Advanced Search (OLGA)

Gene: Htr6 (5-hydroxytryptamine receptor 6) Rattus norvegicus

Analyze

Symbol:

Htr6

Name:

5-hydroxytryptamine receptor 6

RGD ID:

62044

Description:

Enables G protein-coupled serotonin receptor activity. Involved in several processes, including G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger; long-term synaptic potentiation; and regulation of amine transport. Located in dendrite. Human ortholog(s) of this gene implicated in Alzheimer's disease. Orthologous to human HTR6 (5-hydroxytryptamine receptor 6); PARTICIPATES IN serotonin signaling pathway via receptors engaging G alphas protein family; calcium/calcium-mediated signaling pathway; INTERACTS WITH 6-propyl-2-thiouracil; acrylamide; ammonium chloride.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

5-HT-6; 5-HT6; 5-hydroxytryptamine (serotonin) receptor 6; 5-hydroxytryptamine (serotonin) receptor 6, G protein-coupled; serotonin receptor 6; ST-B17

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	156,579,901 - 156,595,147 (-)	NCBI		GRCr8
mRatBN7.2	5	151,295,269 - 151,312,853 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	151,296,662 - 151,311,912 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	153,994,008 - 154,009,139 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	155,768,318 - 155,783,449 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	155,750,238 - 155,765,452 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	157,501,202 - 157,518,870 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	157,503,040 - 157,518,631 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	161,242,331 - 161,257,707 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	5	149,681,578 - 149,696,742 (-)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

3-hydroxy-3-methylglutaryl-CoA lyase deficiency (ISO)

Alzheimer's disease (ISO)

amphetamine abuse (ISO)

chromosome 1p36 deletion syndrome (ISO)

congenital disorder of glycosylation Ir (ISO)

hyperprolinemia type 2 (ISO)

Memory Disorders (ISO)

Parkinson's disease 6 (ISO)

schizophrenia (ISO)

substance-induced psychosis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

3',5'-cyclic AMP (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (EXP)

Aflatoxin B2 alpha (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

apomorphine (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

chlorpyrifos (EXP)

clozapine (ISO)

cocaine (EXP)

copper atom (EXP)

copper(0) (EXP)

Cuprizon (ISO)

decabromodiphenyl ether (EXP)

diazinon (EXP)

dichlorine (EXP)

dieldrin (EXP)

ethyl methanesulfonate (ISO)

ethylparaben (ISO)

fenvalerate (EXP)

formaldehyde (ISO)

lead(0) (ISO)

lysergic acid diethylamide (ISO)

methamphetamine (ISO)

methyl methanesulfonate (ISO)

mono(2-ethylhexyl) phthalate (ISO)

monosodium L-glutamate (ISO)

N-nitrosodiethylamine (ISO)

Nonylphenol (EXP)

olanzapine (ISO)

ozone (EXP)

paracetamol (ISO)

picrotoxin (EXP)

piperonyl butoxide (ISO)

pirinixic acid (ISO)

potassium dichromate (ISO)

resveratrol (ISO)

risperidone (ISO)

scopolamine (EXP)

serotonin (ISO)

sodium arsenite (ISO)

tetrachloromethane (EXP)

titanium dioxide (ISO)

trichloroethene (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adenylate cyclase-activating serotonin receptor signaling pathway (ISO,ISS)

adenylate cyclase-modulating G protein-coupled receptor signaling pathway (IBA)

cerebral cortex cell migration (ISO,ISS)

chemical synaptic transmission (IBA)

G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger (IBA,IMP)

G protein-coupled serotonin receptor signaling pathway (IEA)

learning (IDA)

long-term synaptic potentiation (IMP)

negative regulation of acetylcholine secretion, neurotransmission (IMP)

negative regulation of gamma-aminobutyric acid secretion (IMP)

negative regulation of glutamate secretion (IMP)

positive regulation of dopamine secretion (IMP)

positive regulation of gamma-aminobutyric acid secretion (IMP)

positive regulation of TOR signaling (ISO,ISS)

response to estradiol (IEP)

response to xenobiotic stimulus (IEP)

Cellular Component

cilium (ISO)

dendrite (IBA,IDA)

plasma membrane (IBA,IEA,ISO,ISS)

synapse (IEA)

Molecular Function

G protein-coupled serotonin receptor activity (IBA,IDA,IEA,ISO)

neurotransmitter receptor activity (IBA)

protein binding (IPI,ISO)

serotonin receptor activity (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

calcium/calcium-mediated signaling pathway (IEA)

serotonin signaling pathway via receptors engaging G alphas protein family (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Localization of 5-HT(6) receptors at the plasma membrane of neuronal cilia in the rat brain.	Brailov I, etal., Brain Res. 2000 Jul 28;872(1-2):271-5.
2.	Effects of clozapine and haloperidol on 5-HT6 receptor mRNA levels in rat brain.	Frederick JA and Meador-Woodruff JH, Schizophr Res. 1999 Jul 27;38(1):7-12.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	Characterization of 5-ht6 receptor and expression of 5-ht6 mRNA in the rat brain during ontogenetic development.	Grimaldi B, etal., Naunyn Schmiedebergs Arch Pharmacol. 1998 Apr;357(4):393-400.
6.	Antibodies and antisense oligonucleotide for probing the distribution and putative functions of central 5-HT6 receptors.	Hamon M, etal., Neuropsychopharmacology. 1999 Aug;21(2 Suppl):68S-76S.
7.	Direct interaction and functional coupling between human 5-HT6 receptor and the light chain 1 subunit of the microtubule-associated protein 1B (MAP1B-LC1).	Kim SH, etal., PLoS One. 2014 Mar 10;9(3):e91402. doi: 10.1371/journal.pone.0091402. eCollection 2014.
8.	Cloning, characterization, and chromosomal localization of a human 5-HT6 serotonin receptor.	Kohen R, etal., J Neurochem 1996 Jan;66(1):47-56.
9.	Lack of localization of 5-HT6 receptors on cholinergic neurons: implication of multiple neurotransmitter systems in 5-HT6 receptor-mediated acetylcholine release.	Marcos B, etal., Eur J Neurosci. 2006 Sep;24(5):1299-306.
10.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
11.	Increased expression of 5-HT6 receptors in the rat dorsomedial striatum impairs instrumental learning.	Mitchell ES, etal., Neuropsychopharmacology. 2007 Jul;32(7):1520-30. Epub 2006 Dec 27.
12.	Cloning and expression of a novel serotonin receptor with high affinity for tricyclic psychotropic drugs.	Monsma FJ Jr, etal., Mol Pharmacol 1993 Mar;43(3):320-7.
13.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
14.	Estradiol induces expression of 5-hydroxytryptamine (5-HT) 4, 5-HT5, and 5-HT6 receptor messenger ribonucleic acid in rat anterior pituitary cell aggregates and allows prolactin release via the 5-HT4 receptor.	Papageorgiou A and Denef C, Endocrinology. 2007 Mar;148(3):1384-95. Epub 2006 Nov 22.
15.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
16.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
17.	GOA pipeline	RGD automated data pipeline
18.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
19.	A novel rat serotonin (5-HT6) receptor: molecular cloning, localization and stimulation of cAMP accumulation.	Ruat M, etal., Biochem Biophys Res Commun 1993 May 28;193(1):268-76.
20.	Association analysis of the 5-HT6 receptor polymorphism C267T in Alzheimer's disease.	Tsai SJ, etal., Neurosci Lett 1999 Dec 3;276(2):138-9.
21.	Activation of the 5-HT(6) receptor attenuates long-term potentiation and facilitates GABAergic neurotransmission in rat hippocampus.	West PJ, etal., Neuroscience. 2009 Dec 1;164(2):692-701. Epub 2009 Aug 4.

Additional References at PubMed

PMID:9225298	PMID:17543469	PMID:17998104	PMID:19549510	PMID:19902184	PMID:20093369	PMID:20514872	PMID:21619890	PMID:21714816	PMID:22179047	PMID:22982249	PMID:23027611
PMID:24880860	PMID:25078650	PMID:25837696	PMID:25863121	PMID:25934037	PMID:26424380	PMID:26979176	PMID:27032690	PMID:27106213	PMID:28681593	PMID:31412259	PMID:38408524

Genomics

Comparative Map Data

Htr6
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	156,579,901 - 156,595,147 (-)	NCBI		GRCr8
mRatBN7.2	5	151,295,269 - 151,312,853 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	151,296,662 - 151,311,912 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	153,994,008 - 154,009,139 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	155,768,318 - 155,783,449 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	155,750,238 - 155,765,452 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	157,501,202 - 157,518,870 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	157,503,040 - 157,518,631 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	161,242,331 - 161,257,707 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	5	149,681,578 - 149,696,742 (-)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

HTR6
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	19,664,875 - 19,680,966 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	19,664,875 - 19,680,966 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	19,991,368 - 20,007,459 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	19,864,367 - 19,878,642 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	19,737,085 - 19,751,361	NCBI
Celera	1	18,318,551 - 18,332,825 (+)	NCBI		Celera
Cytogenetic Map	1	p36.13	NCBI
HuRef	1	18,237,853 - 18,251,587 (+)	NCBI		HuRef
CHM1_1	1	20,101,041 - 20,115,313 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	19,488,252 - 19,504,342 (+)	NCBI		T2T-CHM13v2.0

Htr6
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	138,787,017 - 138,802,881 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	138,788,419 - 138,802,881 (-)	Ensembl		GRCm39 Ensembl
GRCm38	4	139,059,706 - 139,075,570 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	139,061,108 - 139,075,570 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	138,617,324 - 138,630,704 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	138,333,485 - 138,346,865 (-)	NCBI		MGSCv36	mm8
Celera	4	140,846,418 - 140,859,919 (-)	NCBI		Celera
Cytogenetic Map	4	D3	NCBI
cM Map	4	70.57	NCBI

Htr6
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955452	323,641 - 338,312 (+)	NCBI	ChiLan1.0	ChiLan1.0

HTR6
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	207,437,095 - 207,459,590 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	206,556,661 - 206,576,460 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	18,619,683 - 18,635,822 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	19,662,978 - 19,678,680 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	19,662,978 - 19,678,680 (+)	Ensembl	panpan1.1		panPan2

HTR6
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	79,022,790 - 79,033,975 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	79,022,775 - 79,033,975 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	75,536,323 - 75,547,597 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	79,589,890 - 79,601,165 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	79,589,903 - 79,601,165 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	76,407,980 - 76,419,252 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	77,415,288 - 77,426,563 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	78,486,607 - 78,497,882 (-)	NCBI		UU_Cfam_GSD_1.0

Htr6
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	40,023,901 - 40,033,703 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936474	5,848,707 - 5,859,749 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936474	5,848,719 - 5,858,520 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

HTR6
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	6	78,077,358 - 78,092,211 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	72,147,759 - 72,164,426 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

HTR6
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	112,873,132 - 112,887,533 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	112,874,734 - 112,887,066 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666033	3,273,572 - 3,288,466 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Htr6
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624764	4,778,657 - 4,791,458 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624764	4,778,563 - 4,791,505 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Htr6
100 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	51
Count of miRNA genes:	47
Interacting mature miRNAs:	51
Transcripts:	ENSRNOT00000070865
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
10053720	Scort26	Serum corticosterone level QTL 26	2.06	0.0147	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	124965598	166875058	Rat
2302369	Scl60	Serum cholesterol level QTL 60	3.13		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	143608201	161165651	Rat
8552960	Pigfal15	Plasma insulin-like growth factor 1 level QTL 15			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	111416838	156416838	Rat
631562	Apr2	Acute phase response QTL 2	3.7		blood murinoglobulin 1 amount (VT:0010597)	plasma murinoglobulin 1 level (CMO:0001931)	5	135927956	166875058	Rat
61444	Strs2	Sensitivity to stroke QTL 2	4.7		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	5	135929696	166875058	Rat
1300119	Bp180	Blood pressure QTL 180	3.82		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	5	144358090	157869054	Rat
8552908	Pigfal4	Plasma insulin-like growth factor 1 level QTL 4	6.6		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	128506074	166875058	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	60293434	161481680	Rat
7794791	Mcs33	Mammary carcinoma susceptibility QTL 33	1.93		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	5	131345754	166875058	Rat
1354631	Swd2	Spike wave discharge measurement QTL 2	3.64	0.0002	brain electrophysiology trait (VT:0010557)	brain total spike-and-wave discharge duration (CMO:0001740)	5	151113452	164465185	Rat
7207486	Bss109	Bone structure and strength QTL 109			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	5	106906205	151906205	Rat
7207481	Bss106	Bone structure and strength QTL 106	7.9		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	106906205	151906205	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	82394392	166664054	Rat
1598861	Cm64	Cardiac mass QTL 64	2.9		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	127798274	166875058	Rat
631263	Cm24	Cardiac mass QTL 24	3.5		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	5	143799107	158428037	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
631505	Bp103	Blood pressure QTL 103	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	132717196	165560427	Rat
1641920	Colcs1	Colorectal carcinoma susceptibility QTL 1	2.99	0.0055	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	5	121846814	166846814	Rat
1549838	Bss4	Bone structure and strength QTL 4	9.2		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	5	106906205	151906205	Rat
1331721	Bp210	Blood pressure QTL 210	3.413		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	5	143069996	166846814	Rat
8694169	Bw148	Body weight QTL 148	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	128506074	166875058	Rat
8657050	Bw146	Body weight QTL 146	19.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	108938288	153938288	Rat
631272	Lanf1	Left ventricular atrial natriuretic factor QTL 1	12		heart left ventricle natriuretic peptide A amount (VT:0010596)	heart left ventricle natriuretic peptide A level (CMO:0002165)	5	151113452	166875058	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
634349	Bp139	Blood pressure QTL 139		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	128924607	166875058	Rat
724525	Bp147	Blood pressure QTL 147	4.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	126424772	166875058	Rat
1598847	Cm62	Cardiac mass QTL 62	3.4		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	108845856	153845856	Rat
738018	Anxrr4	Anxiety related response QTL 4	5.1		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	5	130130159	166875058	Rat
2313096	Bmd78	Bone mineral density QTL 78	3.1	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	5	144377876	161317411	Rat
8694441	Bw169	Body weight QTL 169	17.61	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	5	111416838	156416838	Rat
7207488	Bss110	Bone structure and strength QTL 1	8.4		femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	5	106906205	151906205	Rat
7207491	Bss112	Bone structure and strength QTL 112	7		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	5	106906205	151906205	Rat
8694389	Bw160	Body weight QTL 160	6.17	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	5	111416838	156416838	Rat
8694198	Abfw3	Abdominal fat weight QTL 3	16.13	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	5	111416838	156416838	Rat
1298090	Bp155	Blood pressure QTL 155	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	151006154	161165494	Rat
1298089	Scl14	Serum cholesterol level QTL 14	5.8	0.0004	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	108845856	153845856	Rat
1598819	Bp292	Blood pressure QTL 292	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	127798274	166875058	Rat

Markers in Region

D5Got136

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	151,308,239 - 151,308,356 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	157,514,839 - 157,514,955	NCBI	Rnor6.0
Rnor_5.0	5	161,254,035 - 161,254,151	UniSTS	Rnor5.0
Celera	5	149,693,070 - 149,693,186	UniSTS
RH 3.4 Map	5	1033.01	RGD
RH 3.4 Map	5	1033.01	UniSTS
RH 2.0 Map	5	1005.8	RGD

D5Got92

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	151,308,242 - 151,308,369 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	157,514,842 - 157,514,968	NCBI	Rnor6.0
Rnor_5.0	5	161,254,038 - 161,254,164	UniSTS	Rnor5.0
Celera	5	149,693,073 - 149,693,199	UniSTS
RH 3.4 Map	5	1033.4	RGD
RH 3.4 Map	5	1033.4	UniSTS
RH 2.0 Map	5	1021.2	RGD

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	circulatory system	ectoderm	endocrine system	endoderm	hemolymphoid system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
3	1	92	18	7	13	3	33	25	78	5	26	7

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_024365	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473968	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	L03202	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	L19656	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	L41146	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	S62043	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000070865 ⟹ ENSRNOP00000064366

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	151,296,662 - 151,311,912 (-)	Ensembl
Rnor_6.0 Ensembl	5	157,503,040 - 157,518,511 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000078028 ⟹ ENSRNOP00000070830

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	5	157,503,164 - 157,518,631 (-)	Ensembl

RefSeq Acc Id:

NM_024365 ⟹ NP_077341

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	156,579,901 - 156,595,147 (-)	NCBI
mRatBN7.2	5	151,296,662 - 151,311,912 (-)	NCBI
Rnor_6.0	5	157,503,040 - 157,518,511 (-)	NCBI
Rnor_5.0	5	161,242,331 - 161,257,707 (-)	NCBI
Celera	5	149,681,578 - 149,696,742 (-)	RGD

Sequence:

show sequence

TAGCCAGGAACCCCACCCCCATCTTATGGCATCCCCGGTGGCCCTATTCCATCCCAGGGCTCTC
ATCCAGCCCCAAGCTAACTTTCATTGACTCGTCACATCAGTACCCCTCCCCAAACTTCTTACCC
GAGTACTCCAGGTGGCCCTGCCGTAGGAGGCACCCCTACAACTCCTCCCGATCTCTTGAAATCG
CTGCTCGATGACCTAAGAACCCCGTTTTGCCAATACTACTCTAAGGTGCAGCTTCCTTTCTCCT
CCTTTGCCTTCACCCTGTACCTGCAGTCACCATATCCCGTCTTGGTCCTCAACCCAGTCCCCAT
GGTTCCAGAGCCAGGCCCTGTCAACAGTAGCACCCCAGCCTGGGGTCCCGGGCCACCGCCTGCT
CCGGGGGGCAGCGGCTGGGTGGCTGCCGCGCTGTGCGTGGTCATCGTGCTGACAGCAGCCGCCA
ATTCGCTGCTGATCGTGCTCATTTGCACGCAGCCCGCGCTGCGCAACACGTCTAACTTCTTTCT
GGTGTCGCTCTTCACGTCGGACTTGATGGTGGGGTTGGTGGTGATGCCCCCAGCCATGCTGAAC
GCGCTGTATGGGCGCTGGGTGTTAGCTCGAGGCCTCTGTCTGCTTTGGACTGCCTTCGACGTGA
TGTGCTGCAGCGCCTCCATCCTCAACCTCTGCCTCATCAGCCTGGACCGCTACCTGCTCATCCT
CTCGCCGCTGCGCTACAAGCTGCGCATGACAGCCCCGCGAGCCCTGGCGCTCATCCTGGGTGCC
TGGAGCCTCGCGGCGCTTGCCTCCTTCCTACCCCTCTTGCTGGGCTGGCACGAACTGGGCAAAG
CTCGAACACCTGCCCCTGGCCAGTGCCGCCTATTGGCCAGCCTGCCTTTTGTCCTCGTGGCGTC
CGGCGTCACCTTTTTCCTGCCTTCGGGTGCCATCTGCTTCACCTACTGCAGGATCCTTCTGGCT
GCCCGCAAGCAGGCGGTGCAAGTGGCCTCGCTCACCACGGGCACGGCTGGCCAGGCCTTGGAAA
CCTTGCAGGTGCCCAGGACACCACGCCCAGGGATGGAGTCCGCTGACAGTAGGCGTCTGGCCAC
CAAGCATAGCAGGAAGGCCTTGAAGGCCAGCCTGACCCTGGGCATCCTGCTGGGAATGTTCTTT
GTCACCTGGCTGCCCTTCTTTGTGGCCAACATAGCTCAGGCCGTGTGTGACTGCATCTCCCCAG
GCCTCTTCGATGTCCTCACATGGCTGGGGTACTGTAATAGCACCATGAACCCTATCATCTACCC
GCTCTTTATGCGGGACTTCAAGAGGGCCCTGGGCAGGTTCCTGCCATGCGTCCACTGTCCCCCG
GAGCACCGGGCCAGCCCTGCCTCCCCCTCCATGTGGACCTCTCACAGCGGTGCCAGACCAGGCC
TCAGCCTGCAGCAGGTGCTGCCTCTGCCTCTGCCGCCAAACTCAGATTCAGACTCCGCTTCAGG
GGGCACCTCGGGCCTGCAGCTCACAGCCCAGCTTCTGCTGCCTGGAGAGGCCACCCGGGACCCC
CCGCCACCCACCAGGGCCACCACTGTGGTCAACTTCTTTGTCACAGACTCTGTGGAGCCTGAGA
TACGGCCGCATCCACTCAGTTCCCCCGTGAACTGACCAGGTCAAGAGCTGGCCATTGGAGGCCA
CATTCCCGGAGCTCTCAGCCCACTCTCCCTGAGACTAGGAGGTGGTAGGTCTCCTGAGAGTGTG
CTGAATTGAGGTATCCTCAGCTAGCCCCATCTTCTGCTGCAGGCTCCTTGACCTGAGGGGTAGC
CAGAAACATCTCTGTGGGGTACTCCAGTGCAATGTTGCTTGTGTAGTGAGGCTGGGGGCAGTCT
CAGAGCTGGGCCATTTGGTTCAGGTCAGTAGGAAAGCAATCTGTCCTCATCCCTTTCTCTCATG
GTGGG

hide sequence

Protein Sequences


Protein RefSeqs	NP_077341	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA40611	(Get FASTA)	NCBI Sequence Viewer
	AAA40618	(Get FASTA)	NCBI Sequence Viewer
	AAA92633	(Get FASTA)	NCBI Sequence Viewer
	AAB26908	(Get FASTA)	NCBI Sequence Viewer
	EDL80902	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000064366.3
GenBank Protein	P31388	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_077341 ⟸ NM_024365

- UniProtKB:

A0A8L2QXZ5 (UniProtKB/TrEMBL), A6ITK1 (UniProtKB/TrEMBL), Q63004 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MVPEPGPVNSSTPAWGPGPPPAPGGSGWVAAALCVVIVLTAAANSLLIVLICTQPALRNTSNFF
LVSLFTSDLMVGLVVMPPAMLNALYGRWVLARGLCLLWTAFDVMCCSASILNLCLISLDRYLLI
LSPLRYKLRMTAPRALALILGAWSLAALASFLPLLLGWHELGKARTPAPGQCRLLASLPFVLVA
SGVTFFLPSGAICFTYCRILLAARKQAVQVASLTTGTAGQALETLQVPRTPRPGMESADSRRLA
TKHSRKALKASLTLGILLGMFFVTWLPFFVANIAQAVCDCISPGLFDVLTWLGYCNSTMNPIIY
PLFMRDFKRALGRFLPCVHCPPEHRASPASPSMWTSHSGARPGLSLQQVLPLPLPPNSDSDSAS
GGTSGLQLTAQLLLPGEATRDPPPPTRATTVVNFFVTDSVEPEIRPHPLSSPVN

hide sequence

Ensembl Acc Id:

ENSRNOP00000064366 ⟸ ENSRNOT00000070865

Ensembl Acc Id:

ENSRNOP00000070830 ⟸ ENSRNOT00000078028

Protein Domains

G-protein coupled receptors family 1 profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P31388-F1-model_v2	AlphaFold	P31388	1-436	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13694202

Promoter ID:

EPDNEW_R4723

Type:

single initiation site

Name:

Htr6_1

Description:

5-hydroxytryptamine receptor 6

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	157,518,678 - 157,518,738	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:62044	AgrOrtholog
BioCyc Gene	G2FUF-39432	BioCyc
Ensembl Genes	ENSRNOG00000049761	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000070865.3	UniProtKB/TrEMBL
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	5HT6_rcpt	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCR_Rhodpsn	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:64354	UniProtKB/TrEMBL
NCBI Gene	64354	ENTREZGENE
PANTHER	5-HYDROXYTRYPTAMINE RECEPTOR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	5-HYDROXYTRYPTAMINE RECEPTOR 6	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	7tm_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PharmGKB	HTR6	RGD
PhenoGen	Htr6	PhenoGen
PRINTS	5HT6RECEPTR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCRRHODOPSN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000049761	RatGTEx
SMART	7TM_GPCR_Srsx	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	5HT6R_RAT	UniProtKB/Swiss-Prot
	A0A8L2QXZ5	ENTREZGENE, UniProtKB/TrEMBL
	A6ITK1	ENTREZGENE, UniProtKB/TrEMBL
	P31388	ENTREZGENE
	Q63004	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-02-11	Htr6	5-hydroxytryptamine receptor 6	Htr6	5-hydroxytryptamine (serotonin) receptor 6, G protein-coupled	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-07-17	Htr6	5-hydroxytryptamine (serotonin) receptor 6, G protein-coupled	Htr6	5-hydroxytryptamine (serotonin) receptor 6	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Htr6	5-hydroxytryptamine (serotonin) receptor 6			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in striatum, olfactory tubercle, nucleus accumbens and hippocampus	61636
gene_protein	436 amino acids	61636

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)