Symbol:
Doc2b
Name:
double C2 domain beta
RGD ID:
620519
Description:
Enables calcium-dependent phospholipid binding activity. Involved in calcium ion-regulated exocytosis of neurotransmitter; calcium-dependent activation of synaptic vesicle fusion; and positive regulation of calcium ion-dependent exocytosis. Located in plasma membrane. Part of SNARE complex. Is active in glutamatergic synapse. Is extrinsic component of synaptic vesicle membrane. Orthologous to human DOC2B (double C2 domain beta); INTERACTS WITH 2,2',5,5'-tetrachlorobiphenyl; 6-propyl-2-thiouracil; amitrole.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
doc2-beta; double C2, beta; double C2-like domain-containing protein beta; double C2-like domains, beta
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
DOC2B (double C2 domain beta) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, Panther
Mus musculus (house mouse):
Doc2b (double C2, beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Doc2b (double C2 domain beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
DOC2B (double C2 domain beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
DOC2B (double C2 domain beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Doc2b (double C2 domain beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
DOC2B (double C2 domain beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
DOC2B (double C2 domain beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Doc2b (double C2 domain beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
DOC2A (double C2 domain alpha) HGNC
OrthoDB
Alliance orthologs 3
Homo sapiens (human):
DOC2B (double C2 domain beta)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Doc2b (double C2, beta)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
doc2b (double C2-like domains, beta)
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
Rph
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
rbf-1
Alliance
DIOPT (Hieranoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 61,126,295 - 61,151,533 (-) NCBI GRCr8 mRatBN7.2 10 60,628,029 - 60,653,267 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 60,628,029 - 60,653,267 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 65,274,693 - 65,300,895 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 64,780,111 - 64,806,313 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 60,242,686 - 60,268,888 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 63,921,255 - 63,952,944 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 63,928,064 - 63,952,726 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 64,053,913 - 64,078,844 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 63,115,782 - 63,140,805 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 63,129,404 - 63,154,428 (-) NCBI Celera 10 59,653,415 - 59,678,192 (-) NCBI Celera Cytogenetic Map 10 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Doc2b Rat 2,2',5,5'-tetrachlorobiphenyl affects expression EXP 6480464 2,5,2',5'-tetrachlorobiphenyl affects the expression of DOC2B mRNA CTD PMID:23829299 Doc2b Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:732162 6480464 Tetrachlorodibenzodioxin results in decreased expression of DOC2B mRNA CTD PMID:21296121 Doc2b Rat 4,4'-sulfonyldiphenol increases methylation ISO RGD:732163 6480464 bisphenol S results in increased methylation of DOC2B exon CTD PMID:33297965 Doc2b Rat 4,4'-sulfonyldiphenol affects methylation ISO RGD:732163 6480464 bisphenol S affects the methylation of DOC2B gene CTD PMID:31683443 Doc2b Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of DOC2B mRNA CTD PMID:24780913 Doc2b Rat actinomycin D multiple interactions ISO RGD:732162 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of DOC2B mRNA CTD PMID:38460933 Doc2b Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of DOC2B mRNA CTD PMID:30047161 Doc2b Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of DOC2B mRNA CTD PMID:16483693 Doc2b Rat anthra[1,9-cd]pyrazol-6(2H)-one multiple interactions ISO RGD:732163 6480464 pyrazolanthrone inhibits the reaction [Ozone results in increased expression of DOC2B mRNA] CTD PMID:17460151 Doc2b Rat benzo[a]pyrene increases methylation ISO RGD:732162 6480464 Benzo(a)pyrene results in increased methylation of DOC2B promoter CTD PMID:27901495 Doc2b Rat benzo[a]pyrene affects methylation ISO RGD:732162 6480464 Benzo(a)pyrene affects the methylation of DOC2B intron CTD PMID:30157460 Doc2b Rat benzo[e]pyrene increases methylation ISO RGD:732162 6480464 benzo(e)pyrene results in increased methylation of DOC2B intron CTD PMID:30157460 Doc2b Rat beta-lapachone increases expression ISO RGD:732162 6480464 beta-lapachone results in increased expression of DOC2B mRNA CTD PMID:38218311 Doc2b Rat bis(2-ethylhexyl) phthalate decreases expression ISO RGD:732162 6480464 Diethylhexyl Phthalate results in decreased expression of DOC2B mRNA CTD PMID:31163220 Doc2b Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of DOC2B mRNA CTD PMID:25181051 Doc2b Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of DOC2B mRNA CTD PMID:30816183|PMID:32528016|PMID:34947998 Doc2b Rat buta-1,3-diene increases expression ISO RGD:732163 6480464 1,3-butadiene results in increased expression of DOC2B mRNA CTD PMID:29038090 Doc2b Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of DOC2B mRNA CTD PMID:19167457 Doc2b Rat carbon nanotube increases expression ISO RGD:732163 6480464 Nanotubes, Carbon analog results in increased expression of DOC2B mRNA; Nanotubes, Carbon results in increased more ... CTD PMID:25554681 Doc2b Rat chloroprene increases expression ISO RGD:732163 6480464 Chloroprene results in increased expression of DOC2B mRNA CTD PMID:23125180 Doc2b Rat choline multiple interactions ISO RGD:732163 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation more ... CTD PMID:20938992 Doc2b Rat clotrimazole increases expression EXP 6480464 Clotrimazole results in increased expression of DOC2B mRNA CTD PMID:30047161 Doc2b Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of DOC2B mRNA CTD PMID:26577399 Doc2b Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of DOC2B mRNA CTD PMID:27523638 Doc2b Rat dibutyl phthalate decreases expression ISO RGD:732163 6480464 Dibutyl Phthalate results in decreased expression of DOC2B mRNA CTD PMID:17361019|PMID:21266533 Doc2b Rat dioxygen increases expression ISO RGD:732162 6480464 Oxygen deficiency results in increased expression of DOC2B mRNA CTD PMID:26516004 Doc2b Rat folic acid multiple interactions ISO RGD:732163 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation more ... CTD PMID:20938992 Doc2b Rat genistein increases expression ISO RGD:732163 6480464 Genistein results in increased expression of DOC2B mRNA CTD PMID:32186404 Doc2b Rat L-methionine multiple interactions ISO RGD:732163 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation more ... CTD PMID:20938992 Doc2b Rat lead(0) affects expression ISO RGD:732162 6480464 Lead affects the expression of DOC2B mRNA CTD PMID:28903495 Doc2b Rat leflunomide decreases expression ISO RGD:732163 6480464 leflunomide results in decreased expression of DOC2B mRNA CTD PMID:19751817 Doc2b Rat lipopolysaccharide increases expression ISO RGD:732162 6480464 Lipopolysaccharides results in increased expression of DOC2B mRNA CTD PMID:35811015 Doc2b Rat lipopolysaccharide multiple interactions ISO RGD:732162 6480464 S-(1,2-dichlorovinyl)cysteine inhibits the reaction [Lipopolysaccharides results in increased expression of DOC2B mRNA] CTD PMID:35811015 Doc2b Rat malathion decreases expression ISO RGD:732162 6480464 Malathion results in decreased expression of DOC2B mRNA CTD PMID:37047231 Doc2b Rat methapyrilene increases methylation ISO RGD:732162 6480464 Methapyrilene results in increased methylation of DOC2B intron CTD PMID:30157460 Doc2b Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of DOC2B mRNA CTD PMID:30047161 Doc2b Rat N-methyl-4-phenylpyridinium increases expression ISO RGD:732162 6480464 1-Methyl-4-phenylpyridinium results in increased expression of DOC2B mRNA CTD PMID:24810058 Doc2b Rat Nutlin-3 multiple interactions ISO RGD:732162 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of DOC2B mRNA CTD PMID:38460933 Doc2b Rat ozone increases expression ISO RGD:732163 6480464 Ozone results in increased expression of DOC2B mRNA CTD PMID:17460151 Doc2b Rat ozone multiple interactions ISO RGD:732163 6480464 [Air Pollutants results in increased abundance of Ozone] which results in increased expression of DOC2B more ... CTD PMID:17460151|PMID:34911549 Doc2b Rat PCB138 decreases expression EXP 6480464 2,2',3',4,4',5-hexachlorobiphenyl results in decreased expression of DOC2B mRNA CTD PMID:23829299 Doc2b Rat pinostrobin increases phosphorylation ISO RGD:732162 6480464 pinostrobin results in increased phosphorylation of DOC2B protein CTD PMID:37164308 Doc2b Rat pirinixic acid decreases expression ISO RGD:732163 6480464 pirinixic acid results in decreased expression of DOC2B mRNA CTD PMID:20813756 Doc2b Rat progesterone increases expression ISO RGD:732163 6480464 Progesterone results in increased expression of DOC2B mRNA CTD PMID:22238285 Doc2b Rat rotenone increases expression ISO RGD:732162 6480464 Rotenone results in increased expression of DOC2B mRNA CTD PMID:29955902 Doc2b Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO RGD:732162 6480464 S-(1,2-dichlorovinyl)cysteine inhibits the reaction [Lipopolysaccharides results in increased expression of DOC2B mRNA] CTD PMID:35811015 Doc2b Rat sotorasib multiple interactions ISO RGD:732162 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in decreased expression of DOC2B mRNA CTD PMID:36139627 Doc2b Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of DOC2B mRNA CTD PMID:30047161 Doc2b Rat testosterone multiple interactions ISO RGD:732163 6480464 1,2-dibromo-4-(1,2-dibromoethyl)cyclohexane inhibits the reaction [Testosterone deficiency results in decreased expression of DOC2B mRNA] CTD PMID:33848595 Doc2b Rat testosterone decreases expression ISO RGD:732163 6480464 Testosterone deficiency results in decreased expression of DOC2B mRNA CTD PMID:33848595 Doc2b Rat titanium dioxide increases methylation ISO RGD:732163 6480464 titanium dioxide results in increased methylation of DOC2B gene CTD PMID:35295148 Doc2b Rat titanium dioxide decreases methylation ISO RGD:732163 6480464 titanium dioxide results in decreased methylation of DOC2B gene CTD PMID:35295148 Doc2b Rat trametinib multiple interactions ISO RGD:732162 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in decreased expression of DOC2B mRNA CTD PMID:36139627 Doc2b Rat triclosan increases expression ISO RGD:732162 6480464 Triclosan results in increased expression of DOC2B mRNA CTD PMID:30510588 Doc2b Rat valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of DOC2B mRNA CTD PMID:29427782 Doc2b Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of DOC2B mRNA CTD PMID:22615374
2,2',5,5'-tetrachlorobiphenyl (EXP) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) actinomycin D (ISO) amitrole (EXP) ammonium chloride (EXP) anthra[1,9-cd]pyrazol-6(2H)-one (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP) buta-1,3-diene (ISO) C60 fullerene (EXP) carbon nanotube (ISO) chloroprene (ISO) choline (ISO) clotrimazole (EXP) Cuprizon (EXP) dibutyl phthalate (ISO) dioxygen (ISO) folic acid (ISO) genistein (ISO) L-methionine (ISO) lead(0) (ISO) leflunomide (ISO) lipopolysaccharide (ISO) malathion (ISO) methapyrilene (ISO) methimazole (EXP) N-methyl-4-phenylpyridinium (ISO) Nutlin-3 (ISO) ozone (ISO) PCB138 (EXP) pinostrobin (ISO) pirinixic acid (ISO) progesterone (ISO) rotenone (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) sotorasib (ISO) sulfadimethoxine (EXP) testosterone (ISO) titanium dioxide (ISO) trametinib (ISO) triclosan (ISO) valproic acid (EXP) vinclozolin (EXP)
Biological Process
calcium ion-regulated exocytosis of neurotransmitter (IDA,IEA,ISO) calcium-dependent activation of synaptic vesicle fusion (IBA,IDA,IEA,IMP,ISO) exocytosis (IEP) neurotransmitter secretion (IEA) positive regulation of calcium ion-dependent exocytosis (IBA,IDA) positive regulation of insulin secretion (IEA,ISO,ISS) positive regulation of vesicle fusion (IDA) protein localization (IEA,ISO,ISS) spontaneous neurotransmitter secretion (IEA,ISO)
1.
DOC2B acts as a calcium switch and enhances vesicle fusion.
Friedrich R, etal., J Neurosci. 2008 Jul 2;28(27):6794-806. doi: 10.1523/JNEUROSCI.0538-08.2008.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
4.
Doc2b is a high-affinity Ca2+ sensor for spontaneous neurotransmitter release.
Groffen AJ, etal., Science. 2010 Mar 26;327(5973):1614-8. doi: 10.1126/science.1183765. Epub 2010 Feb 11.
5.
Calcium-dependent phospholipid binding to the C2A domain of a ubiquitous form of double C2 protein (Doc2 beta).
Kojima T, etal., J Biochem (Tokyo) 1996 Sep;120(3):671-6.
6.
Different spatiotemporal expression of DOC2 genes in the developing rat brain argues for an additional, nonsynaptic role of DOC2B in early development.
Korteweg N, etal., Eur J Neurosci 2000 Jan;12(1):165-71.
7.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
8.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.
GOA pipeline
RGD automated data pipeline
10.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
11.
DOC2 proteins in rat brain: complementary distribution and proposed function as vesicular adapter proteins in early stages of secretion.
Verhage M, etal., Neuron 1997 Mar;18(3):453-61.
12.
Doc2 is a Ca2+ sensor required for asynchronous neurotransmitter release.
Yao J, etal., Cell. 2011 Oct 28;147(3):666-77. doi: 10.1016/j.cell.2011.09.046.
Doc2b Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 61,126,295 - 61,151,533 (-) NCBI GRCr8 mRatBN7.2 10 60,628,029 - 60,653,267 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 60,628,029 - 60,653,267 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 65,274,693 - 65,300,895 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 64,780,111 - 64,806,313 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 60,242,686 - 60,268,888 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 63,921,255 - 63,952,944 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 63,928,064 - 63,952,726 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 64,053,913 - 64,078,844 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 63,115,782 - 63,140,805 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 63,129,404 - 63,154,428 (-) NCBI Celera 10 59,653,415 - 59,678,192 (-) NCBI Celera Cytogenetic Map 10 q24 NCBI
DOC2B Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 142,789 - 181,650 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 142,789 - 181,650 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 67 - 31,441 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 5,810 - 31,270 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 17 96,907 - 129,072 (-) NCBI Celera Cytogenetic Map 17 p13.3 NCBI HuRef 17 15,749 - 39,198 (-) NCBI HuRef CHM1_1 17 16,004 - 40,168 (-) NCBI CHM1_1 T2T-CHM13v2.0 17 48,059 - 84,879 (-) NCBI T2T-CHM13v2.0
Doc2b Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 75,659,096 - 75,686,886 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 75,659,792 - 75,686,875 (-) Ensembl GRCm39 Ensembl GRCm38 11 75,768,270 - 75,796,060 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 75,768,966 - 75,796,049 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 75,582,592 - 75,609,559 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 75,585,285 - 75,612,252 (-) NCBI MGSCv36 mm8 Celera 11 83,278,304 - 83,305,458 (-) NCBI Celera Cytogenetic Map 11 B5 NCBI cM Map 11 45.92 NCBI
Doc2b Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955481 1,842,815 - 1,860,374 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955481 1,839,894 - 1,859,733 (-) NCBI ChiLan1.0 ChiLan1.0
DOC2B Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 7,677,806 - 7,716,293 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 9,235,284 - 9,272,796 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 19,854 - 58,336 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 80,050 - 123,659 (-) NCBI panpan1.1 PanPan1.1 panPan2
DOC2B Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 9 45,450,270 - 45,488,638 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 9 45,450,302 - 45,485,247 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 9 44,600,738 - 44,639,091 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 9 46,269,076 - 46,307,688 (+) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 9 45,047,177 - 45,085,473 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 9 45,340,905 - 45,379,302 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 9 45,419,613 - 45,457,959 (+) NCBI UU_Cfam_GSD_1.0
Doc2b Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 44,582,572 - 44,608,703 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936538 7,469,408 - 7,483,516 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936538 7,461,030 - 7,486,648 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
DOC2B
DOC2B
Doc2b
.
Predicted Target Of
Count of predictions: 52 Count of miRNA genes: 50 Interacting mature miRNAs: 51 Transcripts: ENSRNOT00000008429 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
61441 Btemp1 Thermal response to stress QTL 1 4 body temperature trait (VT:0005535) core body temperature (CMO:0001036) 10 35392457 63642539 Rat 1549846 Scl47 Serum cholesterol level QTL 47 3.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 50574707 95574707 Rat 152025229 Scl83 Serum cholesterol level QTL 83 4.33 blood cholesterol amount (VT:0000180) 10 35710580 68663659 Rat 1578779 Tcas10 Tongue tumor susceptibility QTL 10 3.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 10 31297439 76297439 Rat 152025227 Bw195 Body weight QTL 195 5.73 body mass (VT:0001259) 10 46989699 68663659 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 2293669 Bmd33 Bone mineral density QTL 33 4.5 0.0001 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 10 49444551 81709989 Rat 152025224 Bw193 Body weight QTL 193 6.47 body mass (VT:0001259) 10 51663405 75085664 Rat 631552 Vetf2 Vascular elastic tissue fragility QTL 2 4.5 0.0002 aorta elastic tissue integrity trait (VT:0010556) artery internal elastic lamina non-tumorous lesion count (CMO:0001913) 10 41142633 86142633 Rat 631554 Bp133 Blood pressure QTL 133 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 743364 63851208 Rat 631557 Bp136 Blood pressure QTL 136 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 30632053 75632053 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1298078 Stresp5 Stress response QTL 5 2.99 0.00025 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 42045676 104670812 Rat 2293679 Bmd30 Bone mineral density QTL 30 3.5 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 1549831 Bss6 Bone structure and strength QTL 6 4 lumbar vertebra strength trait (VT:0010574) vertebra ultimate force (CMO:0001678) 10 57576521 102576521 Rat 2298544 Neuinf9 Neuroinflammation QTL 9 4.6 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 10 5801990 62146030 Rat 70164 Bw21 Body weight QTL 21 4.36 0.00005 body mass (VT:0001259) body weight (CMO:0000012) 10 53797494 98952626 Rat 61463 Bp12 Blood pressure QTL 12 6.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 41333258 86333258 Rat 8694173 Bw149 Body weight QTL 149 4.38 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 10 44441699 89441699 Rat 2300218 Hpcl2 Hepatic cholesterol level QTL 2 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 45029650 95600334 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 70171 Cari1 Carrageenan-induced inflammation QTL 1 4.9 0.0005 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 10 53797385 107211142 Rat 1598852 Anxrr19 Anxiety related response QTL 19 5.07 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 10 18167841 63167841 Rat 1581497 Esta1 Estrogen-induced thymic atrophy QTL 1 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 21329805 61345413 Rat 724527 Bp148 Blood pressure QTL 148 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 28453136 73453136 Rat 1358897 Stresp6 Stress response QTL 6 4.17 0.022 blood norepinephrine amount (VT:0005663) plasma norepinephrine level (CMO:0001010) 10 35392267 64155584 Rat 1331762 Rf40 Renal function QTL 40 3.873 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 10 29299504 64155584 Rat 2300171 Bmd58 Bone mineral density QTL 58 4.9 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 26944628 71944628 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2301967 Cm73 Cardiac mass QTL 73 4.55 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 10 14487011 89062041 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 70188 BpQTLcluster1 Blood pressure QTL cluster 1 4.864 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 42323132 87323132 Rat 9589030 Epfw9 Epididymal fat weight QTL 9 19.24 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 10 44441699 89441699 Rat 10402859 Bp381 Blood pressure QTL 381 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 2293652 Bmd22 Bone mineral density QTL 22 4.9 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 70198 BpQTLcluster9 Blood pressure QTL cluster 9 2.94 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 42323132 87323132 Rat 1359017 Hrtrt21 Heart rate QTL 21 2.4 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 10 51772940 96772940 Rat 2306787 Ean3 Experimental allergic neuritis QTL 3 3.1 nervous system integrity trait (VT:0010566) body weight loss (CMO:0001399) 10 53797385 66979128 Rat 6893352 Bw100 Body weight QTL 100 0.33 0.6 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 2312672 Insul15 Insulin level QTL 15 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 10 57134272 102134272 Rat 724556 Pur2 Proteinuria QTL 2 5.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 22427500 90627625 Rat 8662860 Vetf10 Vascular elastic tissue fragility QTL 10 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 10 6154182 73453136 Rat 61387 Bp1 Blood pressure QTL 1 5.1 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 51770177 107211142 Rat 70223 Bp57 Blood pressure QTL 57 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 1 80676123 Rat 6893350 Bw99 Body weight QTL 99 0.87 0.16 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 2317043 Aia7 Adjuvant induced arthritis QTL 7 3.82 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 37565079 82565079 Rat 70224 Eae3 Experimental allergic encephalomyelitis QTL 3 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 10 26521957 61345413 Rat 2317042 Aia20 Adjuvant induced arthritis QTL 20 3.38 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 37565079 82565079 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 2313087 Bmd80 Bone mineral density QTL 80 3.2 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 10 19606483 64606483 Rat 2298495 Eae23 Experimental allergic encephalomyelitis QTL 23 16.93 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis duration (CMO:0001424) 10 55273696 60677262 Rat 70364 Bp72 Blood pressure QTL 72 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 51121100 96121100 Rat 2293698 Bss43 Bone structure and strength QTL 43 5.33 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 10 59209888 104209888 Rat 631530 Tls3 T-lymphoma susceptibility QTL 3 0 0.0001 thymus integrity trait (VT:0010555) percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911) 10 51774612 95600334 Rat 1354608 Cm33 Cardiac mass QTL 33 2.8 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 10 54809292 99809292 Rat 631535 Cm51 Cardiac mass QTL 51 3 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 10 51786282 91669536 Rat 1576319 Cia29 Collagen induced arthritis QTL 29 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 33973921 78973921 Rat 8552805 Bw145 Body weight QTL 145 2.2 body mass (VT:0001259) change in body weight to body weight ratio (CMO:0002216) 10 41944526 78307017 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2293705 Bmd25 Bone mineral density QTL 25 7.1 0.0001 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 10 49444551 81709989 Rat 1576308 Schws1 Schwannoma susceptibility QTL 1 0.0041 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 40035094 102359817 Rat 631269 Cia22 Collagen induced arthritis QTL 22 8.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 7207811 Bmd90 Bone mineral density QTL 90 5.2 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 10 49444551 81709989 Rat 1576311 Pia26 Pristane induced arthritis QTL 26 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 31224026 75632053 Rat 631270 Cia23 Collagen induced arthritis QTL 23 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 7411614 Foco18 Food consumption QTL 18 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 44441699 89441699 Rat 631547 Bp87 Blood pressure QTL 87 4.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 47369470 92369470 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 2312662 Slep8 Serum leptin concentration QTL 8 0.05 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 10 57134272 102134272 Rat 6893342 Cm78 Cardiac mass QTL 78 0.1 0.88 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 42876766 79813922 Rat 2292441 Bp308 Blood pressure QTL 308 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2313055 Bw96 Body weight QTL 96 3.6 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 10 19606483 64606483 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat 2312668 Scl65 Serum cholesterol level QTL 65 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 57134272 102134272 Rat
BG375498
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 60,651,205 - 60,651,334 (+) MAPPER mRatBN7.2 Rnor_6.0 10 63,950,826 - 63,950,954 NCBI Rnor6.0 Rnor_5.0 10 64,055,749 - 64,055,877 UniSTS Rnor5.0 RGSC_v3.4 10 63,138,730 - 63,138,858 UniSTS RGSC3.4 Celera 10 59,676,182 - 59,676,310 UniSTS Cytogenetic Map 10 q24 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
47
113
89
88
57
25
57
6
214
95
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000090461 ⟹ ENSRNOP00000074543
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 60,628,029 - 60,653,267 (-) Ensembl Rnor_6.0 Ensembl 10 63,928,064 - 63,952,726 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000108492 ⟹ ENSRNOP00000077032
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 60,628,029 - 60,653,267 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000118069 ⟹ ENSRNOP00000079044
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 60,628,029 - 60,653,267 (-) Ensembl
RefSeq Acc Id:
NM_031142 ⟹ NP_112404
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 61,126,295 - 61,151,533 (-) NCBI mRatBN7.2 10 60,628,029 - 60,653,267 (-) NCBI Rnor_6.0 10 63,927,658 - 63,952,881 (-) NCBI Rnor_5.0 10 64,053,913 - 64,078,844 (+) NCBI RGSC_v3.4 10 63,115,782 - 63,140,805 (-) RGD Celera 10 59,653,415 - 59,678,192 (-) RGD
Sequence:
GCCGCCGCCGAGCAGGCAGCAGCCGCGTCAGGGCCGTCCGGGGGCCACACCGGCGATGCCCGCAGCCCCCGCAGCGCCCCGCGGGACCCGCTGACTTACCCCCGGGCCGGGGTCATACCGGGCCGGGC
hide sequence
RefSeq Acc Id:
NP_112404 ⟸ NM_031142
- UniProtKB:
P70610 (UniProtKB/Swiss-Prot), A0A8I5XVQ2 (UniProtKB/TrEMBL)
- Sequence:
MTLRRRGEKATISIQEHMAIDVCPGPIRPIKQISDYFPRFPRGLPPTAAPRASAPPDAPARSPAATAGPRSPSDGARDDDEDVDQLFGAYGASPGPSPGPSPVRPPAKPPEDEPDADGYESDDCTALG
hide sequence
Ensembl Acc Id:
ENSRNOP00000074543 ⟸ ENSRNOT00000090461
Ensembl Acc Id:
ENSRNOP00000079044 ⟸ ENSRNOT00000118069
Ensembl Acc Id:
ENSRNOP00000077032 ⟸ ENSRNOT00000108492
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-03-29
Doc2b
double C2 domain beta
Doc2b
double C2-like domains, beta
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-10-17
Doc2b
double C2-like domains, beta
Doc2b
double C2, beta
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-20
Doc2b
double C2, beta
Doc2b
Symbol and Name status set to approved
1299863 APPROVED
2002-08-07
Doc2b
Doc2b
Symbol and Name status set to provisional
70820 PROVISIONAL
