.36965		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	729470	86724018	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
8662454	Vetf3	Vascular elastic tissue fragility QTL 3	27.4		artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	5	2282226	69540447	Rat
7394712	Emca13	Estrogen-induced mammary cancer QTL 13			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	9823266	99753708	Rat
1641903	Alcrsp3	Alcohol response QTL 3			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	12689285	57689285	Rat
634305	Mamtr1	Mammary tumor resistance QTL 1		0.0001	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	12789751	113558310	Rat
1600358	Mamtr5	Mammary tumor resistance QTL 5			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	18873947	63873947	Rat
1358353	Srcrtb2	Stress Responsive Cort Basal QTL 2	3.48	0.003	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	18873947	74251464	Rat
8552954	Pigfal14	Plasma insulin-like growth factor 1 level QTL 14	9		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	21226744	66226744	Rat
1578767	Stresp17	Stress response QTL 17	4.3	0.01	blood aldosterone amount (VT:0005346)	plasma aldosterone level (CMO:0000551)	5	27955440	72955440	Rat
1578776	Stresp18	Stress response QTL 18	2.9		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	5	27955440	72955440	Rat
6903292	Stl28	Serum triglyceride level QTL 28	2.6	0.0073	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	5	28515489	73515489	Rat
6903306	Scl35	Serum cholesterol QTL 35	2.6	0.0073	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	28515489	73515489	Rat
2290448	Scl54	Serum cholesterol level QTL 54	2.93		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	31663789	131345958	Rat
1598807	Glom12	Glomerulus QTL 12	2.7		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	5	33215665	78215665	Rat
1298067	Scl15	Serum cholesterol level QTL 15	4.8	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	33215665	78215665	Rat
1302786	Kidm8	Kidney mass QTL 8	28.15		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	5	33215665	78215665	Rat
1576317	Eutr2	Estrogen induced uterine response QTL 2		0.01	uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	34730116	104251008	Rat
2316959	Gluco59	Glucose level QTL 59	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	34944474	113558310	Rat
1641922	Alcrsp8	Alcohol response QTL 8			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	5	35189153	68564008	Rat
1641912	Alcrsp18	Alcohol response QTL 18			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	35189153	141643988	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	40128307	148607290	Rat
1331773	Scl26	Serum cholesterol level QTL 26	3.065		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	43726656	86724018	Rat
1331801	Rf33	Renal function QTL 33	4.149		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	43726656	129132602	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
1300115	Hrtrt7	Heart rate QTL 7	2.76		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	5	47869062	90099692	Rat
9589025	Epfw7	Epididymal fat weight QTL 7	20.66	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	5	49463600	94463600	Rat
7411561	Bw134	Body weight QTL 134	24	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	49463600	94463600	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	50328551	141643988	Rat
2303615	Vencon7	Ventilatory control QTL 7		0.001	respiration trait (VT:0001943)	respiration rate (CMO:0000289)	5	50983895	95983895	Rat
2303574	Gluco42	Glucose level QTL 42	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	53496719	98496719	Rat
61359	Eaex	Experimental allergic encephalomyelitis QTL x	3		nervous system integrity trait (VT:0010566)	post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422)	5	55715622	100715622	Rat
70189	Mcs5	Mammary carcinoma susceptibility QTL 5	10.51		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55805606	132207589	Rat

Genetic Models

This gene Vcp is modified in the following models/strains

SD-Vcp^em1Ionsz

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	57	41	19	41	8	11	74	35	41	11	8
Low
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053864	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC141493	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC060518	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473962	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234510	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000161	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U11760	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000046102 ⟹ ENSRNOP00000040121

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	57,210,168 - 57,229,571 (-)	Ensembl
Rnor_6.0 Ensembl	5	58,426,549 - 58,445,953 (-)	Ensembl

RefSeq Acc Id:

NM_053864 ⟹ NP_446316

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	5	57,210,167 - 57,229,571 (-)	NCBI
Rnor_6.0	5	58,426,548 - 58,445,953 (-)	NCBI
Rnor_5.0	5	62,951,999 - 62,971,402 (-)	NCBI
RGSC_v3.4	5	59,472,100 - 59,491,508 (-)	RGD
Celera	5	55,799,589 - 55,818,873 (-)	RGD

Sequence:

show sequence

GTCGCCTCTCGCGGATTAGGAGCTAGCGTCTCCCGCCCGCCTGCCGCCCCGGTGCCGCTGGGAG
GAAGCGAGAGGGAGGCTGCCTGTGGGTTTGTCACTGCTGTTGCTCCTCCACCTGAGTGAGTCAA
GCCCGGGCCTAGTCGGTCGCCTACCATTCTCGTAGCCGTTACCCTCAGGCCGCCACAGCCGCCG
ACCGGGAGAGGCGCGCGCCATGGCCTCTGGAGCCGATTCAAAAGGTGATGATTTATCAACAGCC
ATTCTCAAACAGAAGAACCGTCCCAATCGGTTAATTGTTGATGAAGCCATCAATGAAGATAACA
GTGTGGTGTCCTTGTCCCAGCCCAAGATGGATGAACTACAGTTGTTCAGAGGTGACACGGTGTT
GCTAAAAGGAAAGAAGAGAAGGGAAGCTGTATGCATTGTTCTTTCTGATGACACGTGTTCTGAT
GAGAAGATTCGAATGAATAGAGTTGTTCGGAATAACCTCCGAGTTCGCCTAGGAGATGTCATCA
GCATCCAGCCATGCCCTGATGTAAAGTATGGCAAACGTATCCATGTGCTACCCATTGATGACAC
AGTGGAAGGCATCACTGGCAATCTTTTTGAGGTATACCTTAAGCCGTACTTCCTGGAAGCATAT
CGGCCCATCCGTAAAGGAGATATTTTCCTTGTCCGGGGTGGGATGCGTGCTGTGGAGTTCAAAG
TAGTAGAGACAGATCCCAGCCCTTACTGTATTGTTGCTCCAGACACAGTGATCCACTGTGAGGG
GGAGCCAATCAAGCGAGAGGATGAGGAGGAGTCCTTGAATGAAGTAGGCTATGATGACATCGGT
GGTTGCAGGAAGCAGCTAGCTCAGATAAAGGAGATGGTGGAGCTGCCACTGAGACATCCTGCAC
TCTTTAAGGCAATTGGTGTGAAGCCTCCTCGGGGAATCTTGCTATATGGACCTCCTGGGACAGG
GAAAACCTTGATTGCCCGAGCTGTGGCAAATGAAACTGGAGCCTTCTTCTTTCTGATCAATGGT
CCTGAAATCATGAGCAAATTGGCTGGTGAGTCTGAGAGCAACCTTCGTAAAGCCTTTGAGGAAG
CTGAAAAGAATGCTCCTGCCATCATCTTCATCGACGAGCTTGATGCCATTGCACCCAAAAGAGA
GAAAACTCACGGGGAAGTGGAGCGTCGCATCGTGTCTCAGTTGTTGACCCTTATGGATGGCCTA
AAGCAGAGAGCACATGTGATAGTTATGGCAGCAACCAATAGACCCAACAGCATTGACCCAGCCC
TACGGCGATTTGGTCGCTTTGACAGAGAGGTAGATATTGGAATCCCTGATGCTACAGGACGTTT
GGAAATTCTTCAGATCCATACCAAGAACATGAAACTGGCAGATGATGTGGACTTGGAACAGGTA
GCCAATGAGACTCATGGTCATGTGGGTGCTGACTTGGCAGCCCTGTGTTCAGAGGCTGCTCTAC
AGGCCATCCGGAAAAAAATGGACCTCATTGACCTAGAAGATGAGACCATTGACGCTGAGGTCAT
GAATTCCCTGGCAGTTACTATGGATGACTTCCGGTGGGCCTTAAGTCAAAGCAACCCATCAGCA
CTTCGGGAAACTGTGGTAGAAGTGCCACAAGTAACCTGGGAAGACATTGGAGGCCTGGAGGATG
TCAAACGGGAGCTTCAGGAGTTGGTTCAGTATCCTGTGGAGCATCCAGACAAATTCCTCAAATT
TGGCATGACTCCTTCCAAAGGTGTTCTTTTCTATGGACCGCCTGGCTGTGGGAAAACCTTACTG
GCCAAAGCCATTGCTAATGAATGCCAGGCTAACTTCATCTCCATCAAGGGTCCTGAGCTGCTTA
CCATGTGGTTTGGGGAATCTGAGGCCAATGTCAGGGAAATATTTGACAAGGCACGACAAGCTGC
CCCCTGTGTACTCTTCTTTGATGAGTTAGATTCAATTGCCAAGGCTCGTGGTGGTAATATTGGA
GATGGTGGTGGAGCTGCAGACCGAGTCATCAATCAGATCCTGACAGAAATGGATGGCATGTCCA
CAAAAAAGAATGTGTTTATCATTGGAGCTACCAACCGGCCTGACATCATTGATCCTGCTATCCT
AAGACCTGGCCGTCTTGATCAGCTCATTTATATCCCACTTCCTGATGAGAAGTCCCGTGTTGCC
ATCCTAAAAGCCAATCTGCGAAAATCCCCAGTTGCCAAGGATGTGGATTTGGAGTTCTTGGCTA
AGATGACTAATGGCTTTTCTGGAGCTGACCTGACAGAAATTTGCCAACGTGCTTGTAAACTAGC
CATTCGTGAATCTATCGAGAGTGAGATTAGGCGAGAACGAGAGAGGCAGACAAATCCATCAGCT
ATGGAAGTAGAAGAGGATGATCCAGTGCCTGAGATCCGCAGAGATCACTTTGAGGAAGCCATGC
GTTTTGCCCGACGTTCTGTCAGTGATAATGACATTCGGAAGTATGAAATGTTTGCCCAGACACT
GCAGCAAAGTCGAGGTTTTGGCAGCTTCAGATTCCCTTCAGGGAACCAGGGTGGAGCTGGCCCA
AGTCAGGGCAGTGGAGGTGGCACAGGTGGCAATGTGTACACAGAAGACAATGACGATGACCTCT
ATGGCTAAGTGATGTGCCAGCATGCAGCGAGCTGGCCTGGCTGGACCTTGTTCCCTGGGGGTGG
GGGCGCTCGCCCAATGGGAACCAGGGGTGTGCCCATGGCCTGTTCCATTCCTCAGTCCGAACAG
TTCAGCCCCAGTCAGACTCTGGACAGGGGTTTTCTGTTGCAAAAAAAAATTACAAAAGCGATAA
AATAAAAGTGATTTTCATTTGGGAGGTGAAGAGTGAATTACCAGCAAGGAGCTGGGCCTTGGGC
CCTCACCATTTCTGTTGTAGTTTGGGTGGTGCAGGTAACCTGTGTGGTGTGAACCGAGGCGCTG
CCCCCACCATCACCACAGTAAAGCATCTATACTCAATGCTGTCCAAGCCCTCCCTTACCTCTAG
CCAGCCTGGGTAGGTGGACAAGGGGCCTCAGTTTGCTGGGTGTTTATATAGAAAGTAGGTTGAT
TTTTATTTTACATGCTTTTGAGTTACTGTTGGAAGACTAATCATAAGCAGTTTCTAAACCAAAA
AAAAAAAAAAAAAAAAAAGACATGTTGTAAAAGGATAATAAATGTTGGGTCAAAATGGAAAAAA
AAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_446316	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAC52154	(Get FASTA)	NCBI Sequence Viewer
	AAH60518	(Get FASTA)	NCBI Sequence Viewer
	EDL98716	(Get FASTA)	NCBI Sequence Viewer
	EDL98717	(Get FASTA)	NCBI Sequence Viewer
	P46462	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_446316 ⟸ NM_053864

- UniProtKB:

P46462 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MASGADSKGDDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKR
REAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITG
NLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKRE
DEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIAR
AVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEV
ERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEILQIH
TKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVT
MDDFRWALSQSNPSALRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSK
GVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFF
DELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKKNVFIIGATNRPDIIDPAILRPGRLD
QLIYIPLPDEKSRVAILKANLRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRACKLAIRESIE
SEIRRERERQTNPSAMEVEEDDPVPEIRRDHFEEAMRFARRSVSDNDIRKYEMFAQTLQQSRGF
GSFRFPSGNQGGAGPSQGSGGGTGGNVYTEDNDDDLYG

hide sequence

RefSeq Acc Id:

ENSRNOP00000040121 ⟸ ENSRNOT00000046102

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P46462-F1-model_v2	AlphaFold	P46462	1-806	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693667

Promoter ID:

EPDNEW_R4192

Type:

initiation region

Name:

Vcp_1

Description:

valosin-containing protein

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	58,445,989 - 58,446,049	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621595	AgrOrtholog
BIND	130679
	130680
	130681
	130683
BioCyc Gene	G2FUF-41527	BioCyc
Ensembl Genes	ENSRNOG00000034242	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSRNOP00000040121	ENTREZGENE
	ENSRNOP00000040121.2	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000046102	ENTREZGENE
	ENSRNOT00000046102.3	UniProtKB/Swiss-Prot
Gene3D-CATH	1.10.8.60	UniProtKB/Swiss-Prot
	2.40.40.20	UniProtKB/Swiss-Prot
	3.10.330.10	UniProtKB/Swiss-Prot
	3.40.50.300	UniProtKB/Swiss-Prot
	6.10.20.150	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:5597843	IMAGE-MGC_LOAD
InterPro	AAA+_ATPase	UniProtKB/Swiss-Prot
	AAA_ATPase_CDC48	UniProtKB/Swiss-Prot
	AAA_lid_3	UniProtKB/Swiss-Prot
	Asp_de-COase-like_dom_sf	UniProtKB/Swiss-Prot
	ATPase_AAA_core	UniProtKB/Swiss-Prot
	ATPase_AAA_CS	UniProtKB/Swiss-Prot
	Cdc48_dom2	UniProtKB/Swiss-Prot
	CDC48_domain_2-like_sf	UniProtKB/Swiss-Prot
	CDC4_N-term_subdom	UniProtKB/Swiss-Prot
	P-loop_NTPase	UniProtKB/Swiss-Prot
	Vps4_C	UniProtKB/Swiss-Prot
KEGG Report	rno:116643	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72335	IMAGE-MGC_LOAD
NCBI Gene	116643	ENTREZGENE
PANTHER	AAA-FAMILY ATPASE	UniProtKB/Swiss-Prot
	TRANSITIONAL ENDOPLASMIC RETICULUM ATPASE	UniProtKB/Swiss-Prot
Pfam	AAA	UniProtKB/Swiss-Prot
	AAA_lid_3	UniProtKB/Swiss-Prot
	CDC48_2	UniProtKB/Swiss-Prot
	CDC48_N	UniProtKB/Swiss-Prot
	Vps4_C	UniProtKB/Swiss-Prot
PhenoGen	Vcp	PhenoGen
PROSITE	AAA	UniProtKB/Swiss-Prot
SMART	AAA	UniProtKB/Swiss-Prot
	CDC48_2	UniProtKB/Swiss-Prot
	CDC48_N	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF50692	UniProtKB/Swiss-Prot
	SSF52540	UniProtKB/Swiss-Prot
	SSF54585	UniProtKB/Swiss-Prot
TIGRFAMs	CDC48	UniProtKB/Swiss-Prot
UniProt	P46462	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-07-08	Vcp	valosin-containing protein			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Vcp	valosin-containing protein			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_domains	contains two conserved ATPase domains (D1 and D2)	727438
gene_process	may be important for degrading membrane-associated ubiquitinated proteins in the endoplasmic reticulum	727438

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)