Advanced Search (OLGA)

Gene: Htr6 (5-hydroxytryptamine (serotonin) receptor 6) Mus musculus

Subscribe to Updates

Analyze

Symbol:

Htr6

Name:

5-hydroxytryptamine (serotonin) receptor 6

RGD ID:

62336

MGI Page

MGI

Description:

Enables G protein-coupled serotonin receptor activity. Involved in cerebral cortex cell migration and positive regulation of TOR signaling. Located in cilium. Is expressed in aorta-gonad-mesonephros; cerebral cortex intermediate zone; cerebral cortex subventricular zone; cortical plate; and embryo. Human ortholog(s) of this gene implicated in Alzheimer's disease. Orthologous to human HTR6 (5-hydroxytryptamine receptor 6).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

5-HT-6; 5-HT6; 5-hydroxytryptamine receptor 6; MGC144682; MGC144683; serotonin receptor 6

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	HTR6 (5-hydroxytryptamine receptor 6)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Htr6 (5-hydroxytryptamine receptor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Htr6 (5-hydroxytryptamine receptor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	HTR6 (5-hydroxytryptamine receptor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	HTR6 (5-hydroxytryptamine receptor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Htr6 (5-hydroxytryptamine receptor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	HTR6 (5-hydroxytryptamine receptor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	HTR6 (5-hydroxytryptamine receptor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Htr6 (5-hydroxytryptamine receptor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Htr6 (5-hydroxytryptamine receptor 6)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	HTR6 (5-hydroxytryptamine receptor 6)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	htr6 (5-hydroxytryptamine (serotonin) receptor 6)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid\|ZFIN)
Xenopus tropicalis (tropical clawed frog):	htr6	Alliance	DIOPT (Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER)

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	138,787,017 - 138,802,881 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	138,788,419 - 138,802,881 (-)	Ensembl		GRCm39 Ensembl
GRCm38	4	139,059,706 - 139,075,570 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	139,061,108 - 139,075,570 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	138,617,324 - 138,630,704 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	138,333,485 - 138,346,865 (-)	NCBI		MGSCv36	mm8
Celera	4	140,846,418 - 140,859,919 (-)	NCBI		Celera
Cytogenetic Map	4	D3	NCBI
cM Map	4	70.57	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Htr6	Mouse	Alzheimer's disease	susceptibility	ISO	HTR6 (Homo sapiens)	1358662	DNA:silent mutation:cds: 267C>T (human)	RGD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Htr6	Mouse	3-hydroxy-3-methylglutaryl-CoA lyase deficiency		ISO	HTR6 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Deficiency of hydroxymethylglutaryl-CoA lyase	ClinVar	PMID:28492532
Htr6	Mouse	chromosome 1p36 deletion syndrome		ISO	HTR6 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Chromosome 1p36 deletion syndrome	ClinVar
Htr6	Mouse	congenital disorder of glycosylation Ir		ISO	HTR6 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Congenital disorder of glycosylation type Ir	ClinVar	PMID:28492532
Htr6	Mouse	hyperprolinemia type 2		ISO	HTR6 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Hyperprolinemia type 2	ClinVar	PMID:28492532
Htr6	Mouse	Parkinson's disease 6		ISO	HTR6 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Autosomal recessive early-onset Parkinson disease 6	ClinVar	PMID:28492532

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Htr6	Mouse	amphetamine abuse		ISO	HTR6 (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:20705401
Htr6	Mouse	Memory Disorders		ISO	HTR6 (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:19733250
Htr6	Mouse	schizophrenia		ISO	HTR6 (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:12165372
Htr6	Mouse	substance-induced psychosis		ISO	HTR6 (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:20705401

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Htr6	Mouse	1,2-dichloroethane	increases expression	EXP		6480464	ethylene dichloride results in increased expression of HTR6 mRNA	CTD	PMID:28960355
Htr6	Mouse	3',5'-cyclic AMP	increases abundance	EXP		6480464	HTR6 protein results in increased abundance of Cyclic AMP	CTD	PMID:11406289
Htr6	Mouse	3',5'-cyclic AMP	multiple interactions	EXP		6480464	Serotonin promotes the reaction [HTR6 protein results in increased abundance of Cyclic AMP]	CTD	PMID:11406289
Htr6	Mouse	4,4'-sulfonyldiphenol	affects methylation	EXP		6480464	bisphenol S affects the methylation of HTR6 gene	CTD	PMID:31683443
Htr6	Mouse	6-propyl-2-thiouracil	decreases expression	ISO	Htr6 (Rattus norvegicus)	6480464	Propylthiouracil results in decreased expression of HTR6 mRNA	CTD	PMID:24780913
Htr6	Mouse	acrylamide	decreases expression	ISO	Htr6 (Rattus norvegicus)	6480464	Acrylamide results in decreased expression of HTR6 mRNA	CTD	PMID:28959563
Htr6	Mouse	Aflatoxin B2 alpha	increases methylation	ISO	HTR6 (Homo sapiens)	6480464	aflatoxin B2 results in increased methylation of HTR6 intron	CTD	PMID:30157460
Htr6	Mouse	all-trans-retinoic acid	multiple interactions	EXP		6480464	[mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of HTR6 mRNA	CTD	PMID:36189433
Htr6	Mouse	all-trans-retinoic acid	increases expression	EXP		6480464	Tretinoin results in increased expression of HTR6 mRNA	CTD	PMID:36189433
Htr6	Mouse	ammonium chloride	affects expression	ISO	Htr6 (Rattus norvegicus)	6480464	Ammonium Chloride affects the expression of HTR6 mRNA	CTD	PMID:16483693
Htr6	Mouse	apomorphine	increases response to substance	ISO	Htr6 (Rattus norvegicus)	6480464	HTR6 protein results in increased susceptibility to Apomorphine	CTD	PMID:17920665
Htr6	Mouse	apomorphine	multiple interactions	ISO	Htr6 (Rattus norvegicus)	6480464	Ro4368554 inhibits the reaction [HTR6 protein results in increased susceptibility to Apomorphine]	CTD	PMID:17920665
Htr6	Mouse	benzo[a]pyrene	increases methylation	ISO	HTR6 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of HTR6 5' UTR more ...	CTD	PMID:27901495
Htr6	Mouse	bisphenol A	decreases expression	ISO	Htr6 (Rattus norvegicus)	6480464	bisphenol A results in decreased expression of HTR6 mRNA	CTD	PMID:25181051 more ...
Htr6	Mouse	bisphenol A	decreases methylation	EXP		6480464	bisphenol A results in decreased methylation of HTR6 promoter	CTD	PMID:27312807
Htr6	Mouse	bisphenol F	decreases expression	ISO	Htr6 (Rattus norvegicus)	6480464	4 and 4'-bisphenol F results in decreased expression of HTR6 mRNA	CTD	PMID:26186136
Htr6	Mouse	cadmium atom	multiple interactions	EXP		6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of HTR6 mRNA	CTD	PMID:37325564
Htr6	Mouse	cadmium dichloride	multiple interactions	EXP		6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of HTR6 mRNA	CTD	PMID:37325564
Htr6	Mouse	chlorpyrifos	affects expression	ISO	Htr6 (Rattus norvegicus)	6480464	Chlorpyrifos affects the expression of HTR6 mRNA	CTD	PMID:17452286 and PMID:18835401
Htr6	Mouse	clozapine	multiple interactions	EXP		6480464	Clozapine binds to and results in decreased activity of HTR6 protein	CTD	PMID:11406289
Htr6	Mouse	clozapine	multiple interactions	ISO	HTR6 (Homo sapiens)	6480464	[Cuprizone co-treated with Clozapine] results in increased expression of HTR6 protein	CTD	PMID:34122009
Htr6	Mouse	clozapine	affects binding	ISO	HTR6 (Homo sapiens)	6480464	Clozapine binds to HTR6 protein	CTD	PMID:16983399
Htr6	Mouse	cocaine	multiple interactions	ISO	Htr6 (Rattus norvegicus)	6480464	[Ro 4-6790 binds to and results in decreased activity of HTR6 protein] which results in decreased susceptibility to Cocaine and [SB 271046 binds to and results in decreased activity of HTR6 protein] which results in decreased susceptibility to Cocaine	CTD	PMID:20426879
Htr6	Mouse	copper atom	increases expression	ISO	Htr6 (Rattus norvegicus)	6480464	Copper deficiency results in increased expression of HTR6 mRNA	CTD	PMID:26033743
Htr6	Mouse	copper atom	multiple interactions	ISO	Htr6 (Rattus norvegicus)	6480464	[Copper co-treated with Dietary Sucrose] results in increased expression of HTR6 mRNA	CTD	PMID:26033743
Htr6	Mouse	copper(0)	multiple interactions	ISO	Htr6 (Rattus norvegicus)	6480464	[Copper co-treated with Dietary Sucrose] results in increased expression of HTR6 mRNA	CTD	PMID:26033743
Htr6	Mouse	copper(0)	increases expression	ISO	Htr6 (Rattus norvegicus)	6480464	Copper deficiency results in increased expression of HTR6 mRNA	CTD	PMID:26033743
Htr6	Mouse	Cuprizon	multiple interactions	ISO	HTR6 (Homo sapiens)	6480464	[Cuprizone co-treated with Clozapine] results in increased expression of HTR6 protein	CTD	PMID:34122009
Htr6	Mouse	decabromodiphenyl ether	increases expression	ISO	Htr6 (Rattus norvegicus)	6480464	decabromobiphenyl ether results in increased expression of HTR6 mRNA	CTD	PMID:23640034 and PMID:23914054
Htr6	Mouse	diazinon	affects expression	ISO	Htr6 (Rattus norvegicus)	6480464	Diazinon affects the expression of HTR6 mRNA	CTD	PMID:17452286
Htr6	Mouse	dichlorine	multiple interactions	ISO	Htr6 (Rattus norvegicus)	6480464	[Ozone co-treated with Chlorine] results in increased expression of HTR6 mRNA	CTD	PMID:18636392
Htr6	Mouse	dieldrin	affects expression	ISO	Htr6 (Rattus norvegicus)	6480464	Dieldrin affects the expression of HTR6 mRNA	CTD	PMID:18835401
Htr6	Mouse	ethyl methanesulfonate	decreases expression	ISO	HTR6 (Homo sapiens)	6480464	Ethyl Methanesulfonate results in decreased expression of HTR6 mRNA	CTD	PMID:23649840
Htr6	Mouse	ethylparaben	decreases expression	ISO	HTR6 (Homo sapiens)	6480464	ethyl-p-hydroxybenzoate results in decreased expression of HTR6 mRNA	CTD	PMID:37690743
Htr6	Mouse	fenvalerate	increases expression	ISO	Htr6 (Rattus norvegicus)	6480464	fenvalerate results in increased expression of HTR6 mRNA	CTD	PMID:30307764
Htr6	Mouse	formaldehyde	decreases expression	ISO	HTR6 (Homo sapiens)	6480464	Formaldehyde results in decreased expression of HTR6 mRNA	CTD	PMID:23649840
Htr6	Mouse	lead(0)	increases expression	ISO	HTR6 (Homo sapiens)	6480464	Lead results in increased expression of HTR6 mRNA	CTD	PMID:19921347
Htr6	Mouse	lysergic acid diethylamide	affects binding	ISO	HTR6 (Homo sapiens)	6480464	Lysergic Acid Diethylamide binds to HTR6 protein	CTD	PMID:21866910
Htr6	Mouse	methamphetamine	increases response to substance	ISO	HTR6 (Homo sapiens)	6480464	HTR6 gene SNP results in increased susceptibility to Methamphetamine	CTD	PMID:20705401
Htr6	Mouse	methyl methanesulfonate	decreases expression	ISO	HTR6 (Homo sapiens)	6480464	Methyl Methanesulfonate results in decreased expression of HTR6 mRNA	CTD	PMID:23649840
Htr6	Mouse	mono(2-ethylhexyl) phthalate	multiple interactions	EXP		6480464	[mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of HTR6 mRNA	CTD	PMID:36189433
Htr6	Mouse	monosodium L-glutamate	increases expression	EXP		6480464	Sodium Glutamate results in increased expression of HTR6 mRNA	CTD	PMID:22078008
Htr6	Mouse	N-nitrosodiethylamine	multiple interactions	EXP		6480464	[Piperonyl Butoxide co-treated with Diethylnitrosamine] affects the methylation of HTR6 gene	CTD	PMID:23968726
Htr6	Mouse	Nonylphenol	multiple interactions	ISO	Htr6 (Rattus norvegicus)	6480464	[nonylphenol co-treated with octylphenol] results in decreased expression of HTR6 protein and lycium barbarum polysaccharide inhibits the reaction [[nonylphenol co-treated with octylphenol] results in decreased expression of HTR6 protein]	CTD	PMID:38642822
Htr6	Mouse	olanzapine	affects binding	ISO	HTR6 (Homo sapiens)	6480464	olanzapine binds to HTR6 protein	CTD	PMID:16983399
Htr6	Mouse	ozone	multiple interactions	ISO	Htr6 (Rattus norvegicus)	6480464	[Ozone co-treated with Chlorine] results in increased expression of HTR6 mRNA	CTD	PMID:18636392
Htr6	Mouse	paracetamol	affects expression	EXP		6480464	Acetaminophen affects the expression of HTR6 mRNA	CTD	PMID:17562736
Htr6	Mouse	picrotoxin	increases expression	ISO	Htr6 (Rattus norvegicus)	6480464	Picrotoxin results in increased expression of HTR6 mRNA	CTD	PMID:15170462
Htr6	Mouse	piperonyl butoxide	multiple interactions	EXP		6480464	[Piperonyl Butoxide co-treated with Diethylnitrosamine] affects the methylation of HTR6 gene	CTD	PMID:23968726
Htr6	Mouse	pirinixic acid	multiple interactions	EXP		6480464	NCF1 protein promotes the reaction [pirinixic acid results in decreased expression of HTR6 mRNA]	CTD	PMID:17950772
Htr6	Mouse	pirinixic acid	decreases expression	EXP		6480464	pirinixic acid results in decreased expression of HTR6 mRNA	CTD	PMID:17950772
Htr6	Mouse	potassium dichromate	decreases expression	EXP		6480464	Potassium Dichromate results in decreased expression of HTR6 mRNA	CTD	PMID:23608068
Htr6	Mouse	resveratrol	multiple interactions	ISO	HTR6 (Homo sapiens)	6480464	[Plant Extracts co-treated with Resveratrol] results in decreased expression of HTR6 mRNA	CTD	PMID:23557933
Htr6	Mouse	risperidone	multiple interactions	ISO	HTR6 (Homo sapiens)	6480464	HTR6 gene polymorphism affects the reaction [Risperidone results in increased expression of PRL protein]	CTD	PMID:19997080
Htr6	Mouse	scopolamine	decreases expression	ISO	Htr6 (Rattus norvegicus)	6480464	Scopolamine results in decreased expression of HTR6 mRNA	CTD	PMID:19733250
Htr6	Mouse	serotonin	multiple interactions	EXP		6480464	HTR6 protein affects the reaction [Serotonin affects the phosphorylation of PPP1R1B protein] and Serotonin promotes the reaction [HTR6 protein results in increased abundance of Cyclic AMP]	CTD	PMID:11406289 and PMID:11880652
Htr6	Mouse	sodium arsenite	affects methylation	ISO	HTR6 (Homo sapiens)	6480464	sodium arsenite affects the methylation of HTR6 gene	CTD	PMID:28589171
Htr6	Mouse	tetrachloromethane	affects expression	ISO	Htr6 (Rattus norvegicus)	6480464	Carbon Tetrachloride affects the expression of HTR6 mRNA	CTD	PMID:17805973
Htr6	Mouse	titanium dioxide	increases expression	EXP		6480464	titanium dioxide results in increased expression of HTR6 mRNA	CTD	PMID:29264374 and PMID:35295148
Htr6	Mouse	titanium dioxide	decreases methylation	EXP		6480464	titanium dioxide results in decreased methylation of HTR6 gene and titanium dioxide results in decreased methylation of HTR6 promoter	CTD	PMID:35295148
Htr6	Mouse	trichloroethene	increases methylation	ISO	Htr6 (Rattus norvegicus)	6480464	Trichloroethylene results in increased methylation of HTR6 gene	CTD	PMID:27618143
Htr6	Mouse	trichloroethene	increases expression	ISO	Htr6 (Rattus norvegicus)	6480464	Trichloroethylene results in increased expression of HTR6 mRNA	CTD	PMID:33387578

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Htr6	Mouse	adenylate cyclase-activating serotonin receptor signaling pathway	involved_in	ISS	UniProtKB:P50406	2290270		UniProt	GO_REF:0000024
Htr6	Mouse	adenylate cyclase-modulating G protein-coupled receptor signaling pathway	involved_in	IBA	PANTHER:PTN008610711 more ...	2290270		GO_Central	GO_REF:0000033
Htr6	Mouse	cerebral cortex cell migration	involved_in	IMP		2290270	PMID:25078650	UniProt	PMID:25078650
Htr6	Mouse	chemical synaptic transmission	involved_in	IBA	PANTHER:PTN000664111 more ...	2290270		GO_Central	GO_REF:0000033
Htr6	Mouse	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger		ISO	Htr6 (Rattus norvegicus)	9068941		RGD	PMID:7680751 and REF_RGD_ID:729174
Htr6	Mouse	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	involved_in	ISO	Htr6 (Rattus norvegicus)	2290270		GO_Central	GO_REF:0000096
Htr6	Mouse	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	involved_in	IBA	PANTHER:PTN000664111 more ...	2290270		GO_Central	GO_REF:0000033
Htr6	Mouse	G protein-coupled serotonin receptor signaling pathway	involved_in	IEA	GO:0004993	2290270		GOC	GO_REF:0000108
Htr6	Mouse	learning	involved_in	ISO	Htr6 (Rattus norvegicus)	2290270		GO_Central	GO_REF:0000096
Htr6	Mouse	learning		ISO	Htr6 (Rattus norvegicus)	9068941	instrumental learning	RGD	PMID:17192775 and REF_RGD_ID:2316999
Htr6	Mouse	long-term synaptic potentiation		ISO	Htr6 (Rattus norvegicus)	9068941		RGD	PMID:19660530 and REF_RGD_ID:2316998
Htr6	Mouse	long-term synaptic potentiation	involved_in	ISO	Htr6 (Rattus norvegicus)	2290270		GO_Central	GO_REF:0000096
Htr6	Mouse	negative regulation of acetylcholine secretion, neurotransmission		ISO	Htr6 (Rattus norvegicus)	9068941		RGD	PMID:16987217 and REF_RGD_ID:2317005
Htr6	Mouse	negative regulation of acetylcholine secretion, neurotransmission	involved_in	ISO	Htr6 (Rattus norvegicus)	2290270		GO_Central	GO_REF:0000096
Htr6	Mouse	negative regulation of gamma-aminobutyric acid secretion		ISO	Htr6 (Rattus norvegicus)	9068941		RGD	PMID:16987217 and REF_RGD_ID:2317005
Htr6	Mouse	negative regulation of gamma-aminobutyric acid secretion	involved_in	ISO	Htr6 (Rattus norvegicus)	2290270		GO_Central	GO_REF:0000096
Htr6	Mouse	negative regulation of glutamate secretion		ISO	Htr6 (Rattus norvegicus)	9068941		RGD	PMID:16987217 and REF_RGD_ID:2317005
Htr6	Mouse	negative regulation of glutamate secretion	involved_in	ISO	Htr6 (Rattus norvegicus)	2290270		GO_Central	GO_REF:0000096
Htr6	Mouse	positive regulation of dopamine secretion		ISO	Htr6 (Rattus norvegicus)	9068941		RGD	PMID:16987217 and REF_RGD_ID:2317005
Htr6	Mouse	positive regulation of dopamine secretion	involved_in	ISO	Htr6 (Rattus norvegicus)	2290270		GO_Central	GO_REF:0000096
Htr6	Mouse	positive regulation of gamma-aminobutyric acid secretion		ISO	Htr6 (Rattus norvegicus)	9068941		RGD	PMID:19660530 and REF_RGD_ID:2316998
Htr6	Mouse	positive regulation of gamma-aminobutyric acid secretion	involved_in	ISO	Htr6 (Rattus norvegicus)	2290270		GO_Central	GO_REF:0000096
Htr6	Mouse	positive regulation of TOR signaling	involved_in	IDA		2290270	PMID:23027611	UniProt	PMID:23027611
Htr6	Mouse	positive regulation of TOR signaling	involved_in	ISO	UniProtKB:P50406	2290270		GO_Central	GO_REF:0000119
Htr6	Mouse	response to estradiol		ISO	Htr6 (Rattus norvegicus)	9068941		RGD	PMID:17122082 and REF_RGD_ID:1642579
Htr6	Mouse	response to xenobiotic stimulus		ISO	Htr6 (Rattus norvegicus)	9068941	clozapine	RGD	PMID:10427606 and REF_RGD_ID:2317012

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Htr6	Mouse	cilium	located_in	IDA		2290270	PMID:22179047	MGI	PMID:22179047
Htr6	Mouse	dendrite		ISO	Htr6 (Rattus norvegicus)	9068941		RGD	PMID:10432491 and REF_RGD_ID:2317011
Htr6	Mouse	dendrite	located_in	ISO	Htr6 (Rattus norvegicus)	2290270		GO_Central	GO_REF:0000096
Htr6	Mouse	dendrite	is_active_in	IBA	PANTHER:PTN000664111 more ...	2290270		GO_Central	GO_REF:0000033
Htr6	Mouse	plasma membrane	is_active_in	IBA	PANTHER:PTN000664111 more ...	2290270		GO_Central	GO_REF:0000033
Htr6	Mouse	plasma membrane	is_active_in	ISS	UniProtKB:P50406	2290270		UniProt	GO_REF:0000024

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Htr6	Mouse	G protein-coupled serotonin receptor activity		ISO	Htr6 (Rattus norvegicus)	9068941		RGD	PMID:7680751 and REF_RGD_ID:729174
Htr6	Mouse	G protein-coupled serotonin receptor activity	enables	IDA		2290270	PMID:11406289	UniProt	PMID:11406289
Htr6	Mouse	G protein-coupled serotonin receptor activity	enables	ISO	Htr6 (Rattus norvegicus)	2290270		GO_Central	GO_REF:0000096
Htr6	Mouse	G protein-coupled serotonin receptor activity	enables	IBA	PANTHER:PTN000664111 more ...	2290270		GO_Central	GO_REF:0000033
Htr6	Mouse	neurotransmitter receptor activity	enables	IBA	PANTHER:PTN000664111 more ...	2290270		GO_Central	GO_REF:0000033
Htr6	Mouse	protein binding	enables	IPI	UniProtKB:Q9JLN9	2290270	PMID:23027611	UniProt	PMID:23027611
Htr6	Mouse	protein binding	enables	IPI	UniProtKB:P49615	2290270	PMID:25078650	UniProt	PMID:25078650
Htr6	Mouse	serotonin receptor activity	enables	IEA	UniProtKB:P50406 and ensembl:ENSP00000289753	2290270		Ensembl	GO_REF:0000107

Imported Annotations - SMPDB

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Htr6	Mouse	serotonin signaling pathway via receptors engaging G alphas protein family		ISO	HTR6 (Homo sapiens)	10402751		SMPDB	SMP:00312

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Htr6	Mouse	decreased basal metabolism		IAGP		5509061		MGI	PMID:18755168
Htr6	Mouse	decreased body length		IEA		5509061		MGI
Htr6	Mouse	decreased body weight		IAGP		5509061		MGI	PMID:18755168
Htr6	Mouse	decreased food intake		IAGP		5509061		MGI	PMID:18755168
Htr6	Mouse	decreased total body fat amount		IAGP		5509061		MGI	PMID:18755168
Htr6	Mouse	hyperactivity elicited by ethanol administration		IAGP		5509061		MGI	PMID:16452990
Htr6	Mouse	impaired behavioral response to alcohol		IAGP		5509061		MGI	PMID:16452990

#	Reference Title	Reference Citation
1.	Electronic Transfer of Homolog Data	MGD and Homologene mouse data transfer
2.	MGDs mouse GO annotations	MGD data from the GO Consortium
3.	MGD IEA	MGD IEA
4.	Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.	Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
5.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
6.	Mouse MP Annotation Import Pipeline	RGD automated import pipeline
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	Association analysis of the 5-HT6 receptor polymorphism C267T in Alzheimer's disease.	Tsai SJ, etal., Neurosci Lett 1999 Dec 3;276(2):138-9.

PMID:9335342	PMID:10349636	PMID:11042159	PMID:11076861	PMID:11217851	PMID:11406289	PMID:12477932	PMID:12855751	PMID:16141072	PMID:16141073	PMID:16452990	PMID:16602821
PMID:16612839	PMID:18663366	PMID:18755168	PMID:19737523	PMID:20558667	PMID:20813116	PMID:21267068	PMID:21289087	PMID:21873635	PMID:22179047	PMID:22833193	PMID:23027611
PMID:23392690	PMID:24497636	PMID:24952961	PMID:25078650	PMID:25795301	PMID:26979176	PMID:27581523	PMID:27791021	PMID:28031476	PMID:28087224	PMID:28931427	PMID:29678909
PMID:29778944	PMID:29896304	PMID:30883547	PMID:32047117	PMID:32329240	PMID:32512114	PMID:33357407	PMID:33372037	PMID:33960602	PMID:36055200	PMID:36496200

Htr6
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	138,787,017 - 138,802,881 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	138,788,419 - 138,802,881 (-)	Ensembl		GRCm39 Ensembl
GRCm38	4	139,059,706 - 139,075,570 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	139,061,108 - 139,075,570 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	138,617,324 - 138,630,704 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	138,333,485 - 138,346,865 (-)	NCBI		MGSCv36	mm8
Celera	4	140,846,418 - 140,859,919 (-)	NCBI		Celera
Cytogenetic Map	4	D3	NCBI
cM Map	4	70.57	NCBI

HTR6
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	19,664,875 - 19,680,966 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	19,664,875 - 19,680,966 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	19,991,368 - 20,007,459 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	19,864,367 - 19,878,642 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	19,737,085 - 19,751,361	NCBI
Celera	1	18,318,551 - 18,332,825 (+)	NCBI		Celera
Cytogenetic Map	1	p36.13	NCBI
HuRef	1	18,237,853 - 18,251,587 (+)	NCBI		HuRef
CHM1_1	1	20,101,041 - 20,115,313 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	19,488,252 - 19,504,342 (+)	NCBI		T2T-CHM13v2.0

Htr6
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	156,579,901 - 156,595,147 (-)	NCBI		GRCr8
mRatBN7.2	5	151,295,269 - 151,312,853 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	151,296,662 - 151,311,912 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	153,994,008 - 154,009,139 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	155,768,318 - 155,783,449 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	155,750,238 - 155,765,452 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	157,501,202 - 157,518,870 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	157,503,040 - 157,518,631 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	161,242,331 - 161,257,707 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	5	149,681,578 - 149,696,742 (-)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

Htr6
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955452	323,641 - 338,312 (+)	NCBI	ChiLan1.0	ChiLan1.0

HTR6
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	207,437,095 - 207,459,590 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	206,556,661 - 206,576,460 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	18,619,683 - 18,635,822 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	19,662,978 - 19,678,680 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	19,662,978 - 19,678,680 (+)	Ensembl	panpan1.1		panPan2

HTR6
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	79,022,790 - 79,033,975 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	79,022,775 - 79,033,975 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	75,536,323 - 75,547,597 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	79,589,890 - 79,601,165 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	79,589,903 - 79,601,165 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	76,407,980 - 76,419,252 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	77,415,288 - 77,426,563 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	78,486,607 - 78,497,882 (-)	NCBI		UU_Cfam_GSD_1.0

Htr6
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	40,023,901 - 40,033,703 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936474	5,848,707 - 5,859,749 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936474	5,848,719 - 5,858,520 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

HTR6
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	6	78,077,358 - 78,092,211 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	72,147,759 - 72,164,426 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

HTR6
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	112,873,132 - 112,887,533 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	112,874,734 - 112,887,066 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666033	3,273,572 - 3,288,466 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Htr6
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624764	4,778,657 - 4,791,458 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624764	4,778,563 - 4,791,505 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Htr6
984 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	384
Count of miRNA genes:	245
Interacting mature miRNAs:	274
Transcripts:	ENSMUST00000068036, ENSMUST00000105802
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1301267	Bcmd2_m	B cell maturation defect 2 (mouse)			Not determined		4	133154678	150789451	Mouse
4142139	Adip12_m	adiposity 12 (mouse)			Not determined		4	124621281	156860686	Mouse
10047132	Albq19_m	albuminuria QTL 19 (mouse)			Not determined		4	112824389	146824389	Mouse
1301525	Lmb1_m	lupus in MRL and B6 F2 cross (mouse)			Not determined		4	124264957	150676858	Mouse
14746982	Manh56_m	mandible shape 56 (mouse)					4	117815917	151815917	Mouse
4141623	W6q13_m	weight 6 weeks QTL 13 (mouse)			Not determined			88982069	140468203	Mouse
12910797	Pwgrq4_m	pre-weaning growth rate QTL 4 (mouse)					4	105835310	141433838	Mouse
25314312	Syncl2_m	synaptonemal complex length 2 (mouse)					4	65718237	146584457	Mouse
12910794	Pwbwq8_m	post-weaning body weight QTL 8 (mouse)					4	105835310	141433838	Mouse
1300743	Skull6_m	skull morphology 6 (mouse)			Not determined		4	111009051	145009280	Mouse
1301382	Arvm2_m	autoimmune renal vasculitis 2 (mouse)			Not determined		4	107791564	141791756	Mouse
1302149	Tlsr2_m	thymic lymphoma suppressor region 2 (mouse)			Not determined		4	124264957	142230960	Mouse
12910813	Pwbwq4_m	pre-weaning body weight QTL 4 (mouse)					4	105835310	141433838	Mouse
1300874	Gasa2_m	gastritis type A susceptibility locus 2 (mouse)			Not determined		4	133010494	156860686	Mouse
4141093	W3q17_m	weight 3 weeks QTL 17 (mouse)			Not determined			88982069	140468203	Mouse
27226757	Femd1_m	femur midshaft diameter 1, 5 week (mouse)					4	123993793	144326570	Mouse
12910808	Pwbwq9_m	post-weaning body weight QTL 9 (mouse)					4	105835310	141433838	Mouse
1300621	Tpnr1_m	thermal pain response 1 (mouse)			Not determined		4	125230872	156860686	Mouse
11567249	Elorr3_m	ethanol induced loss of righting response 3 (mouse)					4	3722677	156268235	Mouse
4142493	Femwf13_m	femur work to failure 13 (mouse)			Not determined			116154678	150154782	Mouse
1301815	Sles2_m	systemic lupus erythmatosus suppressor 2 (mouse)			Not determined		4	94957579	150676858	Mouse
1300663	Start2_m	startle response 2 (mouse)			Not determined		4	107264957	141265153	Mouse
1300917	Gasa1_m	gastritis type A susceptibility locus 1 (mouse)			Not determined		4	124055093	142438020	Mouse
1300537	Ap3q_m	alcohol preference 3 QTL (mouse)			Not determined		4	134654451	156860686	Mouse
1301823	Bmd7_m	bone mineral density 7 (mouse)			Not determined		4	88982069	151654550	Mouse
10412210	Cypr6_m	cytokine production 6 (mouse)			Not determined		4	120617848	154617995	Mouse
1302078	Sluc21_m	susceptibility to lung cancer 21 (mouse)			Not determined		4	117401141	151401275	Mouse
10045620	Heal22_m	wound healing/regeneration 22 (mouse)			Not determined		4	125230872	156860686	Mouse
4142481	Gct1_m	granulosa cell tumorigenesis 1 (mouse)			Not determined		4	127784226	156860686	Mouse
4141065	Shali2_m	survival time to hyperoxic acute lung injury 2 (mouse)			Not determined			124055093	141572792	Mouse
13503348	Bntq18_m	bone traits QTL 18 (mouse)					4	120617848	154617995	Mouse
13208562	Wght7_m	weight 7 (mouse)					4	90888237	148084457	Mouse
1300781	Lith8_m	lithogenic gene 8 (mouse)			Not determined		4	107264957	141265153	Mouse
4141184	Tb2r1_m	TGF-beta2 responsiveness 1 (mouse)			Not determined			137674005	150676858	Mouse
39128212	Lwq21_m	liver weight QTL 21 (mouse)					4	88982069	140468203	Mouse
4142077	Ignpq2_m	IgA nephropathy QTL 2 (mouse)			Not determined		4	133676733	156860686	Mouse
4141180	Ssic1_m	susceptibility to small intestinal cancer 1 (mouse)			Not determined			120674005	154674151	Mouse
1301584	Lrdg2_m	light induced retinal degeneration 2 (mouse)			Not determined		4	129465811	151654550	Mouse
1302102	Bis1_m	beta-carboline-induced seizures 1 (mouse)			Not determined		4	119864433	153864536	Mouse
10043996	Gct5_m	granulosa cell tumorigenesis 5 (mouse)			Not determined		4	127784226	156860686	Mouse
26884445	Sklq7_m	skull length QTL 7, 10 week (mouse)					4	68018237	150884457	Mouse
10043985	Stheal12_m	soft tissue heal 12 (mouse)			Not determined		4	121342649	155342753	Mouse
1357534	Cinda3_m	cytokine induced activation 3 (mouse)			Not determined		4	137617848	142289472	Mouse
1301982	Pltiq1_m	phospholipid transfer protein inducibility QTL 1 (mouse)			Not determined		4	124621281	156860686	Mouse
26884437	Sklq13_m	skull length QTL 13, 16 week (mouse)					4	57700000	155684457	Mouse
1300803	Sluc6_m	susceptibility to lung cancer 6 (mouse)			Not determined		4	120674005	154674151	Mouse
4141549	W10q10_m	weight 10 weeks QTL 10 (mouse)			Not determined			88982069	140468203	Mouse
4142061	Chlq16_m	circulating hormone level QTL 16 (mouse)			Not determined		4	121342649	155342753	Mouse
1300933	Cdcs9_m	cytokine deficiency colitis susceptibility 9 (mouse)			Not determined		4	125230872	156860686	Mouse
1300809	Ccrs2_m	corpus callosum hemisphere surface size 2 (mouse)			Not determined		4	107264957	141265153	Mouse
1300553	Athsq1_m	atherosclerosis susceptibility QTL 1 (mouse)			Not determined		4	137617848	151654550	Mouse
4141154	Nba1_m	New Zealand Black autoimmunity 1 (mouse)			Not determined			131650724	140879275	Mouse
1301964	Bw8q2_m	body weight at 8 weeks QTL 2 (mouse)			Not determined		4	119864433	153864536	Mouse
1301452	Elsgp1_m	elevated serum gp70 1 (mouse)			Not determined		4	121342649	155342753	Mouse
10755520	Rbc1_m	red blood cell count 1 (mouse)					4	108477692	142477692	Mouse
10755521	Hct1_m	hematocrit 1 (mouse)					4	108477692	142477692	Mouse
10755522	Hgb1_m	hemoglobin 1 (mouse)					4	108477692	142477692	Mouse
1301108	Scon2_m	sucrose consumption 2 (mouse)			Not determined		4	134654451	156860686	Mouse
1300858	Tafat_m	tally ho associated mesenteric fat pad weight (mouse)			Not determined		4	124621281	156860686	Mouse
10755531	Lymph3_m	lymphocyte differential 3 (mouse)					4	124553483	156860686	Mouse
15039382	Ltgq7_m	liver triglyceride QTL 7 (mouse)					4	105705794	139705794	Mouse
11533916	Mts1_m	mammary tumor susceptibility 1 (mouse)					4	125289325	156860686	Mouse
15039377	Bw45_m	body weight QTL 45 (mouse)					4	105705794	139705794	Mouse
1300839	Dyscalc2_m	dystrophic cardiac calcinosis 2 (mouse)			Not determined		4	111009051	145009280	Mouse
4141001	Tgq17_m	triglyceride QTL 17 (mouse)			Not determined			112523489	146523489	Mouse
15039378	Adip30_m	adiposity 30 (mouse)					4	105705794	139705794	Mouse
1357800	Tgq3_m	triglyceride QTL 3 (mouse)			Not determined		4	107055093	141055180	Mouse
15039385	Mvlq3_m	macrovesicular liver lesion QTL 3 (mouse)					4	112182386	146182386	Mouse

Htr6

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	4	D3	UniSTS
cM Map	4	64.9	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.


RefSeq Transcripts	NM_001377096	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_021358	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF134158	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK134977	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL805923	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC116652	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC116653	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466615	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSMUST00000068036 ⟹ ENSMUSP00000068333

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	4	138,788,720 - 138,802,100 (-)	Ensembl
GRCm38.p6 Ensembl	4	139,061,409 - 139,074,789 (-)	Ensembl

Ensembl Acc Id:

ENSMUST00000105802 ⟹ ENSMUSP00000101428

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	4	138,788,419 - 138,802,881 (-)	Ensembl
GRCm38.p6 Ensembl	4	139,061,108 - 139,075,570 (-)	Ensembl

RefSeq Acc Id:

NM_001377096 ⟹ NP_001364025

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	4	138,787,017 - 138,802,881 (-)	NCBI
GRCm38	4	139,059,706 - 139,075,570 (-)	NCBI

Sequence:

show sequence

GAAGCGTCGCGGGCTCCTGCGCACCATCTCCCCGGCTCGGGAGCCCTATGCCCGCCGCGCCACCAGCCGCTGCCTGTAGTCTCCAGCCCCGCGGCGCTTGCCGCAGTCGCCGGCAGCGGATCACCCGC
GAGCGCCCAGGTCTGGCCCGGCCCGGTCCGCGGCCTCCGGTACCCGGGATCCTTCAGTGCCTAGGGGAGAAAGGAGACCTGCTTTCCGCCGCCGAGCTGCGCTCCTGTTCTTGGGCCACCCCATTGCG
ACCCCCACGCGCGACAGCTCGTGATCAAGCGTACTCACACGCCCACCCTCCTCAGAGAGACTGCCCCGACCGGAAGGCGGGAGTTCGCCTCCTGCTCCCACCTCCCCAGCCGTGCCTCTGGCCAGGAG
CCCCACCCCCATCCTTAGGCATCCCCGGTGGCTCTATTCCATTCCAGGGCTCTCATCCAGCCCCAGCCCAACTTTCATGGACTCGGCGCATCGGTACCCCTCCCCAAACTTCTTACCCGAGTACTCCA
GGTGGCCCCGCCATAGGAGGCGCCCCTACAATCTCTCCCCGACCTCTTGTAATGGTTGCTCGGTGACCTAAGAACCCTGTTTTGCCACCTACTCCTCTGAGGTGCAGTTTTTACCCATCTTGCTTTCT
CTTCCTTTGGCTTCACCCTGTATCCGCATTCACCATATCCTGTCCTGGTCCTCAACCCTAGTCCCCATGGTTCCAGAGCCCGGCCCTGTCAACAGTAGCACCCCAGCCTGGGGCCCCGGGCCACCGCC
AGCCCCAGGGGGCAGCGGCTGGGTGGCCGCTGCGCTGTGCGTGGTCATCGTGCTGACGGCAGCCGCCAATTCGCTGCTGATCGCGCTCATCTGCACGCAGCCCGCGCTGCGCAACACGTCTAACTTCT
TCCTGGTGTCGCTCTTCACGTCGGACCTGATGGTGGGATTGGTGGTGATGCCCCCAGCCATGCTGAACGCGCTGTATGGGCGCTGGGTGCTAGCTCGCGGCCTCTGTCTGCTTTGGACCGCCTTCGAC
GTGATGTGCTGCAGCGCCTCCATTCTCAACCTCTGCCTCATCAGCCTGGACCGCTACCTGCTCATCCTCTCGCCGCTGCGCTACAAGCTGCGCATGACAGCCCCGCGTGCCCTGGCGCTCATCCTGGG
TGCCTGGAGCCTCGCCGCGCTGGCCTCCTTCCTGCCCCTCTTGCTGGGCTGGCATGAACTGGGCAAAGCTCGAACATCTGCCCCGGGCCAGTGCCGCCTATTGGCCAGCCTGCCTTATGTCCTCGTGG
CGTCCGGCGTCACCTTTTTCCTGCCTTCGGGTGCCATCTGCTTCACCTACTGCAGGATCTTGCTGGCTGCCCGCAAGCAGGCGGTGCAAGTGGCCTCGCTCACCACGGGCACGGCTACGGCTGGCCAG
GCCTTGGAAACCTTGCAGGTGCCCAGGACACCACGCCCAGGGATGGAGTCTGCTGACAGTAGGCGTCTGACCACCAAGCATAGCAGGAAGGCCTTGAAGGCCAGCCTGACCCTCGGCATCCTGCTGAG
CATGTTCTTTGTCACCTGGCTGCCCTTCTTTGTGGCCAGCATAGCTCAGGCCGTATGTGACTGCATCTCTCCAGGTCTCTTCGATGTCCTCACATGGCTGGGATACTGTAATAGCACCATGAACCCTA
TCATCTATCCCCTCTTCATGCGGGACTTCAAGAGGGCCCTGGGCAGGTTCGTGCCGTGTGTCCACTGTCCCCCGGAGCACCGGGCCAGCCCCGCCTCCCCCTCCATGTGGACCTCTCACAGTGGTGCC
AGGCCAGGCCTCAGCCTGCAGCAGGTGCTGCCCCTGCCTCTGCCACCCAACTCAGATTCAGACTCAGCTTCAGGGGGCACCTCGGGCCTGCAGCTCACAGCCCAGCTTTTGCTGCCTGGAGAGGCGAC
CCGGGACCCCCCGCCACCCACCAGGGCCCCTACTGTGGTCAACTTCTTCGTCACAGACTCTGTGGAGCCTGAGATACGGCAGCATCCACTTGGTTCCCCCATGAACTGACCAGGTCAAGAGCTGGCCA
GCGGAGGCCACATTCCCAGAGGCCTCAGCCCATTCTCCCTAAGAGTGGGAGGTGGTAGGTCTCCCGAGAGCATGCCGAGTGTCCTGAGGGATCCTCGGCTAGCCCCCATCTTCTACTTGAAGGCTCCT
TGACATGAGAGATAATCTGAAACATCGTAGGGTATTCCAGTACAATGTTGCTTGTGGTTTGTGTAGTGTGGCTGGCGGGGGGTGGGGGGCAGTGTCTCGGAGCTGTGCCATTTGGTTCAGTTCAGCAG
GAAAGCAATCAGTCCTCAGCCCTTTTTGTTAAGTGGGAAGAACGTATTCCTCTAGACACCCCAGTTCCTGACTGGCCCAATCCTGTTATCCAAAGTGCCATCTCTGGGTTGTTGGGGTTCCTGTAGGC
TCTGGGGAGCTTATTCAAAGTGCCCACCCCTCTGGAGATGGGCTCAATCGACATTGTATGTTCATGAGCTTTGCCAAGTCTGCCTTTGCTGAACTTTCAGACCTGCCAGCCCCTAGGAGGGGGGTGGC
AACTTTAAGAAGTAGCTTAGGCTGGAGGCTGGGCAGCCAGAAATATGACCTTTTCCTCAGCTGTATGCTGCATTTCTTGGGCTTGGCACAGGTCTCAAGGTAGAGTAGGAGTGATACCACCTGTAAGA
CAATGTGGATGGTATGCCCAGAACCTGTGAGGGGCCAGTGGGTGGTAAATCCTATTGCTTTAACTCTTGGTTAGCCGGATTCTGGCTCTGGTAGAAGGGTAGCAAGTGTCCCTCCCTCCTTCTTCCAG
CCTTCCCTCCCTCTCTCCCTCCCTCCCTCCCTCCCTCTCTTCCTTTTGTTTTGATTTGTTCTAGGCTCTCAAGTAACTCATGTTTCCCTATGTGGCCAAGGATGACCCTGAACTTGTAATCCTCTTGC
CTCTACCTCCCAAGTGCTGGGGTCACAGGGATACACCACACACCAGATTATATGGTGCTGGGGGTGAAACTCAGGGCTTCATGCATTCTGGGAAAGCACTCTACCAGTGGAGCTGTGTCCCTAGGGCC
TCCTGTTTTCTGTTAGGTCAGCCTCACATATACTAGGCAAGCGCTCTCCACGGGGCCACATCTCAGCCCCATTGTCTATTCCAGCCCAGATTGGGCTCCCAGCCTCCTTGCTTTGCTGGGTGGAGACT
GTACCACTCAGGGACTCTTTCTAGTCCCATCCTGTTCTTCTGCCTCTAGAGGCCCAGGGGATGGTGACAGATCCTGTACAACCTTAAGTGTGGGTTTCCTCTACCCCAGCTTCCCCAGCTGATGGAGG
CAGAGCAGCCCCTCATCCTGCCTGTCCCCTTTGGTTCTTCCTAGGGTCACTGAAAGAAAGAACAGCTGCTTGGGTAGGCAGCATACAGCTGAAGAGGGATGTGTGCCCCTGGCTTGGGGGTGAAGCCA
CAGACAGGCAGGTGGGCTCTGGTTTGGCACGGGGCTTGCATTTGTGGGTAAGGGCAGGGGACTCCCTTACTCCATGCTGCTCCACACTGAATTCCCCTTCAGCAGCTGCAGGTCTTTCTTTGAGCCTG
TGTTCCAGCGACCCGGGCTCCCGGACTCTCTCCCTATGGCCAGGAGCTCTCCTTGGTGCTGACCGTGCTCAACTGGGCCCTGGCAGCAAGGCTCTGGTGCTTCCGGCTTTCTCTGCCACTGGGCCTGC
CTGAGGGACTCAATAAACACAAGCTGAAGGA

hide sequence

RefSeq Acc Id:

NM_021358 ⟹ NP_067333

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	4	138,788,720 - 138,802,100 (-)	NCBI
GRCm38	4	139,061,409 - 139,074,789 (-)	NCBI
MGSCv37	4	138,617,324 - 138,630,704 (-)	RGD
Celera	4	140,846,418 - 140,859,919 (-)	RGD
cM Map	4		ENTREZGENE

Sequence:

show sequence

CCTGTCCTGGTCCTCAACCCTAGTCCCCATGGTTCCAGAGCCCGGCCCTGTCAACAGTAGCACC
CCAGCCTGGGGCCCCGGGCCACCGCCAGCCCCAGGGGGCAGCGGCTGGGTGGCCGCTGCGCTGTGCGTGGTCATCGTGCTGACGGCAGCCGCCAATTCGCTGCTGATCGCGCTCATCTGCACGCAGCC
CGCGCTGCGCAACACGTCTAACTTCTTCCTGGTGTCGCTCTTCACGTCGGACCTGATGGTGGGATTGGTGGTGATGCCCCCAGCCATGCTGAACGCGCTGTATGGGCGCTGGGTGCTAGCTCGCGGCC
TCTGTCTGCTTTGGACCGCCTTCGACGTGATGTGCTGCAGCGCCTCCATTCTCAACCTCTGCCTCATCAGCCTGGACCGCTACCTGCTCATCCTCTCGCCGCTGCGCTACAAGCTGCGCATGACAGCC
CCGCGTGCCCTGGCGCTCATCCTGGGTGCCTGGAGCCTCGCCGCGCTGGCCTCCTTCCTGCCCCTCTTGCTGGGCTGGCATGAACTGGGCAAAGCTCGAACATCTGCCCCGGGCCAGTGCCGCCTATT
GGCCAGCCTGCCTTATGTCCTCGTGGCGTCCGGCGTCACCTTTTTCCTGCCTTCGGGTGCCATCTGCTTCACCTACTGCAGGATCTTGCTGGCTGCCCGCAAGCAGGCGGTGCAAGTGGCCTCGCTCA
CCACGGGCACGGCTACGGCTGGCCAGGCCTTGGAAACCTTGCAGGTGCCCAGGACACCACGCCCAGGGATGGAGTCTGCTGACAGTAGGCGTCTGACCACCAAGCATAGCAGGAAGGCCTTGAAGGCC
AGCCTGACCCTCGGCATCCTGCTGAGCATGTTCTTTGTCACCTGGCTGCCCTTCTTTGTGGCCAGCATAGCTCAGGCCGTATGTGACTGCATCTCTCCAGGTCTCTTCGATGTCCTCACATGGCTGGG
ATACTGTAATAGCACCATGAACCCTATCATCTATCCCCTCTTCATGCGGGACTTCAAGAGGGCCCTGGGCAGGTTCGTGCCGTGTGTCCACTGTCCCCCGGAGCACCGGGCCAGCCCCGCCTCCCCCT
CCATGTGGACCTCTCACAGTGGTGCCAGGCCAGGCCTCAGCCTGCAGCAGGTGCTGCCCCTGCCTCTGCCACCCAACTCAGATTCAGACTCAGCTTCAGGGGGCACCTCGGGCCTGCAGCTCACAGCC
CAGCTTTTGCTGCCTGGAGAGGCGACCCGGGACCCCCCGCCACCCACCAGGGCCCCTACTGTGGTCAACTTCTTCGTCACAGACTCTGTGGAGCCTGAGATACGGCAGCATCCACTTGGTTCCCCCAT
GAACTGACCAGGTCAAGA

hide sequence


Protein RefSeqs	NP_001364025	(Get FASTA)	NCBI Sequence Viewer
	NP_067333	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAD46490	(Get FASTA)	NCBI Sequence Viewer
	AAI16653	(Get FASTA)	NCBI Sequence Viewer
	AAI16654	(Get FASTA)	NCBI Sequence Viewer
	BAE22367	(Get FASTA)	NCBI Sequence Viewer
	EDL13293	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000068333
	ENSMUSP00000068333.2
	ENSMUSP00000101428
	ENSMUSP00000101428.2
GenBank Protein	Q9R1C8	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_067333 ⟸ NM_021358

- UniProtKB:

Q9R1C8 (UniProtKB/Swiss-Prot), Q14AW8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MVPEPGPVNSSTPAWGPGPPPAPGGSGWVAAALCVVIVLTAAANSLLIALICTQPALRNTSNFFLVSLFTSDLMVGLVVMPPAMLNALYGRWVLARGLCLLWTAFDVMCCSASILNLCLISLDRYLLI
LSPLRYKLRMTAPRALALILGAWSLAALASFLPLLLGWHELGKARTSAPGQCRLLASLPYVLVASGVTFFLPSGAICFTYCRILLAARKQAVQVASLTTGTATAGQALETLQVPRTPRPGMESADSRR
LTTKHSRKALKASLTLGILLSMFFVTWLPFFVASIAQAVCDCISPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFVPCVHCPPEHRASPASPSMWTSHSGARPGLSLQQVLPLPLPPNSDSDS
ASGGTSGLQLTAQLLLPGEATRDPPPPTRAPTVVNFFVTDSVEPEIRQHPLGSPMN

hide sequence

RefSeq Acc Id:	NP_001364025 ⟸ NM_001377096
- UniProtKB:	Q9R1C8 (UniProtKB/Swiss-Prot), Q14AW8 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSMUSP00000101428 ⟸ ENSMUST00000105802

Ensembl Acc Id:

ENSMUSP00000068333 ⟸ ENSMUST00000068036

Protein Domains

G-protein coupled receptors family 1 profile

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9R1C8-F1-model_v2	AlphaFold	Q9R1C8	1-440	view protein structure

RGD ID:

6835484

Promoter ID:

MM_KWN:40347

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

Brain

Transcripts:

NM_021358

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	4	138,630,031 - 138,630,531 (-)	MPROMDB

Database	Acc Id	Source(s)
Ensembl Genes	ENSMUSG00000028747	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000068036	ENTREZGENE
	ENSMUST00000068036.2	UniProtKB/Swiss-Prot
	ENSMUST00000105802	ENTREZGENE
	ENSMUST00000105802.8	UniProtKB/Swiss-Prot
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot
InterPro	5HT6_rcpt	UniProtKB/Swiss-Prot
	GPCR_Rhodpsn	UniProtKB/Swiss-Prot
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot
MGD	MGI:1196627	ENTREZGENE
NCBI Gene	15565	ENTREZGENE
PANTHER	5-HYDROXYTRYPTAMINE RECEPTOR	UniProtKB/Swiss-Prot
	5-HYDROXYTRYPTAMINE RECEPTOR 6	UniProtKB/Swiss-Prot
Pfam	7tm_1	UniProtKB/Swiss-Prot
PharmGKB	HTR6	RGD
PhenoGen	Htr6	PhenoGen
PRINTS	5HT6RECEPTR	UniProtKB/Swiss-Prot
	GPCRRHODOPSN	UniProtKB/Swiss-Prot
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/Swiss-Prot
	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot
SMART	7TM_GPCR_Srsx	UniProtKB/Swiss-Prot
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot
UniProt	5HT6R_MOUSE	UniProtKB/Swiss-Prot
	Q14AW8	ENTREZGENE, UniProtKB/TrEMBL
	Q3UY46_MOUSE	UniProtKB/TrEMBL
	Q9R1C8	ENTREZGENE

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - SMPDB

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - SMPDB

Mammalian Phenotype