Grm7 (glutamate metabotropic receptor 7)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Grm7 (glutamate metabotropic receptor 7) Rattus norvegicus

Analyze

Symbol:

Grm7

Name:

glutamate metabotropic receptor 7

RGD ID:

619857

Description:

Enables several functions, including PDZ domain binding activity; calmodulin binding activity; and glutamate binding activity. Involved in adenylate cyclase-inhibiting G protein-coupled glutamate receptor signaling pathway; negative regulation of glutamate secretion; and negative regulation of neuron apoptotic process. Located in several cellular components, including dendritic shaft; postsynaptic membrane; and rough endoplasmic reticulum. Part of protein-containing complex. Is active in GABA-ergic synapse; glutamatergic synapse; and presynaptic active zone membrane. Orthologous to human GRM7 (glutamate metabotropic receptor 7); PARTICIPATES IN glutamate signaling pathway; INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

glutamate receptor, metabotropic 7; metabotropic glutamate receptor 7; metabotropic glutamate receptor mGluR7; metabotropic glutamate receptor subtype 7b; mGluR7

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

Allele / Splice:

Grm7^em2Mcwi

Genetic Models:

SS-Grm7^em2Mcwi

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	4	143,730,862 - 144,613,230 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	143,731,259 - 144,612,344 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	149,120,940 - 150,010,094 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	4	144,901,718 - 145,790,918 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	4	143,529,922 - 144,417,702 (+)	NCBI	Rnor_WKY
Rnor_6.0	4	142,452,616 - 143,368,460 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	142,780,987 - 143,367,578 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	205,768,625 - 206,090,308 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Rnor_5.0	4	206,230,927 - 206,680,107 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	146,952,340 - 147,270,225 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	146,889,004 - 147,035,543 (-)	NCBI
Celera	4	132,321,261 - 133,197,545 (+)	NCBI		Celera
Cytogenetic Map	4	q41	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Atrioventricular Septal Defect 2 (ISO)

attention deficit hyperactivity disorder (ISO)

Developmental Disabilities (ISO)

epilepsy (ISO)

NEURODEVELOPMENTAL DISORDER WITH SEIZURES, HYPOTONIA, AND BRAIN IMAGING ABNORMALITIES (ISO)

Neurodevelopmental Disorders (ISO)

substance-related disorder (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17alpha-ethynylestradiol (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

3,4-methylenedioxymethamphetamine (ISO)

4,4'-sulfonyldiphenol (ISO)

aflatoxin B1 (ISO)

ammonium chloride (EXP)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

beta-naphthoflavone (EXP)

bisphenol A (EXP,ISO)

chlorpyrifos (EXP)

cocaine (EXP)

crocidolite asbestos (ISO)

Cuprizon (EXP)

diazinon (EXP)

dibutyl phthalate (EXP)

diclofenac (ISO)

Dicyclohexyl phthalate (EXP)

epoxiconazole (ISO)

ethanol (EXP,ISO)

fonofos (ISO)

linsidomine (EXP)

N,N-diethyl-m-toluamide (EXP)

N-methyl-4-phenylpyridinium (ISO)

N-nitrosodiethylamine (EXP)

parathion (ISO)

permethrin (EXP)

potassium dichromate (ISO)

resveratrol (ISO)

rotenone (EXP)

sodium arsenite (ISO)

taurine (ISO)

terbufos (ISO)

testosterone (ISO)

toluene (EXP)

triclosan (ISO)

valproic acid (EXP,ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adenylate cyclase-inhibiting G protein-coupled glutamate receptor signaling pathway (IDA,IEA,ISO)

adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway (ISO)

adult behavior (ISO)

associative learning (ISO)

axon development (IEA,ISO,ISS)

behavioral fear response (ISO)

calcium ion transmembrane transport (IEA)

chemical synaptic transmission (IEA,ISO)

conditioned taste aversion (ISO)

G protein-coupled glutamate receptor signaling pathway (IBA)

G protein-coupled receptor signaling pathway (IEA)

glycosylation (IEA,ISO)

learning or memory (TAS)

memory (ISO)

multicellular organismal response to stress (ISO)

negative regulation of glutamate secretion (IDA)

negative regulation of neuron apoptotic process (IDA)

nervous system process (ISO)

presynaptic modulation of chemical synaptic transmission (ISO)

regulation of synaptic transmission, glutamatergic (IBA)

regulation of synaptic vesicle exocytosis (ISO)

sensory perception of sound (IEA,ISO)

short-term memory (ISO)

transmission of nerve impulse (ISO)

Cellular Component

asymmetric synapse (IDA)

axon (IDA)

axon terminus (IDA)

cell cortex (IEA,ISO)

cell surface (IDA)

dendrite (IDA,IEA,ISO)

dendritic shaft (IDA)

GABA-ergic synapse (IDA)

glutamatergic synapse (IDA,ISO)

Golgi apparatus (IDA)

membrane (IDA,ISO)

neuronal cell body (IDA)

plasma membrane (IBA,IEA,ISO)

postsynaptic membrane (IDA)

presynapse (ISO)

presynaptic active zone (IDA)

presynaptic active zone membrane (IDA)

presynaptic membrane (IDA,ISO)

protein-containing complex (IDA)

receptor complex (IEA,ISO)

rough endoplasmic reticulum (IDA)

synapse (IDA,IEA)

terminal bouton (IDA)

Molecular Function

adenylate cyclase inhibiting G protein-coupled glutamate receptor activity (IBA,IDA)

adenylate cyclase inhibitor activity (IEA,ISO)

calcium channel regulator activity (ISO)

calcium ion binding (ISO)

calcium-dependent protein binding (IPI)

calmodulin binding (IPI)

G protein-coupled receptor activity (IEA)

glutamate binding (IDA,ISO)

glutamate receptor activity (ISO)

group III metabotropic glutamate receptor activity (IBA,IDA,IEA,ISO,TAS)

identical protein binding (IPI)

PDZ domain binding (IPI)

protein binding (IPI)

protein dimerization activity (IEA,ISO,ISS)

serine binding (IEA,ISO)

voltage-gated calcium channel activity (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

glutamate signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Immunocytochemical localization of group III metabotropic glutamate receptors in the hippocampus with subtype-specific antibodies.	Bradley SR, etal., J Neurosci. 1996 Mar 15;16(6):2044-56.
2.	Compartmental localization of a metabotropic glutamate receptor (mGluR7): two different active sites at a retinal synapse.	Brandstatter JH, etal., J Neurosci. 1996 Aug 1;16(15):4749-56.
3.	Group I metabotropic glutamate receptors bind to protein phosphatase 1C. Mapping and modeling of interacting sequences.	Croci C, etal., J Biol Chem. 2003 Dec 12;278(50):50682-90. Epub 2003 Sep 30.
4.	Enrichment of mGluR7a in the presynaptic active zones of GABAergic and non-GABAergic terminals on interneurons in the rat somatosensory cortex.	Dalezios Y, etal., Cereb Cortex 2002 Sep;12(9):961-74.
5.	PICK1 interacts with and regulates PKC phosphorylation of mGLUR7.	Dev KK, etal., J Neurosci. 2000 Oct 1;20(19):7252-7.
6.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
7.	Expression of metabotropic glutamate receptors in rat meningeal and brain microvasculature and choroid plexus.	Gillard SE, etal., J Comp Neurol 2003 Jun 30;461(3):317-32.
8.	The PDZ proteins PICK1, GRIP, and syntenin bind multiple glutamate receptor subtypes. Analysis of PDZ binding motifs.	Hirbec H, etal., J Biol Chem. 2002 May 3;277(18):15221-4. Epub 2002 Mar 12.
9.	Immunolocalization of metabotropic glutamate receptor 7 in the rat olfactory bulb.	Kinzie JM, etal., J Comp Neurol. 1997 Sep 1;385(3):372-84.
10.	Constitutive endocytosis of the metabotropic glutamate receptor mGluR7 is clathrin-independent.	Lavezzari G and Roche KW, Neuropharmacology. 2007 Jan;52(1):100-7. Epub 2006 Aug 7.
11.	Immunohistochemical localization of a metabotropic glutamate receptor, mGluR7, in ganglion neurons of the rat; with special reference to the presence in glutamatergic ganglion neurons.	Li JL, etal., Neurosci Lett. 1996 Feb 2;204(1-2):9-12.
12.	The inhibition of glutamate release by metabotropic glutamate receptor 7 affects both [Ca2+]c and cAMP: evidence for a strong reduction of Ca2+ entry in single nerve terminals.	Millan C, etal., J Biol Chem 2002 Apr 19;277(16):14092-101.
13.	Co-expression of metabotropic glutamate receptor 7 and N-type Ca(2+) channels in single cerebrocortical nerve terminals of adult rats.	Millan C, etal., J Biol Chem. 2003 Jun 27;278(26):23955-62. Epub 2003 Apr 11.
14.	Expression, purification, crystallization and preliminary X-ray analysis of the ligand-binding domain of metabotropic glutamate receptor 7.	Muto T, etal., Acta Crystallogr Sect F Struct Biol Cryst Commun. 2007 Jul 1;63(Pt 7):627-30. Epub 2007 Jun 29.
15.	Ca2+-dependent binding of calcium-binding protein 1 to presynaptic group III metabotropic glutamate receptors and blockage by phosphorylation of the receptors.	Nakajima Y Biochem Biophys Res Commun. 2011 Sep 9;412(4):602-5. doi: 10.1016/j.bbrc.2011.08.006. Epub 2011 Aug 10.
16.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
17.	Molecular characterization of a new metabotropic glutamate receptor mGluR7 coupled to inhibitory cyclic AMP signal transduction.	Okamoto N, etal., J Biol Chem 1994 Jan 14;269(2):1231-6.
18.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
19.	GOA pipeline	RGD automated data pipeline
20.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
21.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
22.	Cloning and expression of a new member of the L-2-amino-4-phosphonobutyric acid-sensitive class of metabotropic glutamate receptors.	Saugstad JA, etal., Mol Pharmacol 1994 Mar;45(3):367-72.
23.	Differential presynaptic localization of metabotropic glutamate receptor subtypes in the rat hippocampus.	Shigemoto R, etal., J Neurosci. 1997 Oct 1;17(19):7503-22.
24.	High level of mGluR7 in the presynaptic active zones of select populations of GABAergic terminals innervating interneurons in the rat hippocampus.	Somogyi P, etal., Eur J Neurosci. 2003 Jun;17(12):2503-20.
25.	Dissociation of protein kinase-mediated regulation of metabotropic glutamate receptor 7 (mGluR7) interactions with calmodulin and regulation of mGluR7 function.	Sorensen SD, etal., Mol Pharmacol. 2002 Jun;61(6):1303-12.
26.	Beta-arrestin1 and 2 differently modulate metabotropic glutamate receptor 7 signaling in rat developmental sevoflurane-induced neuronal apoptosis.	Wang WY, etal., Neuroscience. 2016 Jan 28;313:199-212. doi: 10.1016/j.neuroscience.2015.11.038. Epub 2015 Nov 24.

Additional References at PubMed

PMID:9144652	PMID:9473604	PMID:9630572	PMID:9875342	PMID:9920659	PMID:10488094	PMID:11122333	PMID:11584003	PMID:11698585	PMID:11943148	PMID:11953448	PMID:12065412
PMID:12814372	PMID:14622100	PMID:15313036	PMID:15494036	PMID:16204199	PMID:16775145	PMID:16987251	PMID:17167337	PMID:18599484	PMID:19047183	PMID:19154087	PMID:19374778
PMID:20375012	PMID:21288202	PMID:22287544	PMID:22479593	PMID:22617702	PMID:22781839	PMID:23085525	PMID:23382219	PMID:23612982	PMID:24399715	PMID:25881041	PMID:27296637
PMID:27488423	PMID:29505788	PMID:31627896	PMID:33500274

Genomics

Comparative Map Data

Grm7
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	4	143,730,862 - 144,613,230 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	143,731,259 - 144,612,344 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	149,120,940 - 150,010,094 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	4	144,901,718 - 145,790,918 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	4	143,529,922 - 144,417,702 (+)	NCBI	Rnor_WKY
Rnor_6.0	4	142,452,616 - 143,368,460 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	142,780,987 - 143,367,578 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	205,768,625 - 206,090,308 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Rnor_5.0	4	206,230,927 - 206,680,107 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	146,952,340 - 147,270,225 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	146,889,004 - 147,035,543 (-)	NCBI
Celera	4	132,321,261 - 133,197,545 (+)	NCBI		Celera
Cytogenetic Map	4	q41	NCBI

GRM7
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	6,861,115 - 7,741,533 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	3	6,770,001 - 7,741,533 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	3	6,902,802 - 7,783,220 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	6,877,927 - 7,758,217 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	3	6,840,354 - 7,720,749 (+)	NCBI		Celera
Cytogenetic Map	3	p26.1	NCBI
HuRef	3	6,836,943 - 7,718,334 (+)	NCBI		HuRef
CHM1_1	3	6,853,465 - 7,733,719 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	3	6,851,699 - 7,732,437 (+)	NCBI		T2T-CHM13v2.0

Grm7
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	110,622,304 - 111,544,191 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	110,622,542 - 111,544,191 (+)	Ensembl		GRCm39 Ensembl
GRCm38	6	110,645,349 - 111,567,230 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	110,645,581 - 111,567,230 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	110,595,592 - 111,517,224 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	110,611,375 - 111,533,007 (+)	NCBI		MGSCv36	mm8
Celera	6	112,489,164 - 113,410,129 (+)	NCBI		Celera
Cytogenetic Map	6	E3	NCBI

Grm7
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955421	5,724,797 - 6,542,475 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955421	5,723,662 - 6,542,557 (-)	NCBI	ChiLan1.0	ChiLan1.0

GRM7
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	3	6,907,165 - 7,934,655 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	6,907,180 - 7,933,536 (+)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	3	6,811,005 - 7,691,344 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

GRM7
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	10,230,568 - 11,058,693 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	10,230,557 - 11,058,703 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	10,264,476 - 11,098,444 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	10,260,908 - 11,089,193 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	10,261,498 - 11,089,124 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	9,981,742 - 10,808,873 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	10,328,873 - 11,156,987 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	10,300,259 - 11,134,699 (-)	NCBI		UU_Cfam_GSD_1.0

Grm7
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404942	12,994,552 - 13,751,982 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936602	5,110,995 - 5,488,555 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936602	5,111,406 - 5,488,506 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GRM7
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	63,318,171 - 64,203,173 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	63,318,002 - 64,203,982 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	70,580,925 - 71,026,770 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GRM7
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	22	42,901,451 - 43,779,815 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666041	122,794,490 - 123,682,715 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Grm7
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624773	18,089,300 - 19,109,716 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624773	18,088,942 - 19,110,838 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Grm7
5436 total Variants

miRNA Target Status

Confirmed Target Of

miRNA Gene	Mature miRNA	Method Name	Result Type	Data Type	Support Type	PMID
Mir34a	rno-miR-34a-5p	Mirtarbase	external_info	Western blot	Functional MTI	18704095

Predicted Target Of

	Summary Value
Count of predictions:	149
Count of miRNA genes:	111
Interacting mature miRNAs:	121
Transcripts:	ENSRNOT00000056570
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5214602	146446691	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	11320076	180699135	Rat
1358352	Srcrt3	Stress Responsive Cort QTL 3	2.29		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	38465774	146803430	Rat
1576305	Emca6	Estrogen-induced mammary cancer QTL 6	5.8		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	4	44463720	155883716	Rat
1354612	Foco1	Food consumption QTL 1	8.87		eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	4	44463908	148090542	Rat
1354660	Salc1	Saline consumption QTL 1	11.26		drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	4	44463908	148090542	Rat
2312567	Glom19	Glomerulus QTL 19	1.9	0.006	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	4	45456990	146803430	Rat
1298082	Stresp4	Stress response QTL 4			blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	50119848	146803430	Rat
70200	Alc18	Alcohol consumption QTL 18	9.2		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	4	56647873	149491524	Rat
738009	Sach4	Saccharine consumption QTL 4	4.9	0.000016	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	59948935	154902892	Rat
738016	Alc16	Alcohol consumption QTL 16	3.6	0.00015	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
738031	Alc14	Alcohol consumption QTL 14	7.6	0.00003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
631674	Iddm14	Insulin dependent diabetes mellitus QTL 14			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	4	64528739	157573521	Rat
70177	Xhs1	X-ray hypersensitivity QTL 1	25.1		intestine integrity trait (VT:0010554)	post-insult time to onset of moribundity (CMO:0001896)	4	82798864	152731274	Rat
1576316	Ept5	Estrogen-induced pituitary tumorigenesis QTL 5	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	4	83428419	177635233	Rat
1582232	Gluco25	Glucose level QTL 25	3.6	0.0023	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	85253748	148090731	Rat
12798523	Anxrr56	Anxiety related response QTL 56	2.83	0.05	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	85253748	150276390	Rat
1358202	Gluco11	Glucose level QTL 11	2.4	0.02	adipocyte glucose uptake trait (VT:0004185)	absolute change in adipocyte glucose uptake (CMO:0000873)	4	85379421	167139601	Rat
634335	Anxrr16	Anxiety related response QTL 16	7.22		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	93308457	167139447	Rat
61434	Cia3	Collagen induced arthritis QTL 3	4.8		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	103194656	148194656	Rat
2302049	Pia32	Pristane induced arthritis QTL 32	5.1	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112)	4	105789505	150789505	Rat
731165	Uae21	Urinary albumin excretion QTL 21	2.4	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	4	106649412	151649412	Rat
61406	Scwia1	Streptococcal cell wall induced arthritis QTL 1	2.3		joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	4	106805662	151805662	Rat
7207480	Bss105	Bone structure and strength QTL 105	8.1		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	4	109827074	154827074	Rat
1549832	Bss3	Bone structure and strength QTL 3	11		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	4	109827074	154827074	Rat
737821	Hcar9	Hepatocarcinoma resistance QTL 9	3.7		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	4	109866907	167139601	Rat
1331759	Hrtrt13	Heart rate QTL 13	3.54628		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	110275411	168266883	Rat
6478760	Anxrr45	Anxiety related response QTL 45		0.06717	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	110870972	155870972	Rat
6478763	Anxrr46	Anxiety related response QTL 46		0.07428	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	110870972	155870972	Rat
12798519	Anxrr54	Anxiety related response QTL 54	2.54	0.05	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	114627026	159627026	Rat
1300116	Hrtrt5	Heart rate QTL 5	3.76		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	116179486	151161268	Rat
724535	Cm18	Cardiac mass QTL 18	2.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	4	118856416	163856416	Rat
1331802	Srn5	Serum renin concentration QTL 5	3.045		renin activity (VT:0005581)	plasma renin activity level (CMO:0000116)	4	119428175	157578333	Rat
12798527	Anxrr58	Anxiety related response QTL 58	4.11	0.05	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	119463257	147278687	Rat
70201	Gcr1	Gastric cancer resistance QTL 1	2.7		stomach morphology trait (VT:0000470)	stomach tumor susceptibility score (CMO:0002043)	4	120260281	147278687	Rat
2293840	Kiddil9	Kidney dilation QTL 9	2.9		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	4	120926564	148090731	Rat
634347	Hcar8	Hepatocarcinoma resistance QTL 8	5.8		liver integrity trait (VT:0010547)	liver tumorous lesion area to total liver area ratio (CMO:0001075)	4	123143783	168143783	Rat
631683	Bp116	Blood pressure QTL 116		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	124303370	169303370	Rat
6478778	Anxrr51	Anxiety related response QTL 51		0.25384	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	4	124778595	169778595	Rat
7411558	Bw133	Body weight QTL 133	13.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	125590636	170590636	Rat
61451	Ciaa4	CIA Autoantibody QTL 4	3.1		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	4	126395976	167139601	Rat
737978	Pia23	Pristane induced arthritis QTL 23	5.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	131730738	167139601	Rat
631511	Pia7	Pristane induced arthritis QTL 7	4.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	131730738	167139601	Rat
1549827	Scl46	Serum cholesterol level QTL 46	3.5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	4	132396220	177396220	Rat
724558	Plsm2	Polydactyly-luxate syndrome (PLS) morphotypes QTL 2		0.0003	hindlimb integrity trait (VT:0010563)	hind foot phalanges count (CMO:0001949)	4	132422778	177422778	Rat
61422	Cia13	Collagen induced arthritis QTL 13	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	132642577	167139601	Rat
2303623	Vencon2	Ventilatory control QTL 2	3.8		respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	4	135204660	180204660	Rat
1578674	Bmd12	Bone mineral density QTL 12	3.8		femur mineral mass (VT:0010011)	cortical volumetric bone mineral density (CMO:0001730)	4	135699135	180699135	Rat
2293659	Bmd35	Bone mineral density QTL 35	4.5	0.0001	femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	4	137755016	181392681	Rat
61362	Oia2	Oil induced arthritis QTL 2		0.001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	138503169	173369699	Rat
1298524	Oia8	Oil induced arthritis QTL 8			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	138503169	173369699	Rat
1331738	Bp209	Blood pressure QTL 209	2.979		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	138503169	179293946	Rat

Markers in Region

D4Got234

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	144,208,084 - 144,208,275 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	142,957,340 - 142,957,530	NCBI	Rnor6.0
Rnor_5.0	4	206,270,616 - 206,270,806	UniSTS	Rnor5.0
RGSC_v3.4	4	146,613,244 - 146,613,434	UniSTS	RGSC3.4
Celera	4	132,792,861 - 132,793,051	UniSTS
Cytogenetic Map	4	q42	UniSTS

RH144597

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	144,525,486 - 144,525,662 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	143,281,069 - 143,281,244	NCBI	Rnor6.0
Rnor_5.0	4	206,593,740 - 206,593,915	UniSTS	Rnor5.0
RGSC_v3.4	4	147,181,968 - 147,182,143	UniSTS	RGSC3.4
Celera	4	133,112,650 - 133,112,825	UniSTS
RH 3.4 Map	4	950.8	UniSTS
Cytogenetic Map	4	q42	UniSTS

Genetic Models

This gene Grm7 is modified in the following models/strains

SS-Grm7^em2Mcwi

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium									42
Low			10	2		2			22	14	17
Below cutoff	2	11	10	8	2	8	5	5	2	9	16	6	5

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031040	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017592907	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017592908	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039108422	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039108423	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039108424	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC112018	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473957	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D16817	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000148	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U06832	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X96790	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000056570 ⟹ ENSRNOP00000053411

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	143,731,259 - 144,612,344 (+)	Ensembl
Rnor_6.0 Ensembl	4	142,780,987 - 143,367,578 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000056996 ⟹ ENSRNOP00000053829

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	143,731,259 - 144,551,904 (+)	Ensembl

RefSeq Acc Id:

NM_031040 ⟹ NP_112302

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	4	143,730,862 - 144,612,344 (+)	NCBI
Rnor_6.0	4	142,452,616 - 143,367,578 (+)	NCBI
Rnor_5.0	4	205,768,625 - 206,090,308 (+)	NCBI
Rnor_5.0	4	206,230,927 - 206,680,107 (+)	NCBI
RGSC_v3.4	4	146,952,340 - 147,270,225 (+)	RGD
Celera	4	132,321,261 - 133,197,545 (+)	RGD

Sequence:

show sequence

GGGGAGAGATGGATAGCAAGCAAGGGAGGGAGAGAGGGAGTGGGAGGAGGAGGAGGAGGAGAGG
GAGCCCAACGACCATTTAAAGCGATAGCAATCCCTGCCCTCTCCCCAGTGCTTGGCTGTTGGAG
AGCGCAAGAGGCAAGCCAGGGAACGGGGAGCGCAAGCTGGTGCGCCGGCCAGCGGAGCCACAGT
GCCAGGTGCCAAAGACTGGCTGACGCCCTGGGACACCCCCACCCTCTCCTGCTGCACCTCCTCG
GTCTCCTCCACCCTCTGTGCCTACAGAAGTCCCTGGGCTTCCCCCAAAGGAGCTCACCTCCAGA
AGCCCGGACCTGGGAGAGCCCACCAGCATACCCTCCAGCGCCGCCGCCGCCGCTACCGCAGCAG
CATCCGGAGCGGCATGGTCCAGCTGGGGAAGCTGCTCCGCGTCCTGACTTTGATGAAGTTCCCC
TGCTGCGTGCTGGAGGTGCTCCTGTGCGTGCTGGCGGCGGCGGCGCGCGGCCAGGAGATGTACG
CCCCGCACTCGATCCGGATCGAGGGGGACGTCACCCTTGGGGGGTTGTTCCCAGTGCACGCCAA
GGGTCCCAGCGGAGTGCCCTGCGGCGACATCAAGAGGGAGAATGGGATCCACAGGCTGGAAGCT
ATGCTTTATGCCCTGGACCAGATCAACAGCGATCCCAACCTGCTGCCCAATGTAACGTTAGGCG
CGCGGATCCTGGACACTTGTTCCAGGGACACTTATGCGCTCGAACAGTCGCTCACTTTCGTCCA
GGCGCTTATCCAGAAGGACACCTCCGACGTGCGTTGCACCAACGGAGAGCCCCCGGTTTTCGTC
AAGCCAGAGAAAGTAGTTGGAGTGATTGGGGCTTCGGGGAGCTCCGTCTCCATCATGGTAGCCA
ACATCTTGAGGCTTTTTCAGATCCCTCAGATTAGTTATGCATCCACGGCTCCTGAACTCAGTGA
TGACCGGCGCTATGACTTCTTCTCTCGAGTGGTCCCGCCTGATTCCTTCCAAGCCCAGGCGATG
GTTGACATTGTAAAGGCTTTGGGCTGGAATTACGTGTCTACTCTTGCATCTGAAGGAAGCTATG
GAGAGAAAGGTGTGGAGTCCTTCACACAGATTTCCAAAGAGGCAGGTGGGCTCTGCATTGCCCA
GTCCGTGAGAATCCCCCAAGAGCGCAAAGACAGGACCATTGACTTTGATAGAATTATCAAACAG
CTCTTGGACACTCCCAACTCCAGGGCCGTCGTGATTTTTGCCAACGATGAGGATATAAAGCAGA
TCCTTGCCGCCGCCAAAAGAGCTGACCAAGTAGGCCATTTTCTCTGGGTCGGGTCAGACAGCTG
GGGTTCCAAAATCAACCCACTGCATCAGCACGAAGATATTGCGGAAGGAGCCATAACAATCCAG
CCTAAAAGGGCAACCGTGGAAGGATTTGATGCTTACTTCACATCCCGGACACTTGAAAACAACA
GGAGAAATGTATGGTTTGCCGAATACTGGGAAGAAAACTTCAACTGCAAGTTGACAATTAGTGG
GTCCAAAAAAGAAGACACAGATCGCAAATGCACAGGACAGGAGCGAATTGGAAAAGACTCCAAT
TATGAGCAGGAAGGTAAAGTACAGTTTGTGATTGATGCTGTCTATGCCATGGCCCATGCTCTTC
ATCACATGAACAAGGATCTGTGTGCTGACTACCGCGGAGTGTGCCCAGAGATGGAGCAAGCAGG
CGGCAAGAAGTTGTTGAAGTATATCCGCCATGTTAACTTCAATGGTAGTGCTGGAACCCCAGTA
ATGTTTAACAAAAATGGCGATGCTCCAGGGCGTTATGACATCTTCCAATACCAGACAACAAACA
CAACCAACCCTGGTTATCGTCTCATTGGGCAGTGGACAGATGAACTTCAGCTCAATATAGAGGA
CATGCAGTGGGGCAAAGGAGTCCGAGAGATCCCATCCTCTGTGTGTACATTGCCATGCAAGCCT
GGGCAAAGGAAGAAGACACAGAAGGGAACGCCTTGCTGCTGGACCTGTGAGCCCTGTGATGGAT
ACCAGTATCAGTTTGATGAGATGACCTGTCAGCATTGTCCCTACGACCAGAGGCCCAATGAGAA
CCGAACTGGCTGTCAGAACATCCCAATCATCAAACTGGAGTGGCACTCCCCCTGGGCTGTCATT
CCTGTCTTCCTGGCAATGTTGGGGATCATTGCCACCATCTTTGTCATGGCAACTTTCATCCGCT
ACAATGACACACCCATTGTCAGGGCATCTGGGCGGGAACTCAGCTATGTTTTATTGACAGGCAT
CTTTCTCTGCTATATCATCACCTTCCTAATGATTGCCAAACCAGATGTGGCAGTGTGTTCTTTC
CGACGTGTCTTCTTGGGCTTGGGCATGTGTATTAGTTATGCTGCCCTTTTAACAAAGACCAATC
GGATTTATCGCATATTCGAGCAGGGCAAGAAATCGGTGACAGCTCCCAGACTCATAAGCCCAAC
GTCACAACTGGCGATCACTTCCAGTTTAATATCGGTGCAGCTTCTAGGTGTCTTCATTTGGTTT
GGGGTTGACCCCCCCAACATTATCATAGACTACGATGAGCATAAGACCATGAACCCAGAACAAG
CAAGGGGTGTTCTCAAATGTGACATCACAGACCTTCAAATCATTTGTTCCCTGGGATATAGCAT
TCTTCTCATGGTCACATGTACTGTGTATGCCATCAAGACTCGGGGCGTACCAGAGAATTTTAAT
GAAGCCAAGCCCATTGGGTTCACTATGTACACGACGTGTATCGTATGGCTTGCCTTCATCCCAA
TATTTTTTGGCACAGCGCAGTCAGCAGAAAAGCTCTACATACAAACTACCACGCTTACAATCTC
CATGAACCTAAGTGCGTCAGTGGCGCTGGGAATGCTATACATGCCGAAAGTGTACATCATCATT
TTCCACCCTGAACTCAATGTCCAGAAACGGAAGCGAAGCTTCAAGGCCGTAGTCACAGCAGCCA
CCATGTCATCAAGGCTGTCACACAAACCCAGTGACAGGCCCAACGGTGAGGCAAAGACAGAACT
CTGTGAAAATGTAGACCCAAACAGCCCTGCTGCAAAAAAGAAGTATGTCAGTTATAATAACCTG
GTTATCTAACCTGTTCCATGCCATGGAGCCACAGAGGAGGAAGACCTTCAGTTATTCTGTCACC
CAGCCTGGCATTGGACTCTTGGTCCTGCCCGCTTCCTATCTCTGGAGGAGCTTCTCCACCCGGG
AGAGCAATGTTAGAGGATCCACACATCCTGAACAGCTGCTTTATGAGACACCTTTACTTTATCT
TGGCTTAAGAAGTCATTGGCATCAGCACTGCCATCTTGGCTGTAATTCTGGACTCCCTAAGCAA
AGGGAGAGTTGAGACTCAAGTCCCA

hide sequence

RefSeq Acc Id:

XM_039108422 ⟹ XP_038964350

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	4	143,730,899 - 144,612,326 (+)	NCBI

RefSeq Acc Id:

XM_039108423 ⟹ XP_038964351

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	4	143,730,899 - 144,551,956 (+)	NCBI

RefSeq Acc Id:

XM_039108424 ⟹ XP_038964352

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	4	143,730,898 - 144,613,230 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_112302	(Get FASTA)	NCBI Sequence Viewer
	XP_038964350	(Get FASTA)	NCBI Sequence Viewer
	XP_038964351	(Get FASTA)	NCBI Sequence Viewer
	XP_038964352	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA20655	(Get FASTA)	NCBI Sequence Viewer
	BAA04092	(Get FASTA)	NCBI Sequence Viewer
	CAA65584	(Get FASTA)	NCBI Sequence Viewer
	EDL91488	(Get FASTA)	NCBI Sequence Viewer
	EDL91489	(Get FASTA)	NCBI Sequence Viewer
	P35400	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_112302 ⟸ NM_031040
- Peptide Label:	precursor
- UniProtKB:	P35400 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MVQLGKLLRVLTLMKFPCCVLEVLLCVLAAAARGQEMYAPHSIRIEGDVTLGGLFPVHAKGPSG VPCGDIKRENGIHRLEAMLYALDQINSDPNLLPNVTLGARILDTCSRDTYALEQSLTFVQALIQ KDTSDVRCTNGEPPVFVKPEKVVGVIGASGSSVSIMVANILRLFQIPQISYASTAPELSDDRRY DFFSRVVPPDSFQAQAMVDIVKALGWNYVSTLASEGSYGEKGVESFTQISKEAGGLCIAQSVRI PQERKDRTIDFDRIIKQLLDTPNSRAVVIFANDEDIKQILAAAKRADQVGHFLWVGSDSWGSKI NPLHQHEDIAEGAITIQPKRATVEGFDAYFTSRTLENNRRNVWFAEYWEENFNCKLTISGSKKE DTDRKCTGQERIGKDSNYEQEGKVQFVIDAVYAMAHALHHMNKDLCADYRGVCPEMEQAGGKKL LKYIRHVNFNGSAGTPVMFNKNGDAPGRYDIFQYQTTNTTNPGYRLIGQWTDELQLNIEDMQWG KGVREIPSSVCTLPCKPGQRKKTQKGTPCCWTCEPCDGYQYQFDEMTCQHCPYDQRPNENRTGC QNIPIIKLEWHSPWAVIPVFLAMLGIIATIFVMATFIRYNDTPIVRASGRELSYVLLTGIFLCY IITFLMIAKPDVAVCSFRRVFLGLGMCISYAALLTKTNRIYRIFEQGKKSVTAPRLISPTSQLA ITSSLISVQLLGVFIWFGVDPPNIIIDYDEHKTMNPEQARGVLKCDITDLQIICSLGYSILLMV TCTVYAIKTRGVPENFNEAKPIGFTMYTTCIVWLAFIPIFFGTAQSAEKLYIQTTTLTISMNLS ASVALGMLYMPKVYIIIFHPELNVQKRKRSFKAVVTAATMSSRLSHKPSDRPNGEAKTELCENV DPNSPAAKKKYVSYNNLVI hide sequence

RefSeq Acc Id:

ENSRNOP00000053411 ⟸ ENSRNOT00000056570

RefSeq Acc Id:	XP_038964352 ⟸ XM_039108424
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_038964350 ⟸ XM_039108422
- Peptide Label:	isoform X1
- UniProtKB:	F1LWV8 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038964351 ⟸ XM_039108423
- Peptide Label:	isoform X1
- UniProtKB:	F1LWV8 (UniProtKB/TrEMBL)

RefSeq Acc Id:

ENSRNOP00000053829 ⟸ ENSRNOT00000056996

Protein Domains

G_PROTEIN_RECEP_F3_4

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P35400-F1-model_v2	AlphaFold	P35400	1-915	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:619857	AgrOrtholog
BioCyc Gene	G2FUF-43431	BioCyc
Ensembl Genes	ENSRNOG00000005662	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000053411	ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSRNOP00000053829	ENTREZGENE
	ENSRNOP00000053829.5	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000056570	ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSRNOT00000056996	ENTREZGENE
	ENSRNOT00000056996.5	UniProtKB/TrEMBL
Gene3D-CATH	2.10.50.30	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	ANF_lig-bd_rcpt	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCR_3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCR_3_9-Cys_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCR_3_9-Cys_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCR_3_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCR_3_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCR_3_mtglu_rcpt	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCR_3_mtglu_rcpt_7	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Peripla_BP_I	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:81672	UniProtKB/Swiss-Prot
NCBI Gene	81672	ENTREZGENE
Pfam	7tm_3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ANF_receptor	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NCD3G	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Grm7	PhenoGen
PRINTS	GPCRMGR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	MTABOTROPC7R	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	MTABOTROPICR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F3_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	G_PROTEIN_RECEP_F3_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	G_PROTEIN_RECEP_F3_3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	G_PROTEIN_RECEP_F3_4	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF53822	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	F1LWV8	ENTREZGENE, UniProtKB/TrEMBL
	F1LZS5_RAT	UniProtKB/TrEMBL
	GRM7_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-09-10	Grm7	glutamate receptor, metabotropic 7		metabotropic glutamate receptor mGluR7	Name updated	1299863	APPROVED
2002-08-07	Grm7	metabotropic glutamate receptor mGluR7			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)