Nkx2-5 (NK2 homeobox 5) - Rat Genome Database

Name: Nkx2-5
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Nkx2-5 (NK2 homeobox 5) Rattus norvegicus

Analyze

Symbol:

Nkx2-5

Name:

NK2 homeobox 5

RGD ID:

620520

Description:

Enables several functions, including DNA-binding transcription factor activity; histone deacetylase binding activity; and identical protein binding activity. Involved in several processes, including cellular response to hydrogen peroxide; negative regulation of transcription by RNA polymerase II; and response to estradiol. Located in nucleus. Biomarker of pulmonary fibrosis. Human ortholog(s) of this gene implicated in aortic valve disease 2; atrioventricular block; congenital heart disease (multiple); and congenital nongoitrous hypothyroidism 5. Orthologous to human NKX2-5 (NK2 homeobox 5); INTERACTS WITH acrylamide; ammonium chloride; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Csx; homeobox protein NK-2 homolog E; homeobox protein Nkx-2.5; NK2 transcription factor related, locus 5; NK2 transcription factor related, locus 5 (Drosophila); Nkx2.5; rNKx-2.5

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	NKX2-5 (NK2 homeobox 5)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Nkx2-5 (NK2 homeobox 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Nkx2-5 (NK2 homeobox 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	NKX2-5 (NK2 homeobox 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	NKX2-5 (NK2 homeobox 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Nkx2-5 (NK2 homeobox 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	NKX2-5 (NK2 homeobox 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	NKX2-5 (NK2 homeobox 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Nkx2-5 (NK2 homeobox 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Nkx2-5 (NK2 homeobox 5)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	NKX2-5 (NK2 homeobox 5)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	nkx2.5 (NK2 homeobox 5)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ceh-28	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	tin	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	10	16,340,428 - 16,347,004 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	16,344,159 - 16,346,934 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	21,093,028 - 21,095,888 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	10	20,581,977 - 20,584,837 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	10	16,071,642 - 16,074,502 (+)	NCBI	Rnor_WKY
Rnor_6.0	10	16,635,989 - 16,638,758 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	16,635,989 - 16,638,764 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	16,520,570 - 16,527,836 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	16,606,183 - 16,608,952 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	16,607,231 - 16,610,001 (+)	NCBI
Celera	10	16,004,548 - 16,007,317 (+)	NCBI		Celera
Cytogenetic Map	10	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

aortic valve disease 2 (ISO)

atrial fibrillation (ISO)

atrial heart septal defect (ISO)

atrial heart septal defect 7 (ISO)

Atrial Septal Defect with Atrioventricular Conduction Defects (ISO)

atrioventricular block (ISO)

atrioventricular septal defect (ISO)

Cardiac Conduction Defect (ISO)

Cardiomegaly (ISO)

Cardiovascular Abnormalities (ISO)

Common Ventricle (ISO)

congenital heart disease (ISO,ISS)

congenital nongoitrous hypothyroidism 5 (ISO)

Conotruncal Cardiac Defects (ISO)

dilated cardiomyopathy (ISO)

genetic disease (ISO)

heart septal defect (ISO)

hypertrophic cardiomyopathy (ISO)

hypoplastic left heart syndrome (ISO)

Hypoplastic Left Heart Syndrome 2 (ISO)

lissencephaly 3 (ISO)

myotonic disease (ISO)

pulmonary fibrosis (IEP)

second-degree atrioventricular block (ISO)

Splenic Hypoplasia (ISO)

Stroke (ISO)

tetralogy of Fallot (ISO)

Ventricular Fibrillation (ISO)

ventricular septal defect (ISO)

Ventricular Septal Defect 3 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,6-dimethyl-4-tridecylmorpholine (ISO)

4,4'-sulfonyldiphenol (ISO)

4-[3-(4-tert-butylphenyl)-2-methylpropyl]-2,6-dimethylmorpholine (ISO)

5-azacytidine (ISO)

acrylamide (EXP)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium dichloride (ISO)

CGP 52608 (ISO)

cisplatin (ISO)

copper atom (ISO)

copper(0) (ISO)

Cuprizon (EXP)

curcumin (ISO)

doxorubicin (EXP,ISO)

fenpropidin (ISO)

flusilazole (ISO)

homocysteine (EXP)

hydrogen peroxide (ISO)

icariin (ISO)

isoprenaline (ISO)

L-ascorbic acid (ISO)

leflunomide (ISO)

Licochalcone B (ISO)

metacetamol (ISO)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenylephrine (ISO)

pirinixic acid (ISO)

resveratrol (ISO)

testosterone (ISO)

trichloroethene (ISO)

triclosan (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adult heart development (IEA,ISO)

apoptotic process (ISO)

apoptotic process involved in heart morphogenesis (IEA,ISO)

atrial cardiac muscle tissue development (IEA,ISO)

atrial septum morphogenesis (IEA,ISO)

atrioventricular node cell development (IEA,ISO)

atrioventricular node cell fate commitment (IEA,ISO)

atrioventricular node development (ISO)

bundle of His development (IEA,ISO)

cardiac conduction system development (ISO)

cardiac muscle cell development (ISO)

cardiac muscle cell differentiation (IEP,ISO)

cardiac muscle cell proliferation (IEA,ISO)

cardiac muscle contraction (IEA,ISO)

cardiac muscle tissue development (ISO)

cardiac muscle tissue morphogenesis (ISO)

cardiac ventricle formation (IEA,ISO)

cardiac ventricle morphogenesis (ISO)

cell differentiation (IBA,ISO)

cell population proliferation (ISO)

cellular response to growth factor stimulus (IEP)

cellular response to hydrogen peroxide (IEP)

circulatory system development (ISO)

DNA-templated transcription (ISO)

DNA-templated transcription elongation (ISO)

embryonic heart tube development (ISO)

embryonic heart tube left/right pattern formation (IEA,ISO)

epithelial cell apoptotic process (IEA,ISO)

epithelial cell differentiation (IEA,ISO)

epithelial cell proliferation (IEA,ISO)

heart contraction (ISO)

heart development (ISO)

heart looping (IEA,ISO)

heart morphogenesis (ISO)

heart trabecula formation (IEA,ISO)

hemopoiesis (IEA,ISO)

negative regulation of apoptotic process (ISO)

negative regulation of canonical Wnt signaling pathway (IEA,ISO)

negative regulation of cardiac muscle cell apoptotic process (IEA,ISO)

negative regulation of epithelial cell apoptotic process (IEA,ISO)

negative regulation of myotube differentiation (IEA,ISO)

negative regulation of transcription by RNA polymerase II (IDA,IEA,ISO)

obsolete positive regulation of transcription via serum response element binding (ISO)

outflow tract morphogenesis (ISO)

outflow tract septum morphogenesis (IEA,ISO)

pharyngeal system development (IEA,ISO)

positive regulation of cardioblast differentiation (IEA,ISO)

positive regulation of cell population proliferation (ISO)

positive regulation of DNA-templated transcription (ISO)

positive regulation of epithelial cell proliferation (IEA,ISO)

positive regulation of gene expression (IEA,ISO)

positive regulation of heart contraction (IEA,ISO)

positive regulation of neuron differentiation (IEA,ISO)

positive regulation of sodium ion transport (IEA,ISO)

positive regulation of transcription by RNA polymerase II (ISO,ISS)

positive regulation of transcription initiation by RNA polymerase II (IEA,ISO)

proepicardium development (IEA,ISO)

pulmonary myocardium development (IEA,ISO)

Purkinje myocyte differentiation (IEA,ISO)

regulation of cardiac conduction (IEA,ISO)

regulation of cardiac muscle cell proliferation (IEA,ISO)

regulation of cardiac muscle contraction (IEA,ISO)

regulation of DNA-templated transcription (ISO)

regulation of transcription by RNA polymerase II (IBA,ISO)

response to estradiol (IEP)

right ventricular cardiac muscle tissue morphogenesis (IEA,ISO)

sarcomere organization (ISO)

septum secundum development (IEA,ISO)

spleen development (IEA,ISO,ISS)

thyroid gland development (IEA,ISO)

transcription by RNA polymerase II (IEA,ISO)

vasculogenesis (IEA,ISO)

ventricular cardiac myofibril assembly (IEA,ISO)

ventricular septum morphogenesis (IEA,ISO)

ventricular trabecula myocardium morphogenesis (IEA,ISO)

Cellular Component

cytoplasm (IEA,ISO)

nucleus (IBA,IDA,ISO)

protein-containing complex (ISO,ISS)

protein-DNA complex (IEA,ISO,ISS)

RNA polymerase II transcription regulator complex (IEA,ISO)

transcription regulator complex (ISO)

Molecular Function

chromatin binding (IEA,ISO)

DNA binding (ISO)

DNA-binding transcription activator activity (ISO)

DNA-binding transcription activator activity, RNA polymerase II-specific (IEA,ISO)

DNA-binding transcription factor activity (IDA,ISO)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA,ISO)

histone deacetylase binding (IPI)

identical protein binding (IPI)

protein binding (IPI,ISO)

protein homodimerization activity (IEA,ISO)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA,IEA,ISO,ISS)

RNA polymerase II-specific DNA-binding transcription factor binding (IEA,ISO)

sequence-specific DNA binding (IDA,ISO)

sequence-specific double-stranded DNA binding (ISO)

transcription cis-regulatory region binding (ISO,ISS)

References

References - curated

#	Reference Title	Reference Citation
1.	NKX2-5 mutations in an inbred consanguineous population: genetic and phenotypic diversity.	Abou Hassan OK, etal., Sci Rep. 2015 Mar 6;5:8848. doi: 10.1038/srep08848.
2.	A mouse model of human congenital heart disease: high incidence of diverse cardiac anomalies and ventricular noncompaction produced by heterozygous Nkx2-5 homeodomain missense mutation.	Ashraf H, etal., Circ Cardiovasc Genet. 2014 Aug;7(4):423-33. doi: 10.1161/CIRCGENETICS.113.000281. Epub 2014 Jul 15.
3.	Cardiac septal and valvular dysmorphogenesis in mice heterozygous for mutations in the homeobox gene Nkx2-5.	Biben C, etal., Circ Res. 2000 Nov 10;87(10):888-95.
4.	Histone deacetylases facilitate sodium/calcium exchanger up-regulation in adult cardiomyocytes.	Chandrasekaran S, etal., FASEB J. 2009 Nov;23(11):3851-64. doi: 10.1096/fj.09-132415. Epub 2009 Jul 28.
5.	The different cardiac expression of the type 2 iodothyronine deiodinase gene between human and rat is related to the differential response of the Dio2 genes to Nkx-2.5 and GATA-4 transcription factors.	Dentice M, etal., Mol Endocrinol. 2003 Aug;17(8):1508-21. Epub 2003 May 29.
6.	Familial Atrial Septal Defect and Sudden Cardiac Death: Identification of a Novel NKX2-5 Mutation and a Review of the Literature.	Ellesøe SG, etal., Congenit Heart Dis. 2016 May;11(3):283-90. doi: 10.1111/chd.12317. Epub 2015 Dec 18.
7.	Endothelin-converting enzyme-1 (ECE-1) is a downstream target of the homeobox transcription factor Nkx2-5.	Funke-Kaiser H, etal., FASEB J 2003 Aug;17(11):1487-9.
8.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
9.	NKX2.5 mutations in patients with tetralogy of fallot.	Goldmuntz E, etal., Circulation. 2001 Nov 20;104(21):2565-8.
10.	A novel CSX/NKX2-5 mutation causes autosomal-dominant AV block: are atrial fibrillation and syncopes part of the phenotype?	Gutierrez-Roelens I, etal., Eur J Hum Genet. 2006 Dec;14(12):1313-6. Epub 2006 Aug 9.
11.	Progressive AV-block and anomalous venous return among cardiac anomalies associated with two novel missense mutations in the CSX/NKX2-5 gene.	Gutierrez-Roelens I, etal., Hum Mutat. 2002 Jul;20(1):75-6.
12.	Nkx2.5/Csx represses myofibroblast differentiation.	Hu B, etal., Am J Respir Cell Mol Biol. 2010 Feb;42(2):218-26. Epub 2009 Apr 24.
13.	Functional dissection of sequence-specific NKX2-5 DNA binding domain mutations associated with human heart septation defects using a yeast-based system.	Inga A, etal., Hum Mol Genet. 2005 Jul 15;14(14):1965-75. Epub 2005 May 25.
14.	Characterization of homo- and heterodimerization of cardiac Csx/Nkx2.5 homeoprotein.	Kasahara H, etal., J Biol Chem. 2001 Feb 16;276(7):4570-80. Epub 2000 Oct 20.
15.	Progressive atrioventricular conduction defects and heart failure in mice expressing a mutant Csx/Nkx2.5 homeoprotein.	Kasahara H, etal., J Clin Invest. 2001 Jul;108(2):189-201.
16.	Carboxyl terminus of Nkx2.5 impairs its interaction with p300.	Li T, etal., J Mol Biol. 2007 Jul 27;370(5):976-92. Epub 2007 May 18.
17.	Novel NKX2-5 mutations in patients with familial atrial septal defects.	Liu XY, etal., Pediatr Cardiol. 2011 Feb;32(2):193-201. doi: 10.1007/s00246-010-9859-6. Epub 2010 Dec 25.
18.	Cardiomyocyte differentiation of rat bone marrow multipotent progenitor cells is associated with downregulation of Oct-4 expression.	Lu T, etal., Tissue Eng Part A. 2010 Oct;16(10):3111-7.
19.	17 beta-estradiol modulates expression of low-voltage-activated Ca(V)3.2 T-type calcium channel via extracellularly regulated kinase pathway in cardiomyocytes.	Marni F, etal., Endocrinology. 2009 Feb;150(2):879-88. Epub 2008 Oct 1.
20.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
21.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
22.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
23.	A novel stop mutation truncating critical regions of the cardiac transcription factor NKX2-5 in a large family with autosomal-dominant inherited congenital heart disease.	Pabst S, etal., Clin Res Cardiol. 2008 Jan;97(1):39-42. Epub 2007 Sep 25.
24.	Ventricular noncompaction and distal chromosome 5q deletion.	Pauli RM, etal., Am J Med Genet 1999 Aug 6;85(4):419-23.
25.	Novel and highly lethal NKX2.5 missense mutation in a family with sudden death and ventricular arrhythmia.	Perera JL, etal., Pediatr Cardiol. 2014 Oct;35(7):1206-12. doi: 10.1007/s00246-014-0917-3. Epub 2014 Jun 1.
26.	A novel NKX2.5 loss-of-function mutation associated with congenital bicuspid aortic valve.	Qu XK, etal., Am J Cardiol. 2014 Dec 15;114(12):1891-5. doi: 10.1016/j.amjcard.2014.09.028. Epub 2014 Sep 28.
27.	Somatic NKX2-5 mutations as a novel mechanism of disease in complex congenital heart disease.	Reamon-Buettner SM and Borlak J, J Med Genet. 2004 Sep;41(9):684-90.
28.	GOA pipeline	RGD automated data pipeline
29.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
30.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
31.	Epistatic rescue of Nkx2.5 adult cardiac conduction disease phenotypes by prospero-related homeobox protein 1 and HDAC3.	Risebro CA, etal., Circ Res. 2012 Jul 6;111(2):e19-31. doi: 10.1161/CIRCRESAHA.111.260695. Epub 2012 May 29.
32.	Congenital heart disease caused by mutations in the transcription factor NKX2-5.	Schott JJ, etal., Science. 1998 Jul 3;281(5373):108-11.
33.	The ambiguous role of NKX2-5 mutations in thyroid dysgenesis.	van Engelen K, etal., PLoS One. 2012;7(12):e52685. doi: 10.1371/journal.pone.0052685. Epub 2012 Dec 28.
34.	Novel NKX2-5 mutations responsible for congenital heart disease.	Wang J, etal., Genet Mol Res. 2011 Nov 29;10(4):2905-15. doi: 10.4238/2011.November.29.1.
35.	A novel NKX2-5 mutation in familial ventricular septal defect.	Wang J, etal., Int J Mol Med. 2011 Mar;27(3):369-75. doi: 10.3892/ijmm.2010.585. Epub 2010 Dec 16.
36.	SIRT1 mediates the protective function of Nkx2.5 during stress in cardiomyocytes.	Zheng W, etal., Basic Res Cardiol. 2013 Jul;108(4):364. doi: 10.1007/s00395-013-0364-y. Epub 2013 Jun 7.
37.	Functional analyses of three Csx/Nkx-2.5 mutations that cause human congenital heart disease.	Zhu W, etal., J Biol Chem. 2000 Nov 10;275(45):35291-6.

Additional References at PubMed

PMID:7628699	PMID:8887666	PMID:8900044	PMID:9192865	PMID:9312027	PMID:9857019	PMID:9858576	PMID:10021345	PMID:10206974	PMID:10587520	PMID:11390666	PMID:11431700
PMID:11572777	PMID:11784028	PMID:11889119	PMID:12023302	PMID:12297045	PMID:12392994	PMID:12754203	PMID:14550786	PMID:14645532	PMID:14978031	PMID:15085192	PMID:15109497
PMID:15363409	PMID:15649947	PMID:15653675	PMID:15843414	PMID:16380715	PMID:16418214	PMID:16510504	PMID:16556915	PMID:16678093	PMID:17234970	PMID:17250822	PMID:17350578
PMID:17360443	PMID:17498735	PMID:17604724	PMID:17823370	PMID:18079734	PMID:18285513	PMID:18689573	PMID:18722343	PMID:19035347	PMID:19253817	PMID:19479054	PMID:19483677
PMID:19546853	PMID:19578358	PMID:20457810	PMID:20713518	PMID:20807224	PMID:21379568	PMID:21690310	PMID:21931855	PMID:22527936	PMID:22560297	PMID:22849347	PMID:23892084
PMID:24866243	PMID:26926761	PMID:27207958	PMID:27747432	PMID:31104268	PMID:32780729	PMID:33035436

Genomics

Comparative Map Data

Nkx2-5
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	10	16,340,428 - 16,347,004 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	16,344,159 - 16,346,934 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	21,093,028 - 21,095,888 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	10	20,581,977 - 20,584,837 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	10	16,071,642 - 16,074,502 (+)	NCBI	Rnor_WKY
Rnor_6.0	10	16,635,989 - 16,638,758 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	16,635,989 - 16,638,764 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	16,520,570 - 16,527,836 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	16,606,183 - 16,608,952 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	16,607,231 - 16,610,001 (+)	NCBI
Celera	10	16,004,548 - 16,007,317 (+)	NCBI		Celera
Cytogenetic Map	10	q12	NCBI

NKX2-5
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	173,232,109 - 173,235,206 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	5	173,232,109 - 173,235,311 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	172,659,112 - 172,662,209 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	172,591,744 - 172,594,868 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	5	168,692,473 - 168,695,681 (-)	NCBI		Celera
Cytogenetic Map	5	q35.1	NCBI
HuRef	5	167,754,405 - 167,757,613 (-)	NCBI		HuRef
CHM1_1	5	172,091,589 - 172,094,797 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	5	173,772,181 - 173,775,278 (-)	NCBI		T2T-CHM13v2.0

Nkx2-5
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	27,057,638 - 27,063,962 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	27,057,638 - 27,063,983 (-)	Ensembl		GRCm39 Ensembl
GRCm38	17	26,838,664 - 26,844,988 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	26,838,664 - 26,845,009 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	17	26,975,610 - 26,978,510 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	17	26,566,254 - 26,569,154 (-)	NCBI		MGSCv36	mm8
Celera	17	27,375,289 - 27,378,187 (-)	NCBI		Celera
Cytogenetic Map	17	A3.3	NCBI
cM Map	17	13.6	NCBI

Nkx2-5
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955408	25,832,683 - 25,836,840 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955408	25,833,649 - 25,836,673 (-)	NCBI	ChiLan1.0	ChiLan1.0

NKX2-5
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	5	175,492,288 - 175,495,514 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	175,492,288 - 175,495,514 (-)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	5	168,584,197 - 168,589,406 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

NKX2-5
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	4	39,240,755 - 39,254,585 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	4	39,244,286 - 39,247,592 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	4	39,189,667 - 39,192,973 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	4	39,612,560 - 39,618,296 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	4	39,614,913 - 39,618,296 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	4	39,432,539 - 39,435,856 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	4	39,621,539 - 39,624,869 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	4	40,130,495 - 40,133,809 (+)	NCBI		UU_Cfam_GSD_1.0

Nkx2-5
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	93,683,325 - 93,686,308 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936609	2,406,004 - 2,409,046 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936609	2,406,004 - 2,408,980 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NKX2-5
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	16	51,086,011 - 51,089,162 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	16	51,086,014 - 51,089,165 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	16	55,400,567 - 55,403,626 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NKX2-5
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	23	75,391,833 - 75,399,003 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	23	75,391,847 - 75,395,205 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666034	3,212,995 - 3,216,184 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Nkx2-5
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624733	16,881,191 - 16,884,210 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624733	16,881,189 - 16,884,245 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Nkx2-5
9 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	60
Count of miRNA genes:	56
Interacting mature miRNAs:	59
Transcripts:	ENSRNOT00000028155
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
634329	Pia15	Pristane induced arthritis QTL 15	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	1	24158324	Rat
2293680	Bss40	Bone structure and strength QTL 40	5.66	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	10	1	35225947	Rat
634327	Hc4	Hypercalciuria QTL 4	2.4		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	10	1	38328221	Rat
7411611	Foco17	Food consumption QTL 17	18.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	1	42315980	Rat
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1	80676123	Rat
10401803	Kidm50	Kidney mass QTL 50			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	10	418344	45418344	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	743364	63851208	Rat
1576304	Schws7	Schwannoma susceptibility QTL 7		0.0115	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	4765527	19816042	Rat
631828	Alc5	Alcohol consumption QTL 5	2.4		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	10	5144027	17245662	Rat
737820	Alc9	Alcohol consumption QTL 9	2.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	10	5144027	19233348	Rat
2313064	Bmd71	Bone mineral density QTL 71	0.9	0.0001	tibia mineral mass (VT:1000283)	cortical volumetric bone mineral density (CMO:0001730)	10	5387014	50387014	Rat
2313066	Bss63	Bone structure and strength QTL 63	1.4	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	10	5387014	50387014	Rat
2313081	Bss64	Bone structure and strength QTL 64	1.3	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	10	5387014	50387014	Rat
2313095	Bss62	Bone structure and strength QTL 62	1.5	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
2313104	Bss61	Bone structure and strength QTL 61	0.9	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
2298544	Neuinf9	Neuroinflammation QTL 9	4.6		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	10	5801990	62146030	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6154182	73453136	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6357896	96121100	Rat
1578761	Stresp21	Stress response QTL 21	3.3		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	6375746	51375746	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
9590310	Scort19	Serum corticosterone level QTL 19	6.3	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
9590268	Scort13	Serum corticosterone level QTL 13	3.26	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
9589136	Insul27	Insulin level QTL 27	10.46	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	10	11474010	56474010	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14487011	89062041	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14487011	104060283	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat
1354587	Kidm21	Kidney mass QTL 21	3.3		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	10	15028513	60430477	Rat
631564	Apr3	Acute phase response QTL 3	3.9		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	10	15275955	60275955	Rat
6893350	Bw99	Body weight QTL 99	0.87	0.16	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
6893352	Bw100	Body weight QTL 100	0.33	0.6	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat

Markers in Region

Nkx2-5

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	16,346,390 - 16,347,001 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	16,638,221 - 16,638,831	NCBI	Rnor6.0
Rnor_5.0	10	16,527,223 - 16,527,833	UniSTS	Rnor5.0
RGSC_v3.4	10	16,608,415 - 16,609,025	UniSTS	RGSC3.4
Celera	10	16,006,780 - 16,007,390	UniSTS
Cytogenetic Map	10	q12	UniSTS

RH133759

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	16,346,853 - 16,347,004 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	16,638,684 - 16,638,834	NCBI	Rnor6.0
Rnor_5.0	10	16,527,686 - 16,527,836	UniSTS	Rnor5.0
RGSC_v3.4	10	16,608,878 - 16,609,028	UniSTS	RGSC3.4
Celera	10	16,007,243 - 16,007,393	UniSTS
RH 3.4 Map	10	149.46	UniSTS
Cytogenetic Map	10	q12	UniSTS

UniSTS:463422

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	16,344,531 - 16,346,227 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	16,636,362 - 16,638,057	NCBI	Rnor6.0
Rnor_5.0	10	16,525,364 - 16,527,059	UniSTS	Rnor5.0
RGSC_v3.4	10	16,606,556 - 16,608,251	UniSTS	RGSC3.4
Celera	10	16,004,921 - 16,006,616	UniSTS
Cytogenetic Map	10	q12	UniSTS

UniSTS:472868

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	16,346,121 - 16,346,297 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	16,637,952 - 16,638,127	NCBI	Rnor6.0
Rnor_5.0	10	16,526,954 - 16,527,129	UniSTS	Rnor5.0
RGSC_v3.4	10	16,608,146 - 16,608,321	UniSTS	RGSC3.4
Celera	10	16,006,511 - 16,006,686	UniSTS
Cytogenetic Map	10	q12	UniSTS

Nkx2-5

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	16,346,035 - 16,346,252 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	16,637,866 - 16,638,082	NCBI	Rnor6.0
Rnor_5.0	10	16,526,868 - 16,527,084	UniSTS	Rnor5.0
RGSC_v3.4	10	16,608,060 - 16,608,276	UniSTS	RGSC3.4
Celera	10	16,006,425 - 16,006,641	UniSTS
Cytogenetic Map	10	q12	UniSTS

Nkx2-5

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	16,344,042 - 16,344,577 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	16,635,873 - 16,636,407	NCBI	Rnor6.0
Rnor_5.0	10	16,524,875 - 16,525,409	UniSTS	Rnor5.0
RGSC_v3.4	10	16,606,067 - 16,606,601	UniSTS	RGSC3.4
Celera	10	16,004,432 - 16,004,966	UniSTS
Cytogenetic Map	10	q12	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	43			2						3
Low		4	4	9	4					4	6
Below cutoff		12	7	4	7	1	1	4	5	13	3	1

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053651	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085022	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC119699	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF006664	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000219	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000028155 ⟹ ENSRNOP00000028155

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	16,344,159 - 16,346,934 (+)	Ensembl
Rnor_6.0 Ensembl	10	16,635,989 - 16,638,764 (+)	Ensembl

RefSeq Acc Id:

NM_053651 ⟹ NP_446103

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	10	16,344,146 - 16,347,004 (+)	NCBI
Rnor_6.0	10	16,635,989 - 16,638,758 (+)	NCBI
Rnor_5.0	10	16,520,570 - 16,527,836 (+)	NCBI
RGSC_v3.4	10	16,606,183 - 16,608,952 (+)	RGD
Celera	10	16,004,548 - 16,007,317 (+)	RGD

Sequence:

show sequence

GGACAGCGGGCACCATGCGGGAAGGCTATCCCCGGGGGTGGGCAGTGCCACTCTCTGCCACCCA
CCTGGCGCTGTGAGACCGGCGTCGCCACCATGTTCCCCAGCCCTGCGCTCACACACACGCCCTT
CTCAGTCAAAGACATCCTGAACCTGGAGCAGCAGCAGCGCAGCCTGGCGGCTGGGGACCTGTCT
GCGCGCCTCGAGGCCACCCTGGCGCCCGCCTCCTGCATGCTGGCCGCCTTCAAGCCGGACGGCT
ACTCAGGCCCCGAGGCGGCAGCGCCCGGCCTGGCAGAGCTGCGCGCGGAGCTGGGCCCCGCGCC
TTCGCCCCCCAAGTGCTCTCCTGCTTTCCCAACCGCCCCTACATTTTATCCGCGAGCCTACGGT
GACCCTGACCCCGCCAAGGACCCTCGGGCGGATAAGAAAGAGCTGTGCGCGCTGCAGAAGGCGG
TGGAGCTGGACAAAGCCGAGACAGACGGCGCCGAGAGGCGACGACCACGGCGGCGACGGAAGCC
ACGCGTGCTCTTCTCGCAGGCGCAGGTCTATGAGCTGGAGCGGCGCTTCAAGCAACAGCGGTAC
CTGTCGCCCGCTGAGCGCGACCAACTGGCCAGCGTGCTGAAGCTCACGTCCACGCAGGTCAAGA
TCTGGTTCCAGAACCGCCGCTACAAGTGTAAGCGACAGCGGCAGGACCAGACTCTGGAGCTGCT
GGGGCCGCCGCCGCCGCCCGCGCGCAGGATCGCGGTGCCGGTGTTGGTGCGCGACGGGAAGCCC
TGCCTGGGGGACTCGGCGGCCTACGCTCCCGCCTACGGCCTGGGTCTCAACGCCTACGGCTACA
ACGCCTACCCCTATCCCGGCTACGGTGGCGCGGCCTGCAGTCCCGCCTACAGCTGCGCCGCGTA
CCCCGCCGCGCCCCCCGCCGCGCACGCCCCAGCCGCCAGCGCCAACAGCAACTTCGTGAACTTT
GGCGTCGGGGACTTGAACACGGTGCAGAGTCCCGGGATGCCACAGGGCAATTCGGGCGTCTCCA
CGCTGCACGGCATCCGAGCCTGGTAGGGAAAGGGCCCGTCTGGGGAACCCCGGACCGACTCCCA
CCTTTAGGAGAAGGGCGATGACTCCGGGGATGGAAAGGCTCCCACTGTGTCCTGTCCCTCGGAT
TTCACACCCACACTTGCGCAGGCCTGGGACCTTTCTCCGATCCATCCCCTTTTGTTGACCTAAC
CTGATGCCTCGGTCCTGGGAAAGCCCTTCAGGGCCAAAGGCACCCTCCACGGATTCCATATCAG
GACCCGGAGCCTGGGCCGGGCGCCCGGGCCCTGGGTGCCTTGCCGGCGCCCACCGGCCGGGG

hide sequence

RefSeq Acc Id:

XM_039085022 ⟹ XP_038940950

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	10	16,340,428 - 16,347,004 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_446103	(Get FASTA)	NCBI Sequence Viewer
	XP_038940950	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB62696	(Get FASTA)	NCBI Sequence Viewer
	EDM04040	(Get FASTA)	NCBI Sequence Viewer
	O35767	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_446103 ⟸ NM_053651

- UniProtKB:

G3V8T2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MFPSPALTHTPFSVKDILNLEQQQRSLAAGDLSARLEATLAPASCMLAAFKPDGYSGPEAAAPG
LAELRAELGPAPSPPKCSPAFPTAPTFYPRAYGDPDPAKDPRADKKELCALQKAVELDKAETDG
AERRRPRRRRKPRVLFSQAQVYELERRFKQQRYLSPAERDQLASVLKLTSTQVKIWFQNRRYKC
KRQRQDQTLELLGPPPPPARRIAVPVLVRDGKPCLGDSAAYAPAYGLGLNAYGYNAYPYPGYGG
AACSPAYSCAAYPAAPPAAHAPAASANSNFVNFGVGDLNTVQSPGMPQGNSGVSTLHGIRAW

hide sequence

RefSeq Acc Id:

ENSRNOP00000028155 ⟸ ENSRNOT00000028155

RefSeq Acc Id:	XP_038940950 ⟸ XM_039085022
- Peptide Label:	isoform X1
- UniProtKB:	G3V8T2 (UniProtKB/TrEMBL)

Protein Domains

Homeobox

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O35767-F1-model_v2	AlphaFold	O35767	1-318	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620520	AgrOrtholog
BioCyc Gene	G2FUF-25651	BioCyc
Ensembl Genes	ENSRNOG00000020747	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000028155	ENTREZGENE
	ENSRNOP00000028155.3	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000028155	ENTREZGENE
	ENSRNOT00000028155.6	UniProtKB/TrEMBL
InterPro	Homeobox-like_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Homeobox_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Homeobox_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Homeobox_metazoa	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NKX-2.5	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:114109	UniProtKB/Swiss-Prot
NCBI Gene	114109	ENTREZGENE
PANTHER	PTHR24340:SF28	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Homeodomain	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Nkx2-5	PhenoGen
PRINTS	HOMEOBOX	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	HOMEOBOX_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	HOMEOBOX_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	HOX	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF46689	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	G3V8T2	ENTREZGENE, UniProtKB/TrEMBL
	NKX25_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2011-08-02	Nkx2-5	NK2 homeobox 5	Nkx2-5	NK2 transcription factor related, locus 5 (Drosophila)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Nkx2-5	NK2 transcription factor related, locus 5 (Drosophila)	Csx		Symbol updated	1299863	APPROVED
2002-08-07	Csx	NK2 transcription factor related, locus 5 (Drosophila)			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_function	binds within the ECE-1c promoter to activate expression of Endothelin-converting enzyme-1	727751

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM