Advanced Search (OLGA)

Gene: Fbxo32 (F-box protein 32) Rattus norvegicus

Analyze

Symbol:

Fbxo32

Name:

F-box protein 32

RGD ID:

620373

Description:

Predicted to enable ubiquitin-protein transferase activity. Involved in muscle atrophy; positive regulation of cardiac muscle cell apoptotic process; and regulation of muscle adaptation. Predicted to be located in Z disc; cytosol; and nucleoplasm. Predicted to be part of SCF ubiquitin ligase complex. Predicted to be active in cytoplasm and nucleus. Used to study muscular atrophy. Orthologous to human FBXO32 (F-box protein 32); INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 3,3',4,4',5-pentachlorobiphenyl.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

atrogin-1; Atrogin1; atrophy gene 1; F-box only protein 32; MAFbx; muscle atrophy F-box protein

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	FBXO32 (F-box protein 32)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Fbxo32 (F-box protein 32)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Fbxo32 (F-box protein 32)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	FBXO32 (F-box protein 32)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	FBXO32 (F-box protein 32)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Fbxo32 (F-box protein 32)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	FBXO32 (F-box protein 32)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	FBXO32 (F-box protein 32)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Fbxo32 (F-box protein 32)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	WDR11 (WD repeat domain 11)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	FBXO32 (F-box protein 32)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Fbxo32 (F-box protein 32)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	fbxo32 (F-box protein 32)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG11658	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	mfb-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	fbxo32	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	91,620,925 - 91,654,491 (-)	NCBI		GRCr8
mRatBN7.2	7	89,731,428 - 89,764,997 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	89,730,232 - 89,765,436 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	91,607,526 - 91,640,897 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	93,808,794 - 93,842,166 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	93,639,384 - 93,672,680 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	98,065,664 - 98,098,071 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	98,063,735 - 98,098,268 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	98,669,144 - 98,701,551 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	94,909,568 - 94,942,444 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	94,943,797 - 94,976,674 (-)	NCBI
Celera	7	86,503,248 - 86,536,357 (-)	NCBI		Celera
Cytogenetic Map	7	q33	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

RGD Manual Disease Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fbxo32	Rat	muscular atrophy		IDA		633893		RGD
Fbxo32	Rat	primary pulmonary hypertension		ISO	RGD:734419	329812002	mRNA:increased expression:vastus lateralis	RGD

Imported Disease Annotations - ClinVar

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fbxo32	Rat	trichorhinophalangeal syndrome type I		ISO	RGD:734419	8554872	ClinVar Annotator: match by term: Trichorhinophalangeal dysplasia type I	ClinVar	PMID:25741868

Imported Disease Annotations - CTD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fbxo32	Rat	atrial fibrillation		ISO	RGD:734419	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:29892015\|PMID:30061737
Fbxo32	Rat	muscular atrophy		ISO	RGD:734419	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:21139329

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fbxo32	Rat	(+)-schisandrin B	multiple interactions	EXP		6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of FBXO32 mRNA]	CTD	PMID:31150632
Fbxo32	Rat	(S)-(-)-perillyl alcohol	increases expression	ISO	RGD:737552	6480464	perillyl alcohol results in increased expression of FBXO32 mRNA; perillyl alcohol results in increased expression more ...	CTD	PMID:19406843
Fbxo32	Rat	1,2-dichloroethane	decreases expression	ISO	RGD:737552	6480464	ethylene dichloride results in decreased expression of FBXO32 mRNA	CTD	PMID:28960355
Fbxo32	Rat	1,2-dimethylhydrazine	decreases expression	ISO	RGD:737552	6480464	1,2-Dimethylhydrazine results in decreased expression of FBXO32 mRNA	CTD	PMID:22206623
Fbxo32	Rat	17beta-estradiol	increases expression	ISO	RGD:734419	6480464	Estradiol results in increased expression of FBXO32 mRNA	CTD	PMID:16474171
Fbxo32	Rat	17beta-estradiol	decreases expression	ISO	RGD:734419	6480464	Estradiol results in decreased expression of FBXO32 mRNA	CTD	PMID:24758408\|PMID:31614463
Fbxo32	Rat	17beta-estradiol	multiple interactions	ISO	RGD:734419	6480464	[Progesterone co-treated with 8-Bromo Cyclic Adenosine Monophosphate co-treated with Estradiol] results in increased expression of more ...	CTD	PMID:23275455\|PMID:24758408
Fbxo32	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	RGD:734419	6480464	Tetrachlorodibenzodioxin results in decreased expression of FBXO32 mRNA	CTD	PMID:20106945
Fbxo32	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of FBXO32 mRNA	CTD	PMID:33387578\|PMID:34747641
Fbxo32	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	RGD:734419	6480464	Tetrachlorodibenzodioxin results in increased expression of FBXO32 mRNA	CTD	PMID:30096437
Fbxo32	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:737552	6480464	Tetrachlorodibenzodioxin affects the expression of FBXO32 mRNA	CTD	PMID:21570461
Fbxo32	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	RGD:737552	6480464	Tetrachlorodibenzodioxin results in increased expression of FBXO32 mRNA	CTD	PMID:19933214
Fbxo32	Rat	2-butoxyethanol	decreases expression	ISO	RGD:737552	6480464	n-butoxyethanol results in decreased expression of FBXO32 mRNA	CTD	PMID:19812364
Fbxo32	Rat	2-hydroxypropanoic acid	decreases expression	ISO	RGD:734419	6480464	Lactic Acid results in decreased expression of FBXO32 mRNA	CTD	PMID:30851411
Fbxo32	Rat	2-trans,6-trans,10-trans-geranylgeranyl diphosphate	multiple interactions	ISO	RGD:737552	6480464	geranylgeranyl pyrophosphate inhibits the reaction [Lovastatin results in increased expression of FBXO32 mRNA]; geranylgeranyl pyrophosphate more ...	CTD	PMID:19406843
Fbxo32	Rat	3,3',4,4',5-pentachlorobiphenyl	decreases expression	EXP		6480464	3,4,5,3',4'-pentachlorobiphenyl results in decreased expression of FBXO32 mRNA	CTD	PMID:23196670
Fbxo32	Rat	3,3',5,5'-tetrabromobisphenol A	decreases expression	ISO	RGD:737552	6480464	tetrabromobisphenol A results in decreased expression of FBXO32 mRNA	CTD	PMID:25172293
Fbxo32	Rat	3,4-methylenedioxymethamphetamine	increases expression	ISO	RGD:737552	6480464	N-Methyl-3,4-methylenedioxyamphetamine results in increased expression of FBXO32 mRNA	CTD	PMID:20188158
Fbxo32	Rat	3-chloropropane-1,2-diol	increases expression	EXP		6480464	alpha-Chlorohydrin results in increased expression of FBXO32 mRNA	CTD	PMID:28522335
Fbxo32	Rat	3-hydroxyisovaleric acid	increases expression	EXP		6480464	beta-hydroxyisovaleric acid results in increased expression of FBXO32 mRNA	CTD	PMID:24124592
Fbxo32	Rat	3-hydroxyisovaleric acid	multiple interactions	EXP		6480464	beta-hydroxyisovaleric acid inhibits the reaction [Dexamethasone results in increased expression of FBXO32 mRNA]	CTD	PMID:24124592
Fbxo32	Rat	4,4'-diaminodiphenylmethane	decreases expression	ISO	RGD:737552	6480464	4,4'-diaminodiphenylmethane results in decreased expression of FBXO32 mRNA	CTD	PMID:18648102
Fbxo32	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	RGD:737552	6480464	bisphenol S results in increased expression of FBXO32 mRNA	CTD	PMID:30951980
Fbxo32	Rat	4,4'-sulfonyldiphenol	decreases expression	ISO	RGD:737552	6480464	bisphenol S results in decreased expression of FBXO32 mRNA	CTD	PMID:39298647
Fbxo32	Rat	4-hydroxyphenyl retinamide	increases expression	ISO	RGD:737552	6480464	Fenretinide results in increased expression of FBXO32 mRNA	CTD	PMID:28973697
Fbxo32	Rat	4-nitrophenol	decreases expression	ISO	RGD:737552	6480464	4-nitrophenol results in decreased expression of FBXO32 mRNA	CTD	PMID:34673133
Fbxo32	Rat	4-phenylbutyric acid	multiple interactions	EXP		6480464	4-phenylbutyric acid inhibits the reaction [Streptozocin results in increased expression of FBXO32 protein]	CTD	PMID:30980806
Fbxo32	Rat	6-chloro-2,3,4,9-tetrahydro-1H-carbazole-1-carboxamide	multiple interactions	ISO	RGD:734419	6480464	[6-chloro-2,3,4,9-tetrahydro-1H-carbazole-1-carboxamide results in decreased activity of SIRT1 protein] which results in decreased expression of FBXO32 more ...	CTD	PMID:22146233
Fbxo32	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of FBXO32 mRNA	CTD	PMID:24780913
Fbxo32	Rat	6alpha-methylprednisolone	increases expression	EXP		6480464	Methylprednisolone results in increased expression of FBXO32 protein	CTD	PMID:21931329
Fbxo32	Rat	6alpha-methylprednisolone	multiple interactions	EXP		6480464	Testosterone inhibits the reaction [Methylprednisolone results in increased expression of FBXO32 protein]	CTD	PMID:21931329
Fbxo32	Rat	8-Br-cAMP	multiple interactions	ISO	RGD:734419	6480464	[Progesterone co-treated with 8-Bromo Cyclic Adenosine Monophosphate co-treated with Estradiol] results in increased expression of more ...	CTD	PMID:23275455
Fbxo32	Rat	acetamide	decreases expression	EXP		6480464	acetamide results in decreased expression of FBXO32 mRNA	CTD	PMID:31881176
Fbxo32	Rat	aflatoxin B1	decreases expression	ISO	RGD:734419	6480464	Aflatoxin B1 results in decreased expression of FBXO32 mRNA	CTD	PMID:22100608
Fbxo32	Rat	aflatoxin B1	increases methylation	ISO	RGD:734419	6480464	Aflatoxin B1 results in increased methylation of FBXO32 gene	CTD	PMID:27153756
Fbxo32	Rat	aldehydo-D-glucose	multiple interactions	ISO	RGD:737552	6480464	FBXO32 protein affects the reaction [Glucose results in decreased expression of KCNN2 protein]	CTD	PMID:30635400
Fbxo32	Rat	aldehydo-D-glucose	increases expression	ISO	RGD:737552	6480464	Glucose results in increased expression of FBXO32 protein	CTD	PMID:30635400
Fbxo32	Rat	all-trans-retinoic acid	multiple interactions	ISO	RGD:737552	6480464	[mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of FBXO32 mRNA	CTD	PMID:36189433
Fbxo32	Rat	alpha-Zearalanol	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in increased expression of FBXO32 mRNA	CTD	PMID:35163327
Fbxo32	Rat	amiodarone	increases expression	ISO	RGD:734419	6480464	Amiodarone results in increased expression of FBXO32 mRNA	CTD	PMID:19774075
Fbxo32	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of FBXO32 mRNA	CTD	PMID:16483693
Fbxo32	Rat	amphetamine	decreases expression	EXP		6480464	Amphetamine results in decreased expression of FBXO32 mRNA	CTD	PMID:30779732
Fbxo32	Rat	anthra[1,9-cd]pyrazol-6(2H)-one	multiple interactions	ISO	RGD:737552	6480464	pyrazolanthrone inhibits the reaction [Indican results in increased expression of FBXO32 protein]	CTD	PMID:30849338
Fbxo32	Rat	aristolochic acid A	increases expression	ISO	RGD:734419	6480464	aristolochic acid I results in increased expression of FBXO32 mRNA	CTD	PMID:33212167
Fbxo32	Rat	arotinoid acid	multiple interactions	ISO	RGD:734419	6480464	[4-(2-(5,6,7,8-tetrahydro-5,5,8,8-tetramethyl-2-naphthalenyl)-1-propenyl)benzoic acid co-treated with Chir 99021 co-treated with 3-(4-pyridyl)-1H-indole co-treated with Hydrocortisone co-treated with EGF more ...	CTD	PMID:34480604
Fbxo32	Rat	arsane	affects expression	ISO	RGD:734419	6480464	Arsenic affects the expression of FBXO32 mRNA	CTD	PMID:18414638
Fbxo32	Rat	arsane	multiple interactions	ISO	RGD:734419	6480464	[sodium arsenate results in increased abundance of Arsenic] which results in increased expression of FBXO32 more ...	CTD	PMID:32525701
Fbxo32	Rat	arsane	affects methylation	ISO	RGD:734419	6480464	Arsenic affects the methylation of FBXO32 gene	CTD	PMID:25304211
Fbxo32	Rat	arsenic atom	affects expression	ISO	RGD:734419	6480464	Arsenic affects the expression of FBXO32 mRNA	CTD	PMID:18414638
Fbxo32	Rat	arsenic atom	multiple interactions	ISO	RGD:734419	6480464	[sodium arsenate results in increased abundance of Arsenic] which results in increased expression of FBXO32 more ...	CTD	PMID:32525701
Fbxo32	Rat	arsenic atom	affects methylation	ISO	RGD:734419	6480464	Arsenic affects the methylation of FBXO32 gene	CTD	PMID:25304211
Fbxo32	Rat	arsenous acid	increases expression	ISO	RGD:737552	6480464	Arsenic Trioxide results in increased expression of FBXO32 protein	CTD	PMID:32184170\|PMID:32635466
Fbxo32	Rat	arsenous acid	increases expression	ISO	RGD:734419	6480464	Arsenic Trioxide results in increased expression of FBXO32 mRNA	CTD	PMID:24356939
Fbxo32	Rat	atorvastatin calcium	increases expression	EXP		6480464	Atorvastatin results in increased expression of FBXO32 mRNA	CTD	PMID:27377005
Fbxo32	Rat	avobenzone	increases expression	ISO	RGD:734419	6480464	avobenzone results in increased expression of FBXO32 mRNA	CTD	PMID:31016361
Fbxo32	Rat	benzo[a]pyrene	decreases expression	ISO	RGD:734419	6480464	Benzo(a)pyrene results in decreased expression of FBXO32 mRNA	CTD	PMID:20106945
Fbxo32	Rat	benzo[a]pyrene	decreases methylation	ISO	RGD:734419	6480464	Benzo(a)pyrene results in decreased methylation of FBXO32 5' UTR	CTD	PMID:27901495
Fbxo32	Rat	benzo[a]pyrene	increases methylation	ISO	RGD:734419	6480464	Benzo(a)pyrene results in increased methylation of FBXO32 3' UTR; Benzo(a)pyrene results in increased methylation of more ...	CTD	PMID:27901495
Fbxo32	Rat	benzo[a]pyrene	decreases expression	ISO	RGD:737552	6480464	Benzo(a)pyrene results in decreased expression of FBXO32 mRNA	CTD	PMID:22228805
Fbxo32	Rat	benzo[a]pyrene	increases expression	ISO	RGD:737552	6480464	Benzo(a)pyrene results in increased expression of FBXO32 mRNA	CTD	PMID:21715664
Fbxo32	Rat	bis(2-chloroethyl) sulfide	increases expression	ISO	RGD:734419	6480464	Mustard Gas results in increased expression of FBXO32 mRNA	CTD	PMID:25102026
Fbxo32	Rat	bis(2-ethylhexyl) phthalate	multiple interactions	ISO	RGD:734419	6480464	[Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in increased methylation of FBXO32 more ...	CTD	PMID:33872906
Fbxo32	Rat	bisphenol A	increases expression	ISO	RGD:737552	6480464	bisphenol A results in increased expression of FBXO32 mRNA	CTD	PMID:26063408
Fbxo32	Rat	bisphenol A	multiple interactions	ISO	RGD:734419	6480464	[bisphenol A co-treated with Fulvestrant] results in increased methylation of FBXO32 gene	CTD	PMID:31601247
Fbxo32	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of FBXO32 mRNA	CTD	PMID:30816183\|PMID:32528016
Fbxo32	Rat	bisphenol A	increases expression	ISO	RGD:734419	6480464	bisphenol A results in increased expression of FBXO32 mRNA	CTD	PMID:16474171\|PMID:25047013\|PMID:29275510
Fbxo32	Rat	bisphenol F	increases expression	ISO	RGD:737552	6480464	bisphenol F results in increased expression of FBXO32 mRNA	CTD	PMID:38685157
Fbxo32	Rat	Botulinum toxin type A	multiple interactions	ISO	RGD:737552	6480464	Ouabain affects the reaction [Botulinum Toxins, Type A affects the expression of FBXO32 mRNA]	CTD	PMID:21139329
Fbxo32	Rat	Botulinum toxin type A	affects expression	ISO	RGD:737552	6480464	Botulinum Toxins, Type A affects the expression of FBXO32 mRNA	CTD	PMID:21139329
Fbxo32	Rat	cadmium atom	multiple interactions	ISO	RGD:737552	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of FBXO32 more ...	CTD	PMID:37325564
Fbxo32	Rat	cadmium dichloride	multiple interactions	ISO	RGD:737552	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of FBXO32 more ...	CTD	PMID:37325564
Fbxo32	Rat	calcitriol	decreases expression	ISO	RGD:734419	6480464	Calcitriol results in decreased expression of FBXO32 mRNA	CTD	PMID:16002434
Fbxo32	Rat	calcitriol	multiple interactions	ISO	RGD:737552	6480464	Calcitriol inhibits the reaction [Dexamethasone results in increased expression of FBXO32 mRNA]	CTD	PMID:29962435
Fbxo32	Rat	cannabidiol	increases expression	ISO	RGD:734419	6480464	Cannabidiol results in increased expression of FBXO32 mRNA	CTD	PMID:26504004
Fbxo32	Rat	cannabidiol	multiple interactions	ISO	RGD:734419	6480464	[Dronabinol co-treated with Cannabidiol] results in increased expression of FBXO32 mRNA	CTD	PMID:26504004
Fbxo32	Rat	cantharidin	decreases expression	ISO	RGD:737552	6480464	Cantharidin results in decreased expression of FBXO32 mRNA	CTD	PMID:36907384
Fbxo32	Rat	carbon nanotube	affects expression	ISO	RGD:737552	6480464	Nanotubes, Carbon analog affects the expression of FBXO32 mRNA	CTD	PMID:25554681
Fbxo32	Rat	carbon nanotube	decreases expression	ISO	RGD:737552	6480464	Nanotubes, Carbon results in decreased expression of FBXO32 mRNA	CTD	PMID:25554681
Fbxo32	Rat	carmustine	affects response to substance	ISO	RGD:734419	6480464	FBXO32 mRNA affects the susceptibility to Carmustine	CTD	PMID:16365179
Fbxo32	Rat	celastrol	decreases expression	EXP		6480464	celastrol results in decreased expression of FBXO32 protein	CTD	PMID:25903958
Fbxo32	Rat	celastrol	multiple interactions	EXP		6480464	HSPA1A protein affects the reaction [celastrol results in decreased expression of FBXO32 protein]	CTD	PMID:25903958
Fbxo32	Rat	CGP 52608	multiple interactions	ISO	RGD:734419	6480464	CGP 52608 promotes the reaction [RORA protein binds to FBXO32 gene]	CTD	PMID:28238834
Fbxo32	Rat	CHIR 99021	decreases expression	ISO	RGD:737552	6480464	Chir 99021 results in decreased expression of FBXO32 mRNA	CTD	PMID:21832246
Fbxo32	Rat	CHIR 99021	multiple interactions	ISO	RGD:734419	6480464	[4-(2-(5,6,7,8-tetrahydro-5,5,8,8-tetramethyl-2-naphthalenyl)-1-propenyl)benzoic acid co-treated with Chir 99021 co-treated with 3-(4-pyridyl)-1H-indole co-treated with Hydrocortisone co-treated with EGF more ...	CTD	PMID:34480604
Fbxo32	Rat	CHIR 99021	multiple interactions	ISO	RGD:737552	6480464	Chir 99021 inhibits the reaction [Dexamethasone results in increased expression of FBXO32 mRNA]	CTD	PMID:21832246
Fbxo32	Rat	chlordecone	increases expression	ISO	RGD:737552	6480464	Chlordecone results in increased expression of FBXO32 mRNA	CTD	PMID:33711761
Fbxo32	Rat	chloroquine	affects expression	EXP		6480464	Chloroquine affects the expression of FBXO32 mRNA	CTD	PMID:19296457
Fbxo32	Rat	chlorpyrifos	decreases expression	ISO	RGD:737552	6480464	Chlorpyrifos results in decreased expression of FBXO32 mRNA	CTD	PMID:37019170
Fbxo32	Rat	choline	multiple interactions	ISO	RGD:737552	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ...	CTD	PMID:20938992
Fbxo32	Rat	chromium atom	decreases expression	EXP		6480464	Chromium deficiency results in decreased expression of FBXO32 mRNA; Chromium results in decreased expression of more ...	CTD	PMID:19071005\|PMID:20404053
Fbxo32	Rat	chromium(6+)	multiple interactions	ISO	RGD:734419	6480464	[zinc chromate results in increased abundance of chromium hexavalent ion] which results in increased expression more ...	CTD	PMID:38479592
Fbxo32	Rat	cisplatin	increases expression	ISO	RGD:737552	6480464	Cisplatin results in increased expression of FBXO32; Cisplatin results in increased expression of FBXO32 mRNA	CTD	PMID:21074548\|PMID:24823295\|PMID:32738330
Fbxo32	Rat	cobalt dichloride	increases expression	ISO	RGD:737552	6480464	cobaltous chloride results in increased expression of FBXO32 protein	CTD	PMID:23684559
Fbxo32	Rat	copper(II) chloride	decreases expression	ISO	RGD:734419	6480464	cupric chloride results in decreased expression of FBXO32 mRNA	CTD	PMID:38568856
Fbxo32	Rat	copper(II) sulfate	increases expression	ISO	RGD:734419	6480464	Copper Sulfate results in increased expression of FBXO32 mRNA	CTD	PMID:19549813
Fbxo32	Rat	cortisol	multiple interactions	ISO	RGD:734419	6480464	[4-(2-(5,6,7,8-tetrahydro-5,5,8,8-tetramethyl-2-naphthalenyl)-1-propenyl)benzoic acid co-treated with Chir 99021 co-treated with 3-(4-pyridyl)-1H-indole co-treated with Hydrocortisone co-treated with EGF more ...	CTD	PMID:34480604
Fbxo32	Rat	Cuprizon	decreases expression	EXP		6480464	Cuprizone results in decreased expression of FBXO32 mRNA	CTD	PMID:27523638
Fbxo32	Rat	cyclosporin A	increases expression	ISO	RGD:734419	6480464	Cyclosporine results in increased expression of FBXO32 mRNA	CTD	PMID:25562108\|PMID:27989131
Fbxo32	Rat	D-glucose	increases expression	ISO	RGD:737552	6480464	Glucose results in increased expression of FBXO32 protein	CTD	PMID:30635400
Fbxo32	Rat	D-glucose	multiple interactions	ISO	RGD:737552	6480464	FBXO32 protein affects the reaction [Glucose results in decreased expression of KCNN2 protein]	CTD	PMID:30635400
Fbxo32	Rat	DDE	decreases expression	ISO	RGD:734419	6480464	Dichlorodiphenyl Dichloroethylene results in decreased expression of FBXO32 mRNA	CTD	PMID:38568856
Fbxo32	Rat	DDT	decreases expression	EXP		6480464	DDT results in decreased expression of FBXO32 mRNA	CTD	PMID:30207508
Fbxo32	Rat	dexamethasone	multiple interactions	ISO	RGD:737552	6480464	(+)-JQ1 compound inhibits the reaction [Dexamethasone results in increased expression of FBXO32 mRNA]; Calcitriol inhibits more ...	CTD	PMID:19032942\|PMID:21832246\|PMID:22733784\|PMID:23752591\|PMID:29962435\|PMID:31706954
Fbxo32	Rat	dexamethasone	increases expression	ISO	RGD:737552	6480464	Dexamethasone results in increased expression of FBXO32 mRNA; Dexamethasone results in increased expression of FBXO32 more ...	CTD	PMID:19032942\|PMID:19262011\|PMID:21832246\|PMID:22733784\|PMID:23752591\|PMID:29962435\|PMID:31706954
Fbxo32	Rat	dexamethasone	increases expression	EXP		6480464	Dexamethasone results in increased expression of FBXO32 mRNA	CTD	PMID:18436443\|PMID:24124592
Fbxo32	Rat	dexamethasone	multiple interactions	EXP		6480464	beta-hydroxyisovaleric acid inhibits the reaction [Dexamethasone results in increased expression of FBXO32 mRNA]; Testosterone inhibits more ...	CTD	PMID:18436443\|PMID:24124592
Fbxo32	Rat	diarsenic trioxide	increases expression	ISO	RGD:737552	6480464	Arsenic Trioxide results in increased expression of FBXO32 protein	CTD	PMID:32184170\|PMID:32635466
Fbxo32	Rat	diarsenic trioxide	increases expression	ISO	RGD:734419	6480464	Arsenic Trioxide results in increased expression of FBXO32 mRNA	CTD	PMID:24356939
Fbxo32	Rat	diazinon	increases methylation	ISO	RGD:734419	6480464	Diazinon results in increased methylation of FBXO32 gene	CTD	PMID:22964155
Fbxo32	Rat	dibutyl phthalate	decreases expression	ISO	RGD:737552	6480464	Dibutyl Phthalate results in decreased expression of FBXO32 mRNA	CTD	PMID:21266533
Fbxo32	Rat	dibutyl phthalate	increases expression	EXP		6480464	Dibutyl Phthalate results in increased expression of FBXO32 mRNA	CTD	PMID:21266533
Fbxo32	Rat	dioxygen	increases expression	ISO	RGD:737552	6480464	Oxygen deficiency results in increased expression of FBXO32 mRNA	CTD	PMID:23624791
Fbxo32	Rat	dioxygen	multiple interactions	EXP		6480464	[Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in decreased expression more ...	CTD	PMID:33729688
Fbxo32	Rat	dioxygen	multiple interactions	ISO	RGD:737552	6480464	[NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of FBXO32 mRNA	CTD	PMID:30529165
Fbxo32	Rat	dioxygen	increases expression	ISO	RGD:734419	6480464	Oxygen deficiency results in increased expression of FBXO32 mRNA	CTD	PMID:26516004
Fbxo32	Rat	disodium selenite	increases expression	ISO	RGD:734419	6480464	Sodium Selenite results in increased expression of FBXO32 mRNA	CTD	PMID:18175754\|PMID:24383545
Fbxo32	Rat	doxorubicin	multiple interactions	EXP		6480464	4-(4-fluorophenyl)-2-(4-hydroxyphenyl)-5-(4-pyridyl)imidazole inhibits the reaction [Doxorubicin results in increased expression of FBXO32 mRNA]; AKT1 protein inhibits more ...	CTD	PMID:18346979
Fbxo32	Rat	doxorubicin	increases expression	ISO	RGD:734419	6480464	Doxorubicin results in increased expression of FBXO32 mRNA	CTD	PMID:29803840
Fbxo32	Rat	doxorubicin	affects expression	ISO	RGD:734419	6480464	Doxorubicin affects the expression of FBXO32 mRNA	CTD	PMID:25529476
Fbxo32	Rat	doxorubicin	increases expression	ISO	RGD:737552	6480464	Doxorubicin results in increased expression of FBXO32 mRNA; Doxorubicin results in increased expression of FBXO32 more ...	CTD	PMID:23639627\|PMID:25896364
Fbxo32	Rat	doxorubicin	increases expression	EXP		6480464	Doxorubicin results in increased expression of FBXO32 mRNA; Doxorubicin results in increased expression of FBXO32 more ...	CTD	PMID:18346979\|PMID:23639627
Fbxo32	Rat	endosulfan	decreases expression	EXP		6480464	Endosulfan results in decreased expression of FBXO32 mRNA	CTD	PMID:29391264
Fbxo32	Rat	ethanol	affects splicing	ISO	RGD:737552	6480464	Ethanol affects the splicing of FBXO32 mRNA	CTD	PMID:30319688
Fbxo32	Rat	fenofibrate	multiple interactions	ISO	RGD:737552	6480464	Lovastatin promotes the reaction [Fenofibrate results in increased expression of FBXO32 protein]; PPARA protein affects more ...	CTD	PMID:33408297
Fbxo32	Rat	fenofibrate	increases expression	ISO	RGD:737552	6480464	Fenofibrate results in increased expression of FBXO32 mRNA; Fenofibrate results in increased expression of FBXO32 more ...	CTD	PMID:33408297
Fbxo32	Rat	fluoranthene	multiple interactions	ISO	RGD:737552	6480464	[1-methylanthracene co-treated with fluoranthene] results in increased expression of FBXO32 mRNA	CTD	PMID:28329830
Fbxo32	Rat	folic acid	multiple interactions	ISO	RGD:737552	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ...	CTD	PMID:20938992
Fbxo32	Rat	fulvestrant	multiple interactions	ISO	RGD:734419	6480464	[bisphenol A co-treated with Fulvestrant] results in increased methylation of FBXO32 gene	CTD	PMID:31601247
Fbxo32	Rat	gamma-hexachlorocyclohexane	increases expression	ISO	RGD:734419	6480464	Hexachlorocyclohexane results in increased expression of FBXO32 mRNA	CTD	PMID:24356939
Fbxo32	Rat	genistein	increases expression	ISO	RGD:734419	6480464	Genistein results in increased expression of FBXO32 mRNA	CTD	PMID:16474171
Fbxo32	Rat	glucose	multiple interactions	ISO	RGD:737552	6480464	FBXO32 protein affects the reaction [Glucose results in decreased expression of KCNN2 protein]	CTD	PMID:30635400
Fbxo32	Rat	glucose	increases expression	ISO	RGD:737552	6480464	Glucose results in increased expression of FBXO32 protein	CTD	PMID:30635400
Fbxo32	Rat	GSK-J4	increases expression	ISO	RGD:734419	6480464	GSK-J4 results in increased expression of FBXO32 mRNA	CTD	PMID:29301935
Fbxo32	Rat	hexadecanoic acid	increases expression	ISO	RGD:737552	6480464	Palmitic Acid results in increased expression of FBXO32 mRNA	CTD	PMID:25614714
Fbxo32	Rat	hexadecanoic acid	multiple interactions	ISO	RGD:737552	6480464	Quercetin inhibits the reaction [Palmitic Acid results in increased expression of FBXO32 mRNA]	CTD	PMID:25614714
Fbxo32	Rat	indoxyl sulfate	multiple interactions	ISO	RGD:737552	6480464	Acetylcysteine inhibits the reaction [Indican results in increased expression of FBXO32 protein]; pyrazolanthrone inhibits the more ...	CTD	PMID:30849338
Fbxo32	Rat	indoxyl sulfate	increases expression	ISO	RGD:737552	6480464	Indican results in increased expression of FBXO32 mRNA; Indican results in increased expression of FBXO32 more ...	CTD	PMID:29380555\|PMID:30849338
Fbxo32	Rat	isoprenaline	increases expression	ISO	RGD:737552	6480464	Isoproterenol results in increased expression of FBXO32 mRNA	CTD	PMID:20003209
Fbxo32	Rat	L-ascorbic acid	multiple interactions	ISO	RGD:734419	6480464	[[Ascorbic Acid co-treated with Chir 99021 co-treated with XAV939 co-treated with BMP4 protein co-treated with more ...	CTD	PMID:34480604
Fbxo32	Rat	L-ascorbic acid 2-phosphate	multiple interactions	ISO	RGD:734419	6480464	[[ascorbate-2-phosphate co-treated with Chir 99021 co-treated with XAV939 co-treated with BMP4 protein] co-treated with [INHBA more ...	CTD	PMID:34480604
Fbxo32	Rat	L-methionine	multiple interactions	ISO	RGD:737552	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ...	CTD	PMID:20938992
Fbxo32	Rat	lead diacetate	increases expression	ISO	RGD:737552	6480464	lead acetate results in increased expression of FBXO32 mRNA	CTD	PMID:20542052
Fbxo32	Rat	Licochalcone B	increases expression	ISO	RGD:734419	6480464	licochalcone B results in increased expression of FBXO32 mRNA	CTD	PMID:33647349
Fbxo32	Rat	lipopolysaccharide	increases expression	ISO	RGD:737552	6480464	Lipopolysaccharides results in increased expression of FBXO32 mRNA	CTD	PMID:17131360
Fbxo32	Rat	lithium chloride	decreases expression	ISO	RGD:737552	6480464	Lithium Chloride results in decreased expression of FBXO32 mRNA	CTD	PMID:21832246
Fbxo32	Rat	lithocholic acid	decreases expression	ISO	RGD:737552	6480464	Lithocholic Acid results in decreased expression of FBXO32 mRNA	CTD	PMID:39695227
Fbxo32	Rat	lovastatin	multiple interactions	ISO	RGD:737552	6480464	geranylgeranyl pyrophosphate inhibits the reaction [Lovastatin results in increased expression of FBXO32 mRNA]; geranylgeranyl pyrophosphate more ...	CTD	PMID:19406843\|PMID:33408297
Fbxo32	Rat	lovastatin	increases expression	ISO	RGD:737552	6480464	Lovastatin results in increased expression of FBXO32 mRNA; Lovastatin results in increased expression of FBXO32 more ...	CTD	PMID:19406843
Fbxo32	Rat	LY294002	decreases expression	ISO	RGD:737552	6480464	2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one results in decreased expression of FBXO32 mRNA	CTD	PMID:21832246
Fbxo32	Rat	metformin	decreases expression	EXP		6480464	Metformin results in decreased expression of FBXO32 mRNA	CTD	PMID:31324951
Fbxo32	Rat	methamphetamine	increases expression	ISO	RGD:737552	6480464	Methamphetamine results in increased expression of FBXO32 mRNA	CTD	PMID:23933405
Fbxo32	Rat	methoxychlor	affects methylation	EXP		6480464	Methoxychlor affects the methylation of FBXO32 gene	CTD	PMID:35440735
Fbxo32	Rat	methylmercury chloride	increases expression	ISO	RGD:734419	6480464	methylmercuric chloride results in increased expression of FBXO32 mRNA	CTD	PMID:28001369
Fbxo32	Rat	mevalonic acid	multiple interactions	ISO	RGD:737552	6480464	Mevalonic Acid inhibits the reaction [Lovastatin results in increased expression of FBXO32 mRNA]; Mevalonic Acid more ...	CTD	PMID:19406843
Fbxo32	Rat	mono(2-ethylhexyl) phthalate	multiple interactions	ISO	RGD:734419	6480464	[Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in increased methylation of FBXO32 more ...	CTD	PMID:33872906
Fbxo32	Rat	mono(2-ethylhexyl) phthalate	multiple interactions	ISO	RGD:737552	6480464	[mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of FBXO32 mRNA	CTD	PMID:36189433
Fbxo32	Rat	monocrotaline	multiple interactions	EXP		6480464	resveratrol inhibits the reaction [Monocrotaline results in decreased expression of FBXO32 mRNA]	CTD	PMID:22146233
Fbxo32	Rat	monocrotaline	increases expression	EXP		6480464	Monocrotaline results in increased expression of FBXO32 mRNA	CTD	PMID:18801959
Fbxo32	Rat	monocrotaline	decreases expression	EXP		6480464	Monocrotaline results in decreased expression of FBXO32 mRNA	CTD	PMID:22146233
Fbxo32	Rat	Muraglitazar	decreases expression	EXP		6480464	muraglitazar results in decreased expression of FBXO32 mRNA	CTD	PMID:21515302
Fbxo32	Rat	N-acetyl-L-cysteine	multiple interactions	ISO	RGD:737552	6480464	Acetylcysteine inhibits the reaction [Indican results in increased expression of FBXO32 protein]	CTD	PMID:30849338
Fbxo32	Rat	N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal	multiple interactions	ISO	RGD:737552	6480464	benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [FBXO32 protein results in decreased expression of KCNN2 protein]	CTD	PMID:30635400
Fbxo32	Rat	nickel atom	decreases expression	ISO	RGD:734419	6480464	Nickel results in decreased expression of FBXO32 mRNA	CTD	PMID:24768652
Fbxo32	Rat	nickel dichloride	increases expression	ISO	RGD:734419	6480464	nickel chloride results in increased expression of FBXO32 mRNA	CTD	PMID:21455298
Fbxo32	Rat	nickel sulfate	increases expression	ISO	RGD:734419	6480464	nickel sulfate results in increased expression of FBXO32 mRNA	CTD	PMID:22714537
Fbxo32	Rat	ochratoxin A	decreases expression	ISO	RGD:734419	6480464	ochratoxin A metabolite results in decreased expression of FBXO32 mRNA	CTD	PMID:24356939
Fbxo32	Rat	okadaic acid	decreases expression	ISO	RGD:734419	6480464	Okadaic Acid results in decreased expression of FBXO32 mRNA	CTD	PMID:38832940
Fbxo32	Rat	ouabain	multiple interactions	ISO	RGD:737552	6480464	Ouabain affects the reaction [Botulinum Toxins, Type A affects the expression of FBXO32 mRNA]	CTD	PMID:21139329
Fbxo32	Rat	ozone	multiple interactions	ISO	RGD:737552	6480464	[Air Pollutants results in increased abundance of Ozone] which results in decreased expression of FBXO32 more ...	CTD	PMID:27106289
Fbxo32	Rat	paraquat	multiple interactions	ISO	RGD:737552	6480464	ST2825 inhibits the reaction [Paraquat results in increased expression of FBXO32 mRNA]	CTD	PMID:34811946
Fbxo32	Rat	paraquat	increases expression	ISO	RGD:737552	6480464	Paraquat results in increased expression of FBXO32 mRNA	CTD	PMID:34811946
Fbxo32	Rat	perfluorohexanesulfonic acid	decreases expression	ISO	RGD:734419	6480464	perfluorohexanesulfonic acid results in decreased expression of FBXO32 mRNA	CTD	PMID:25812627
Fbxo32	Rat	perfluorononanoic acid	decreases expression	ISO	RGD:734419	6480464	perfluoro-n-nonanoic acid results in decreased expression of FBXO32 mRNA	CTD	PMID:25812627
Fbxo32	Rat	perfluorooctane-1-sulfonic acid	increases expression	ISO	RGD:734419	6480464	perfluorooctane sulfonic acid results in increased expression of FBXO32 mRNA	CTD	PMID:38568856
Fbxo32	Rat	perfluorooctane-1-sulfonic acid	decreases expression	ISO	RGD:734419	6480464	perfluorooctane sulfonic acid results in decreased expression of FBXO32 mRNA	CTD	PMID:25812627
Fbxo32	Rat	perfluorooctanoic acid	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in increased expression of FBXO32 mRNA	CTD	PMID:35163327
Fbxo32	Rat	perfluorooctanoic acid	decreases expression	ISO	RGD:734419	6480464	perfluorooctanoic acid results in decreased expression of FBXO32 mRNA	CTD	PMID:25812627
Fbxo32	Rat	perillyl alcohol	increases expression	ISO	RGD:737552	6480464	perillyl alcohol results in increased expression of FBXO32 mRNA; perillyl alcohol results in increased expression more ...	CTD	PMID:19406843
Fbxo32	Rat	phenethyl isothiocyanate	increases expression	ISO	RGD:734419	6480464	phenethyl isothiocyanate results in increased expression of FBXO32 mRNA	CTD	PMID:26678675
Fbxo32	Rat	phenobarbital	affects expression	ISO	RGD:734419	6480464	Phenobarbital affects the expression of FBXO32 mRNA	CTD	PMID:19159669
Fbxo32	Rat	potassium chromate	decreases expression	ISO	RGD:734419	6480464	potassium chromate(VI) results in decreased expression of FBXO32 mRNA	CTD	PMID:22714537
Fbxo32	Rat	progesterone	multiple interactions	ISO	RGD:734419	6480464	[Progesterone co-treated with 8-Bromo Cyclic Adenosine Monophosphate co-treated with Estradiol] results in increased expression of more ...	CTD	PMID:23275455
Fbxo32	Rat	quercetin	multiple interactions	ISO	RGD:737552	6480464	Quercetin inhibits the reaction [Dietary Fats results in increased expression of FBXO32 mRNA]; Quercetin inhibits more ...	CTD	PMID:25614714
Fbxo32	Rat	rac-lactic acid	decreases expression	ISO	RGD:734419	6480464	Lactic Acid results in decreased expression of FBXO32 mRNA	CTD	PMID:30851411
Fbxo32	Rat	resveratrol	multiple interactions	EXP		6480464	[resveratrol results in increased localization of and results in increased activity of FOXO1 protein] which more ...	CTD	PMID:18077353\|PMID:22146233
Fbxo32	Rat	resveratrol	multiple interactions	ISO	RGD:737552	6480464	FOXO1 protein promotes the reaction [resveratrol inhibits the reaction [TNF protein results in increased expression more ...	CTD	PMID:24534773
Fbxo32	Rat	resveratrol	decreases expression	ISO	RGD:734419	6480464	resveratrol results in decreased expression of FBXO32 mRNA	CTD	PMID:25888808
Fbxo32	Rat	resveratrol	increases expression	ISO	RGD:734419	6480464	resveratrol results in increased expression of FBXO32 mRNA	CTD	PMID:22146233
Fbxo32	Rat	SB 431542	multiple interactions	ISO	RGD:734419	6480464	[LDN 193189 co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with EGF protein co-treated with FGF2 protein] results in more ...	CTD	PMID:34480604
Fbxo32	Rat	simvastatin	increases expression	ISO	RGD:737552	6480464	Simvastatin results in increased expression of FBXO32 mRNA; Simvastatin results in increased expression of FBXO32 more ...	CTD	PMID:25300705\|PMID:27734117\|PMID:33034787
Fbxo32	Rat	simvastatin	multiple interactions	ISO	RGD:737552	6480464	FST protein inhibits the reaction [Simvastatin results in increased expression of FBXO32 mRNA]; FST protein more ...	CTD	PMID:27734117\|PMID:33034787
Fbxo32	Rat	simvastatin	increases expression	EXP		6480464	Simvastatin results in increased expression of FBXO32 mRNA	CTD	PMID:19001041\|PMID:25300705
Fbxo32	Rat	sirolimus	multiple interactions	ISO	RGD:734419	6480464	[(+)-JQ1 compound co-treated with Sirolimus] affects the expression of FBXO32 mRNA; Sirolimus inhibits the reaction more ...	CTD	PMID:21245298\|PMID:25307878
Fbxo32	Rat	sirolimus	increases expression	ISO	RGD:734419	6480464	Sirolimus results in increased expression of FBXO32 mRNA	CTD	PMID:24356939
Fbxo32	Rat	sirtinol	multiple interactions	ISO	RGD:734419	6480464	[sirtinol results in decreased activity of SIRT1 protein] which results in decreased expression of FBXO32 more ...	CTD	PMID:22146233
Fbxo32	Rat	sodium arsenate	increases expression	ISO	RGD:737552	6480464	sodium arsenate results in increased expression of FBXO32 mRNA	CTD	PMID:21795629
Fbxo32	Rat	sodium arsenate	multiple interactions	ISO	RGD:734419	6480464	[sodium arsenate results in increased abundance of Arsenic] which results in increased expression of FBXO32 more ...	CTD	PMID:32525701
Fbxo32	Rat	sodium arsenite	increases expression	ISO	RGD:734419	6480464	sodium arsenite results in increased expression of FBXO32 mRNA	CTD	PMID:22714537\|PMID:23876855
Fbxo32	Rat	sodium arsenite	decreases expression	ISO	RGD:734419	6480464	sodium arsenite results in decreased expression of FBXO32 mRNA	CTD	PMID:34032870
Fbxo32	Rat	streptozocin	increases expression	EXP		6480464	Streptozocin results in increased expression of FBXO32 protein	CTD	PMID:30980806
Fbxo32	Rat	streptozocin	increases expression	ISO	RGD:737552	6480464	Streptozocin results in increased expression of FBXO32 protein	CTD	PMID:30635400
Fbxo32	Rat	streptozocin	multiple interactions	EXP		6480464	4-phenylbutyric acid inhibits the reaction [Streptozocin results in increased expression of FBXO32 protein]	CTD	PMID:30980806
Fbxo32	Rat	sulforaphane	decreases expression	ISO	RGD:734419	6480464	sulforaphane results in decreased expression of FBXO32 mRNA	CTD	PMID:31838189
Fbxo32	Rat	sunitinib	increases expression	ISO	RGD:737552	6480464	Sunitinib results in increased expression of FBXO32 mRNA	CTD	PMID:31445075
Fbxo32	Rat	sunitinib	increases expression	ISO	RGD:734419	6480464	Sunitinib results in increased expression of FBXO32 mRNA	CTD	PMID:31533062
Fbxo32	Rat	temozolomide	affects response to substance	ISO	RGD:734419	6480464	FBXO32 mRNA affects the susceptibility to temozolomide	CTD	PMID:16365179
Fbxo32	Rat	temozolomide	increases expression	ISO	RGD:734419	6480464	Temozolomide results in increased expression of FBXO32 mRNA	CTD	PMID:31758290
Fbxo32	Rat	Tesaglitazar	decreases expression	EXP		6480464	tesaglitazar results in decreased expression of FBXO32 mRNA	CTD	PMID:21515302
Fbxo32	Rat	testosterone	affects expression	ISO	RGD:737552	6480464	Testosterone affects the expression of FBXO32 mRNA	CTD	PMID:20403060
Fbxo32	Rat	testosterone	multiple interactions	EXP		6480464	Testosterone inhibits the reaction [Dexamethasone results in increased expression of FBXO32 mRNA]; Testosterone inhibits the more ...	CTD	PMID:18436443\|PMID:21931329
Fbxo32	Rat	testosterone	increases expression	EXP		6480464	Testosterone deficiency results in increased expression of FBXO32 mRNA; Testosterone deficiency results in increased expression more ...	CTD	PMID:19926828
Fbxo32	Rat	testosterone	multiple interactions	ISO	RGD:737552	6480464	Testosterone inhibits the reaction [Testosterone deficiency results in increased expression of FBXO32 mRNA]	CTD	PMID:21045173
Fbxo32	Rat	testosterone	increases expression	ISO	RGD:737552	6480464	Testosterone deficiency results in increased expression of FBXO32 mRNA; Testosterone results in increased expression of more ...	CTD	PMID:20403060\|PMID:21045173
Fbxo32	Rat	tetrachloro-1,4-benzoquinone	increases expression	ISO	RGD:734419	6480464	Chloranil results in increased expression of FBXO32 mRNA	CTD	PMID:24214992
Fbxo32	Rat	tetrachloroethene	increases expression	ISO	RGD:737552	6480464	Tetrachloroethylene results in increased expression of FBXO32 mRNA	CTD	PMID:28973375
Fbxo32	Rat	tetrachloromethane	multiple interactions	EXP		6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of FBXO32 mRNA]	CTD	PMID:31150632
Fbxo32	Rat	tetrachloromethane	increases expression	EXP		6480464	Carbon Tetrachloride results in increased expression of FBXO32 mRNA	CTD	PMID:31150632
Fbxo32	Rat	thapsigargin	increases expression	ISO	RGD:734419	6480464	Thapsigargin results in increased expression of FBXO32 mRNA	CTD	PMID:22378314
Fbxo32	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of FBXO32 mRNA	CTD	PMID:34492290
Fbxo32	Rat	titanium dioxide	increases expression	ISO	RGD:737552	6480464	titanium dioxide results in increased expression of FBXO32 mRNA	CTD	PMID:23557971
Fbxo32	Rat	titanium dioxide	increases methylation	ISO	RGD:737552	6480464	titanium dioxide results in increased methylation of FBXO32 promoter	CTD	PMID:35295148
Fbxo32	Rat	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of FBXO32 mRNA	CTD	PMID:33387578
Fbxo32	Rat	triphenyl phosphate	affects expression	ISO	RGD:734419	6480464	triphenyl phosphate affects the expression of FBXO32 mRNA	CTD	PMID:37042841
Fbxo32	Rat	troglitazone	decreases expression	EXP		6480464	troglitazone results in decreased expression of FBXO32 mRNA	CTD	PMID:21515302
Fbxo32	Rat	tungsten	decreases expression	ISO	RGD:737552	6480464	Tungsten results in decreased expression of FBXO32 mRNA	CTD	PMID:30912803
Fbxo32	Rat	tunicamycin	increases expression	ISO	RGD:734419	6480464	Tunicamycin results in increased expression of FBXO32 mRNA	CTD	PMID:22378314
Fbxo32	Rat	urethane	increases expression	ISO	RGD:734419	6480464	Urethane results in increased expression of FBXO32 mRNA	CTD	PMID:28818685
Fbxo32	Rat	valproic acid	increases expression	ISO	RGD:734419	6480464	Valproic Acid results in increased expression of FBXO32 mRNA	CTD	PMID:28001369
Fbxo32	Rat	vinclozolin	increases expression	EXP		6480464	vinclozolin results in increased expression of FBXO32 mRNA	CTD	PMID:23034163
Fbxo32	Rat	XAV939	multiple interactions	ISO	RGD:734419	6480464	[[ascorbate-2-phosphate co-treated with Chir 99021 co-treated with XAV939 co-treated with BMP4 protein] co-treated with [INHBA more ...	CTD	PMID:34480604
Fbxo32	Rat	zinc atom	multiple interactions	ISO	RGD:734419	6480464	[PCI 5002 co-treated with Zinc] results in increased expression of FBXO32 mRNA	CTD	PMID:18593933
Fbxo32	Rat	zinc(0)	multiple interactions	ISO	RGD:734419	6480464	[PCI 5002 co-treated with Zinc] results in increased expression of FBXO32 mRNA	CTD	PMID:18593933

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fbxo32	Rat	cellular response to dexamethasone stimulus	acts_upstream_of_or_within	ISO	RGD:737552	1624291	PMID:23752591	RGD	PMID:23752591
Fbxo32	Rat	muscle atrophy		IDA		633893		RGD
Fbxo32	Rat	negative regulation of cardiac muscle hypertrophy	involved_in	IMP		11079185	PMID:24117217	BHF-UCL
Fbxo32	Rat	positive regulation of cardiac muscle cell apoptotic process	involved_in	IGI	UniProtKB:O88498	11079185	PMID:24117217	BHF-UCL
Fbxo32	Rat	positive regulation of cardiac muscle cell apoptotic process	involved_in	IGI	UniProtKB:G3V6Z4	11079185	PMID:24117217	BHF-UCL
Fbxo32	Rat	protein ubiquitination	involved_in	ISO	RGD:734419	1624291	PMID:26753747	RGD	PMID:26753747
Fbxo32	Rat	protein ubiquitination	involved_in	IBA	MGI:1914072\|PANTHER:PTN002295006\|UniProtKB:Q969P5	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Fbxo32	Rat	protein ubiquitination	involved_in	ISS	UniProtKB:Q969P5	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Fbxo32	Rat	protein ubiquitination	involved_in	IEA	UniPathway:UPA00143	1600115	GO_REF:0000041	UniProt	GO_REF:0000041
Fbxo32	Rat	response to denervation involved in regulation of muscle adaptation	involved_in	ISS	UniProtKB:Q9CPU7	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Fbxo32	Rat	response to denervation involved in regulation of muscle adaptation	involved_in	ISO	RGD:737552	1624291	PMID:21465538	RGD	PMID:21465538
Fbxo32	Rat	response to electrical stimulus involved in regulation of muscle adaptation	involved_in	IDA		8553783	PMID:21465538	UniProt
Fbxo32	Rat	ubiquitin-dependent protein catabolic process		TAS		728366		RGD

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fbxo32	Rat	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Fbxo32	Rat	cytoplasm	is_active_in	IBA	MGI:1914981\|PANTHER:PTN002295006\|UniProtKB:Q969P5\|ZFIN:ZDB-GENE-040426-1040	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Fbxo32	Rat	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Fbxo32	Rat	cytoplasm	located_in	ISO	RGD:734419	1624291	PMID:26768247	RGD	PMID:26768247
Fbxo32	Rat	cytoplasm	located_in	ISS	UniProtKB:Q969P5	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Fbxo32	Rat	cytosol	located_in	ISO	RGD:734419\|UniProtKB:Q969P5-1\|UniProtKB:Q969P5-2	1624291		RGD	GO_REF:0000052
Fbxo32	Rat	nucleoplasm	located_in	ISO	RGD:734419\|UniProtKB:Q969P5-1\|UniProtKB:Q969P5-2	1624291		RGD	GO_REF:0000052
Fbxo32	Rat	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Fbxo32	Rat	nucleus	located_in	ISO	RGD:737552	1624291	PMID:21611832	RGD	PMID:21611832
Fbxo32	Rat	nucleus	is_active_in	IBA	MGI:1914072\|MGI:1914981\|PANTHER:PTN002295006\|UniProtKB:Q8TCJ0\|UniProtKB:Q969P5	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Fbxo32	Rat	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Fbxo32	Rat	SCF ubiquitin ligase complex	part_of	ISO	RGD:734419	1624291	PMID:26753747	RGD	PMID:26753747
Fbxo32	Rat	SCF ubiquitin ligase complex	part_of	IBA	MGI:1914072\|PANTHER:PTN002295006\|UniProtKB:Q969P5	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Fbxo32	Rat	ubiquitin ligase complex	part_of	NAS		11079185	PMID:24117217	BHF-UCL
Fbxo32	Rat	Z disc	located_in	ISO	RGD:737552	1624291	PMID:19850579	RGD	PMID:19850579

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fbxo32	Rat	protein binding	enables	ISO	RGD:734419	1624291	UniProtKB:O00303 PMID:18354498	RGD	PMID:18354498
Fbxo32	Rat	protein binding	enables	ISO	RGD:737552	1624291	UniProtKB:Q14896 PMID:19850579	RGD	PMID:19850579
Fbxo32	Rat	ubiquitin-protein transferase activity		TAS		728366		RGD

Disease Annotations Click to see Annotation Detail View

atrial fibrillation (ISO)

muscular atrophy (IDA,ISO)

primary pulmonary hypertension (ISO)

trichorhinophalangeal syndrome type I (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(S)-(-)-perillyl alcohol (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-butoxyethanol (ISO)

2-hydroxypropanoic acid (ISO)

2-trans,6-trans,10-trans-geranylgeranyl diphosphate (ISO)

3,3',4,4',5-pentachlorobiphenyl (EXP)

3,3',5,5'-tetrabromobisphenol A (ISO)

3,4-methylenedioxymethamphetamine (ISO)

3-chloropropane-1,2-diol (EXP)

3-hydroxyisovaleric acid (EXP)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

4-nitrophenol (ISO)

4-phenylbutyric acid (EXP)

6-chloro-2,3,4,9-tetrahydro-1H-carbazole-1-carboxamide (ISO)

6-propyl-2-thiouracil (EXP)

6alpha-methylprednisolone (EXP)

8-Br-cAMP (ISO)

acetamide (EXP)

aflatoxin B1 (ISO)

aldehydo-D-glucose (ISO)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

amiodarone (ISO)

ammonium chloride (EXP)

amphetamine (EXP)

anthra[1,9-cd]pyrazol-6(2H)-one (ISO)

aristolochic acid A (ISO)

arotinoid acid (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

atorvastatin calcium (EXP)

avobenzone (ISO)

benzo[a]pyrene (ISO)

bis(2-chloroethyl) sulfide (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

Botulinum toxin type A (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

calcitriol (ISO)

cannabidiol (ISO)

cantharidin (ISO)

carbon nanotube (ISO)

carmustine (ISO)

celastrol (EXP)

CGP 52608 (ISO)

CHIR 99021 (ISO)

chlordecone (ISO)

chloroquine (EXP)

chlorpyrifos (ISO)

choline (ISO)

chromium atom (EXP)

chromium(6+) (ISO)

cisplatin (ISO)

cobalt dichloride (ISO)

copper(II) chloride (ISO)

copper(II) sulfate (ISO)

cortisol (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

D-glucose (ISO)

DDE (ISO)

DDT (EXP)

dexamethasone (EXP,ISO)

diarsenic trioxide (ISO)

diazinon (ISO)

dibutyl phthalate (EXP,ISO)

dioxygen (EXP,ISO)

disodium selenite (ISO)

doxorubicin (EXP,ISO)

endosulfan (EXP)

ethanol (ISO)

fenofibrate (ISO)

fluoranthene (ISO)

folic acid (ISO)

fulvestrant (ISO)

gamma-hexachlorocyclohexane (ISO)

genistein (ISO)

glucose (ISO)

GSK-J4 (ISO)

hexadecanoic acid (ISO)

indoxyl sulfate (ISO)

isoprenaline (ISO)

L-ascorbic acid (ISO)

L-ascorbic acid 2-phosphate (ISO)

L-methionine (ISO)

lead diacetate (ISO)

Licochalcone B (ISO)

lipopolysaccharide (ISO)

lithium chloride (ISO)

lithocholic acid (ISO)

lovastatin (ISO)

LY294002 (ISO)

metformin (EXP)

methamphetamine (ISO)

methoxychlor (EXP)

methylmercury chloride (ISO)

mevalonic acid (ISO)

mono(2-ethylhexyl) phthalate (ISO)

monocrotaline (EXP)

Muraglitazar (EXP)

N-acetyl-L-cysteine (ISO)

N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO)

nickel atom (ISO)

nickel dichloride (ISO)

nickel sulfate (ISO)

ochratoxin A (ISO)

okadaic acid (ISO)

ouabain (ISO)

ozone (ISO)

paraquat (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP,ISO)

perillyl alcohol (ISO)

phenethyl isothiocyanate (ISO)

phenobarbital (ISO)

potassium chromate (ISO)

progesterone (ISO)

quercetin (ISO)

rac-lactic acid (ISO)

resveratrol (EXP,ISO)

SB 431542 (ISO)

simvastatin (EXP,ISO)

sirolimus (ISO)

sirtinol (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

streptozocin (EXP,ISO)

sulforaphane (ISO)

sunitinib (ISO)

temozolomide (ISO)

Tesaglitazar (EXP)

testosterone (EXP,ISO)

tetrachloro-1,4-benzoquinone (ISO)

tetrachloroethene (ISO)

tetrachloromethane (EXP)

thapsigargin (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trichloroethene (EXP)

triphenyl phosphate (ISO)

troglitazone (EXP)

tungsten (ISO)

tunicamycin (ISO)

urethane (ISO)

valproic acid (ISO)

vinclozolin (EXP)

XAV939 (ISO)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to dexamethasone stimulus (ISO)

muscle atrophy (IDA)

negative regulation of cardiac muscle hypertrophy (IMP)

positive regulation of cardiac muscle cell apoptotic process (IGI)

protein ubiquitination (IBA,IEA,ISO,ISS)

response to denervation involved in regulation of muscle adaptation (ISO,ISS)

response to electrical stimulus involved in regulation of muscle adaptation (IDA)

ubiquitin-dependent protein catabolic process (TAS)

Cellular Component

cytoplasm (IBA,IEA,ISO,ISS)

cytosol (ISO)

nucleoplasm (ISO)

nucleus (IBA,IEA,ISO)

SCF ubiquitin ligase complex (IBA,ISO)

ubiquitin ligase complex (NAS)

Z disc (ISO)

Molecular Function

protein binding (ISO)

ubiquitin-protein transferase activity (TAS)

References

References - curated

#	Reference Title	Reference Citation
1.	Skeletal muscle dysfunction in idiopathic pulmonary arterial hypertension.	Batt J, etal., Am J Respir Cell Mol Biol. 2014 Jan;50(1):74-86. doi: 10.1165/rcmb.2012-0506OC.
2.	Identification of ubiquitin ligases required for skeletal muscle atrophy.	Bodine SC, etal., Science 2001 Nov 23;294(5547):1704-8.
3.	Induction of MafBx and Murf ubiquitin ligase mRNAs in rat skeletal muscle after LPS injection.	Dehoux MJ, etal., FEBS Lett 2003 Jun 5;544(1-3):214-7.
4.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.	Myogenin regulates denervation-dependent muscle atrophy in mouse soleus muscle.	Macpherson PC, etal., J Cell Biochem. 2011 Aug;112(8):2149-59. doi: 10.1002/jcb.23136.
6.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
7.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.	GOA pipeline	RGD automated data pipeline
9.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
11.	The miR-19a/b family positively regulates cardiomyocyte hypertrophy by targeting atrogin-1 and MuRF-1.	Song DW, etal., Biochem J. 2014 Jan 1;457(1):151-62. doi: 10.1042/BJ20130833.

Additional References at PubMed

PMID:15284206	PMID:15726428	PMID:16714087	PMID:16949134	PMID:17034040	PMID:17622304	PMID:17721978	PMID:17916612	PMID:18644837	PMID:19028597	PMID:19211729	PMID:19728616
PMID:19777444	PMID:19803207	PMID:19850579	PMID:20191313	PMID:20349269	PMID:20371624	PMID:20519361	PMID:20555375	PMID:21611832	PMID:21617130	PMID:21691063	PMID:22146233
PMID:22328594	PMID:22702057	PMID:22854904	PMID:23084640	PMID:23335977	PMID:23388481	PMID:23526547	PMID:23752591	PMID:23866982	PMID:24084216	PMID:25300705	PMID:26483344
PMID:26691660	PMID:26753747	PMID:26768247	PMID:27521792	PMID:27841025	PMID:28000044	PMID:28246104	PMID:30312703	PMID:31311969	PMID:32646070

Genomics

Comparative Map Data

Fbxo32
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	91,620,925 - 91,654,491 (-)	NCBI		GRCr8
mRatBN7.2	7	89,731,428 - 89,764,997 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	89,730,232 - 89,765,436 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	91,607,526 - 91,640,897 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	93,808,794 - 93,842,166 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	93,639,384 - 93,672,680 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	98,065,664 - 98,098,071 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	98,063,735 - 98,098,268 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	98,669,144 - 98,701,551 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	94,909,568 - 94,942,444 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	94,943,797 - 94,976,674 (-)	NCBI
Celera	7	86,503,248 - 86,536,357 (-)	NCBI		Celera
Cytogenetic Map	7	q33	NCBI

FBXO32
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	8	123,497,889 - 123,541,206 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	8	123,497,889 - 123,541,206 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	8	124,510,129 - 124,553,446 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	8	124,584,539 - 124,622,627 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	8	124,584,539 - 124,613,564	NCBI
Celera	8	120,703,016 - 120,741,104 (-)	NCBI		Celera
Cytogenetic Map	8	q24.13	NCBI
HuRef	8	119,835,717 - 119,879,094 (-)	NCBI		HuRef
CHM1_1	8	124,550,510 - 124,593,876 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	8	124,628,980 - 124,672,309 (-)	NCBI		T2T-CHM13v2.0

Fbxo32
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	58,039,275 - 58,078,288 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	58,039,275 - 58,078,328 (-)	Ensembl		GRCm39 Ensembl
GRCm38	15	58,175,879 - 58,214,892 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	58,175,879 - 58,214,932 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	15	58,011,634 - 58,046,433 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	15	58,010,162 - 58,044,957 (-)	NCBI		MGSCv36	mm8
Celera	15	59,700,046 - 59,734,826 (-)	NCBI		Celera
Cytogenetic Map	15	D1	NCBI
cM Map	15	24.43	NCBI

Fbxo32
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955540	2,309,315 - 2,340,956 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955540	2,309,315 - 2,334,735 (-)	NCBI	ChiLan1.0	ChiLan1.0

FBXO32
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	7	140,929,665 - 140,973,569 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	8	116,440,872 - 116,484,172 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	8	120,192,822 - 120,236,116 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	8	122,948,853 - 122,992,157 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	8	122,954,343 - 122,992,157 (-)	Ensembl	panpan1.1		panPan2

FBXO32
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	13	21,804,442 - 21,838,157 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	13	21,809,292 - 21,838,169 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	13	21,770,175 - 21,803,891 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	13	22,146,431 - 22,178,526 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	13	22,148,672 - 22,178,548 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	13	21,873,240 - 21,906,944 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	13	21,975,418 - 22,009,111 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	13	22,218,984 - 22,252,700 (-)	NCBI		UU_Cfam_GSD_1.0

Fbxo32
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	16,460,677 - 16,496,758 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936470	23,886,970 - 23,918,258 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936470	23,886,836 - 23,919,063 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FBXO32
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	15,895,689 - 15,930,931 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	15,895,875 - 15,925,929 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	16,639,187 - 16,669,235 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

FBXO32
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	8	118,071,856 - 118,115,761 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666039	22,118,961 - 22,162,524 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Fbxo32
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624735	31,475,041 - 31,509,245 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624735	31,475,008 - 31,511,837 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Fbxo32
162 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	70
Count of miRNA genes:	65
Interacting mature miRNAs:	67
Transcripts:	ENSRNOT00000010361
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300179	Kidm5	Kidney mass QTL 5	3.51		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	43747012	135012528	Rat
2293667	Bss42	Bone structure and strength QTL 42	7.25	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	7	47651439	92651439	Rat
1331728	Bp214	Blood pressure QTL 214	2.825		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	80221299	124373579	Rat
2317035	Aia16	Adjuvant induced arthritis QTL 16	2.71		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	7	59238038	104238038	Rat
2298475	Eau6	Experimental allergic uveoretinitis QTL 6		0.0029	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	7	84257275	129257275	Rat
71114	Niddm14	Non-insulin dependent diabetes mellitus QTL 14	4.5		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	7	84257275	129257275	Rat
2293678	Bss24	Bone structure and strength QTL 24	6.71	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	7	47651439	92651439	Rat
1358361	Sradr5	Stress Responsive Adrenal Weight QTL 5	5.55		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	7	43747012	108555253	Rat
1357338	Stl17	Serum triglyceride level QTL 17	3.23		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	7	69736356	112729554	Rat
634331	Pia17	Pristane induced arthritis QTL 17	4.7		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	7	73829340	130221005	Rat
1358914	Bp266	Blood pressure QTL 266			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	83591953	134666232	Rat
2293685	Bmd21	Bone mineral density QTL 21	4.2	0.0003	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	7	47651439	92651439	Rat
631504	Cm27	Cardiac mass QTL 27	3.45		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	7	44421311	118198041	Rat
634322	Bw12	Body weight QTL 12	0		body mass (VT:0001259)	body weight (CMO:0000012)	7	83153392	128153392	Rat
70173	Niddm19	Non-insulin dependent diabetes mellitus QTL 19	4.33	0.00005	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	64002457	135012528	Rat
2317052	Aia17	Adjuvant induced arthritis QTL 17	2.13		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	7	81737938	126737938	Rat
631529	Tls2	T-lymphoma susceptibility QTL 2	0	0.001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	7	80221299	109401111	Rat
2293696	Bmd32	Bone mineral density QTL 32	5.1	0.0001	femur strength trait (VT:0010010)	femoral neck polar moment of inertia (CMO:0001670)	7	47651439	92651439	Rat
1300151	Bp181	Blood pressure QTL 181	3.36		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	7	53612714	103945643	Rat
1559283	Emca4	Estrogen-induced mammary cancer QTL 4	3.7		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	7	62004452	101773158	Rat
1643004	Pain2	Pain QTL 2	1		mechanical nociception trait (VT:0002734)	self mutilation severity score (CMO:0002145)	7	9462246	98011544	Rat
738030	Anxrr8	Anxiety related response QTL 8	4.1		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	46590070	91590070	Rat
1300149	Cm6	Cardiac mass QTL 6	4.09		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	7	43747099	102228765	Rat
7411607	Foco15	Food consumption QTL 15		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	75918751	120918751	Rat
1558655	Swd4	Spike wave discharge measurement QTL 4	3.68	0.0002	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge severity grade (CMO:0001988)	7	86983365	131983365	Rat
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	924703	115097879	Rat
2293707	Bss32	Bone structure and strength QTL 32	7.64	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	7	47651439	92651439	Rat
1331768	Kidm10	Kidney mass QTL 10	4.62096		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	80221299	125221299	Rat
61357	Bp38	Blood pressure QTL 38	1.6	0.052	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	41333674	119109060	Rat
1641908	Teswt1	Testicular weight QTL 1	3.28		testis mass (VT:1000644)	both testes wet weight (CMO:0000175)	7	80221299	94811326	Rat
2293644	Bmd29	Bone mineral density QTL 29	5.4	0.0001	femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	7	47651439	92651439	Rat
2316947	Rf58	Renal function QTL 58	7.8		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	7	68938720	113886318	Rat
2300178	Bmd54	Bone mineral density QTL 54	5.3	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	7	47651439	92651439	Rat
724537	Niddm52	Non-insulin dependent diabetes mellitus QTL 52		0.02	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	80221299	93595843	Rat
1298528	Bp169	Blood pressure QTL 169		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	61074194	106074194	Rat
61428	Scl3	Serum cholesterol level QTL 3	3.2		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	7	44867533	89867533	Rat
1331746	Kidm9	Kidney mass QTL 9	3.934		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	7	80221299	112308525	Rat
1576303	Ept7	Estrogen-induced pituitary tumorigenesis QTL 7	3.7		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	7	62004452	101773158	Rat
7411654	Foco25	Food consumption QTL 25	9.3	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	75918751	120918751	Rat
2316955	Stl24	Serum triglyceride level QTL 24	7.1		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	7	68938720	113886318	Rat
2316952	Pur22	Proteinuria QTL 22	5.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	7	68938720	113886318	Rat
631540	Bw9	Body weight QTL 9	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	7	69736226	117455174	Rat
1358891	Bp265	Blood pressure QTL 265	2.21		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	83591953	134666232	Rat

Markers in Region

D7Uwm16

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	89,740,273 - 89,740,457 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	98,074,313 - 98,074,496	NCBI	Rnor6.0
Rnor_5.0	7	98,677,793 - 98,677,976	UniSTS	Rnor5.0
RGSC_v3.4	7	94,918,217 - 94,918,401	RGD	RGSC3.4
RGSC_v3.4	7	94,918,218 - 94,918,401	UniSTS	RGSC3.4
RGSC_v3.1	7	94,952,447 - 94,952,631	RGD
Celera	7	86,511,895 - 86,512,068	UniSTS
Cytogenetic Map	7	q33	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_133521	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AY059628	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473950	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000010361 ⟹ ENSRNOP00000010361

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	89,730,232 - 89,765,436 (-)	Ensembl
Rnor_6.0 Ensembl	7	98,063,735 - 98,098,268 (-)	Ensembl

RefSeq Acc Id:

NM_133521 ⟹ NP_598205

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	91,620,925 - 91,654,491 (-)	NCBI
mRatBN7.2	7	89,731,428 - 89,764,997 (-)	NCBI
Rnor_6.0	7	98,065,664 - 98,098,071 (-)	NCBI
Rnor_5.0	7	98,669,144 - 98,701,551 (-)	NCBI
RGSC_v3.4	7	94,909,568 - 94,942,444 (-)	RGD
Celera	7	86,503,248 - 86,536,357 (-)	RGD

Sequence:

show sequence

ATGCCGTTCCTTGGTCAGGACTGGCGGTCCCCGGGCCAGAGCTGGGTGAAGACGGCGGACGGCT
GGAAGCGCTTCTTGGATGAGAAAAGCGGCACCTTCGTGAGCGACCTCAGCAGTTACTGCAACAA
GGAGAATCTGTTCAACAGCCTGAACTACGATGTTGCAGCCAAGAAGAGAAAGAAAGACATACAG
AACAGCAAAACCAAAACTCAGTATTTCCATCAGGAGAAGTGGATCTATGTTCACAAAGGGAGTA
CTAAGGAGCGCCATGGATACTGCACTTTGGGGGAAGCTTTCAACAGACTGGACTTCTCGACTGC
CATCCTGGATTCCAGAAGATTCAACTACGTAGTAAGGCTGTTGGAGCTGATAGCAAAGTCACAG
CTCACATCCCTGAGTGGCATCGCCCAAAAGAACTTCATGAACATTTTGGAAAAAGTAGTACTGA
AAGTTCTTGAAGACCAGCAAAACATAAGACTCATACGGGAACTTCTCCAGACCCTCTACACATC
CTTATGCACGCTGGTCCAGAGAGTCGGCAAGTCCGTGCTGGTGGGCAACATCAACATGTGGGTG
TATCGAATGGAGACCACTCTACACTGGCAACAGCAGCTGAACAGCATCCAGATCAGCAGGCCGG
CCTTCAAAGGTCTCACGATCACCGACCTGCCTGTGTGCTTACAACTGAACATCATGCAGAGGCT
GAGCGATGGGCGGGACCTGGTCAGCCTGGGCCAGGCAGCCCCAGACCTGCATGTGCTCAGTGAA
GACCGGCTACTGTGGAAGAGACTCTGCCAGTACCACTTCTCAGAGCGGCAGATCCGCAAGCGAT
TGATCTTGTCTGACAAAGGGCAGCTGGATTGGAAGAAGATGTACTTTAAGCTTGTGCGATGTTA
CCCAAGAAGAGAACAGTATGGGGTCACCCTGCAGCTTTGCAAACACTGCCACATTCTCTCCTGG
AAGGGCACTGACCATCCATGCACGGCCAACAACCCAGAGAGCTGCTCCGTCTCACTTTCACCCC
AAGACTTTATTAACTTGTTCAAGTTCTGA

hide sequence

Protein Sequences


Protein RefSeqs	NP_598205	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAL16406	(Get FASTA)	NCBI Sequence Viewer
	EDM16222	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000104530
GenBank Protein	Q91Z62	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_598205 ⟸ NM_133521

- UniProtKB:

Q91Z62 (UniProtKB/Swiss-Prot), G3V6Z4 (UniProtKB/TrEMBL), A6HRK0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MPFLGQDWRSPGQSWVKTADGWKRFLDEKSGTFVSDLSSYCNKENLFNSLNYDVAAKKRKKDIQ
NSKTKTQYFHQEKWIYVHKGSTKERHGYCTLGEAFNRLDFSTAILDSRRFNYVVRLLELIAKSQ
LTSLSGIAQKNFMNILEKVVLKVLEDQQNIRLIRELLQTLYTSLCTLVQRVGKSVLVGNINMWV
YRMETTLHWQQQLNSIQISRPAFKGLTITDLPVCLQLNIMQRLSDGRDLVSLGQAAPDLHVLSE
DRLLWKRLCQYHFSERQIRKRLILSDKGQLDWKKMYFKLVRCYPRREQYGVTLQLCKHCHILSW
KGTDHPCTANNPESCSVSLSPQDFINLFKF

hide sequence

Ensembl Acc Id:

ENSRNOP00000010361 ⟸ ENSRNOT00000010361

Protein Domains

F-box

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q91Z62-F1-model_v2	AlphaFold	Q91Z62	1-350	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13695348

Promoter ID:

EPDNEW_R5872

Type:

multiple initiation site

Name:

Fbxo32_1

Description:

F-box protein 32

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	7	98,098,307 - 98,098,367	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620373	AgrOrtholog
BioCyc Gene	G2FUF-33323	BioCyc
Ensembl Genes	ENSRNOG00000006738	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000130982	ENTREZGENE
Gene3D-CATH	1.20.1280.50	UniProtKB/Swiss-Prot
InterPro	F-box-like_dom_sf	UniProtKB/Swiss-Prot
	FBX25/32	UniProtKB/Swiss-Prot
KEGG Report	rno:171043	UniProtKB/Swiss-Prot
NCBI Gene	171043	ENTREZGENE
PANTHER	F-BOX ONLY PROTEIN 32	UniProtKB/Swiss-Prot
	PTHR13123	UniProtKB/Swiss-Prot
PhenoGen	Fbxo32	PhenoGen
RatGTEx	ENSRNOG00000006738	RatGTEx
Superfamily-SCOP	SSF81383	UniProtKB/Swiss-Prot
UniProt	A6HRK0	ENTREZGENE, UniProtKB/TrEMBL
	FBX32_RAT	UniProtKB/Swiss-Prot
	G3V6Z4	ENTREZGENE, UniProtKB/TrEMBL
	Q91Z62	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-02-25	Fbxo32	F-box protein 32	Fbxo32	F-box only protein 32	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-02-26	Fbxo32	F-box only protein 32		f-box only protein 32	Symbol and Name status set to approved	625702	APPROVED
2002-08-07	Fbxo32	f-box only protein 32			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_disease	displays increased mRNA expression in denervation, immobilization, and hindlimb suspension models of muscle atrophy	633893

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD