Symbol:
Grm7
Name:
glutamate metabotropic receptor 7
RGD ID:
619857
Description:
Enables several functions, including PDZ domain binding activity; calmodulin binding activity; and glutamate binding activity. Involved in adenylate cyclase-inhibiting G protein-coupled glutamate receptor signaling pathway; negative regulation of glutamate secretion; and negative regulation of neuron apoptotic process. Located in several cellular components, including dendritic shaft; postsynaptic membrane; and presynaptic active zone. Part of protein-containing complex. Is active in GABA-ergic synapse; glutamatergic synapse; and presynaptic active zone membrane. Orthologous to human GRM7 (glutamate metabotropic receptor 7); PARTICIPATES IN glutamate signaling pathway; INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
glutamate receptor, metabotropic 7; metabotropic glutamate receptor 7; metabotropic glutamate receptor mGluR7; metabotropic glutamate receptor subtype 7b; mGluR7
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
GRM7 (glutamate metabotropic receptor 7) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):
Grm7 (glutamate receptor, metabotropic 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Grm7 (glutamate metabotropic receptor 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
GRM7 (glutamate metabotropic receptor 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
GRM7 (glutamate metabotropic receptor 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Grm7 (glutamate metabotropic receptor 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
GRM7 (glutamate metabotropic receptor 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
GRM7 (glutamate metabotropic receptor 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Grm7 (glutamate metabotropic receptor 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
GRM8 (glutamate metabotropic receptor 8) HGNC
EggNOG, OrthoDB
Homo sapiens (human):
GRM4 (glutamate metabotropic receptor 4) HGNC
OrthoDB
Alliance orthologs 3
Mus musculus (house mouse):
Grm7 (glutamate receptor, metabotropic 7)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
GRM7 (glutamate metabotropic receptor 7)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
mgl-3
Alliance
DIOPT (Ensembl Compara|OMA|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
grm7
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Allele / Splice:
Grm7em2Mcwi
Genetic Models:
SS-Grm7em2Mcwi
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 145,286,714 - 146,169,099 (+) NCBI GRCr8 mRatBN7.2 4 143,730,862 - 144,613,230 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 143,731,259 - 144,612,344 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 149,120,940 - 150,010,094 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 144,901,718 - 145,790,918 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 143,529,922 - 144,417,702 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 142,452,616 - 143,368,460 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 142,780,987 - 143,367,578 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 205,768,625 - 206,090,308 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Rnor_5.0 4 206,230,927 - 206,680,107 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 146,952,340 - 147,270,225 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 146,889,004 - 147,035,543 (-) NCBI Celera 4 132,321,261 - 133,197,545 (+) NCBI Celera Cytogenetic Map 4 q41 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Grm7 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of GRM7 mRNA CTD PMID:29097150 Grm7 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of GRM7 mRNA CTD PMID:32109520 Grm7 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Grm7 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of GRM7 mRNA CTD PMID:31961203 Grm7 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Grm7 Rat 2-palmitoylglycerol increases expression ISO GRM7 (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of GRM7 mRNA CTD PMID:37199045 Grm7 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Grm7 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of GRM7 mRNA CTD PMID:20188158 Grm7 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Grm7 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of GRM7 mRNA CTD PMID:20188158 Grm7 Rat 4,4'-sulfonyldiphenol increases expression ISO Grm7 (Mus musculus) 6480464 bisphenol S results in increased expression of GRM7 mRNA CTD PMID:30951980 Grm7 Rat aflatoxin B1 decreases methylation ISO GRM7 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of GRM7 gene CTD PMID:27153756 Grm7 Rat all-trans-retinoic acid multiple interactions ISO Grm7 (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of GRM7 mRNA CTD PMID:36189433 Grm7 Rat all-trans-retinoic acid decreases expression ISO Grm7 (Mus musculus) 6480464 Tretinoin results in decreased expression of GRM7 mRNA CTD PMID:36189433 Grm7 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of GRM7 mRNA CTD PMID:16483693 Grm7 Rat arsenite(3-) increases methylation ISO GRM7 (Homo sapiens) 6480464 arsenite results in increased methylation of GRM7 promoter CTD PMID:23974009 Grm7 Rat benzo[a]pyrene affects methylation ISO GRM7 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of GRM7 intron and Benzo(a)pyrene affects the methylation of GRM7 promoter CTD PMID:27901495 and PMID:30157460 Grm7 Rat benzo[a]pyrene decreases methylation ISO GRM7 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of GRM7 3' UTR CTD PMID:27901495 Grm7 Rat beta-naphthoflavone multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in decreased expression of GRM7 mRNA CTD PMID:18164116 Grm7 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Grm7 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of GRM7 mRNA CTD PMID:34319233 Grm7 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of GRM7 mRNA CTD PMID:25181051 more ... Grm7 Rat bisphenol A decreases expression ISO Grm7 (Mus musculus) 6480464 bisphenol A results in decreased expression of GRM7 mRNA CTD PMID:32156529 Grm7 Rat bisphenol A decreases methylation ISO GRM7 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of GRM7 gene CTD PMID:31601247 Grm7 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of GRM7 mRNA CTD PMID:29097150 Grm7 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of GRM7 gene CTD PMID:28505145 Grm7 Rat bisphenol A increases methylation ISO Grm7 (Mus musculus) 6480464 bisphenol A results in increased methylation of GRM7 promoter CTD PMID:27312807 Grm7 Rat chlorpyrifos increases expression EXP 6480464 Chlorpyrifos results in increased expression of GRM7 mRNA CTD PMID:17452286 Grm7 Rat cocaine increases expression EXP 6480464 Cocaine results in increased expression of GRM7 mRNA CTD PMID:16076954 Grm7 Rat crocidolite asbestos affects expression ISO GRM7 (Homo sapiens) 6480464 Asbestos and Crocidolite affects the expression of GRM7 mRNA CTD PMID:17331233 Grm7 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of GRM7 mRNA CTD PMID:26577399 Grm7 Rat diazinon increases expression EXP 6480464 Diazinon results in increased expression of GRM7 mRNA CTD PMID:17452286 Grm7 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of GRM7 mRNA CTD PMID:15620428 Grm7 Rat diclofenac increases expression ISO Grm7 (Mus musculus) 6480464 Diclofenac results in increased expression of GRM7 mRNA CTD PMID:26934552 Grm7 Rat Dicyclohexyl phthalate increases expression EXP 6480464 dicyclohexyl phthalate results in increased expression of GRM7 mRNA CTD PMID:15620428 Grm7 Rat epoxiconazole increases expression ISO Grm7 (Mus musculus) 6480464 epoxiconazole results in increased expression of GRM7 mRNA CTD PMID:35436446 Grm7 Rat ethanol increases expression EXP 6480464 Ethanol results in increased expression of GRM7 mRNA CTD PMID:20655511 Grm7 Rat ethanol affects splicing ISO Grm7 (Mus musculus) 6480464 Ethanol affects the splicing of GRM7 mRNA CTD PMID:30319688 Grm7 Rat fonofos increases methylation ISO GRM7 (Homo sapiens) 6480464 Fonofos results in increased methylation of GRM7 promoter CTD PMID:22847954 Grm7 Rat linsidomine increases oxidation EXP 6480464 linsidomine results in increased oxidation of GRM7 protein CTD PMID:28086193 Grm7 Rat mono(2-ethylhexyl) phthalate decreases expression ISO Grm7 (Mus musculus) 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of GRM7 mRNA CTD PMID:36189433 Grm7 Rat mono(2-ethylhexyl) phthalate multiple interactions ISO Grm7 (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of GRM7 mRNA CTD PMID:36189433 Grm7 Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of GRM7 gene CTD PMID:33148267 Grm7 Rat N-methyl-4-phenylpyridinium affects expression ISO GRM7 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium affects the expression of GRM7 mRNA CTD PMID:12710931 Grm7 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in decreased expression of GRM7 mRNA CTD PMID:18164116 Grm7 Rat parathion increases methylation ISO GRM7 (Homo sapiens) 6480464 Parathion results in increased methylation of GRM7 promoter CTD PMID:22847954 Grm7 Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of GRM7 gene CTD PMID:33148267 Grm7 Rat potassium dichromate decreases expression ISO Grm7 (Mus musculus) 6480464 Potassium Dichromate results in decreased expression of GRM7 mRNA CTD PMID:23608068 Grm7 Rat resveratrol multiple interactions ISO GRM7 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of GRM7 mRNA CTD PMID:23557933 Grm7 Rat rotenone decreases response to substance EXP 6480464 GRM7 protein results in decreased susceptibility to Rotenone CTD PMID:16624952 Grm7 Rat sodium arsenite increases methylation ISO Grm7 (Mus musculus) 6480464 sodium arsenite results in increased methylation of GRM7 gene CTD PMID:24118411 Grm7 Rat taurine decreases expression ISO GRM7 (Homo sapiens) 6480464 Taurine results in decreased expression of GRM7 mRNA CTD PMID:16579726 Grm7 Rat terbufos increases methylation ISO GRM7 (Homo sapiens) 6480464 terbufos results in increased methylation of GRM7 promoter CTD PMID:22847954 Grm7 Rat testosterone increases expression ISO GRM7 (Homo sapiens) 6480464 Testosterone results in increased expression of GRM7 mRNA CTD PMID:33359661 Grm7 Rat titanium dioxide decreases methylation ISO Grm7 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of GRM7 gene CTD PMID:35295148 Grm7 Rat toluene affects expression EXP 6480464 Toluene affects the expression of GRM7 mRNA CTD PMID:21827849 Grm7 Rat triclosan increases expression ISO GRM7 (Homo sapiens) 6480464 Triclosan results in increased expression of GRM7 mRNA CTD PMID:30510588 Grm7 Rat valproic acid affects expression ISO Grm7 (Mus musculus) 6480464 Valproic Acid affects the expression of GRM7 mRNA CTD PMID:17963808 Grm7 Rat valproic acid decreases methylation ISO GRM7 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of GRM7 gene CTD PMID:29154799 Grm7 Rat valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of GRM7 mRNA CTD PMID:32428529 Grm7 Rat valproic acid affects splicing EXP 6480464 Valproic Acid affects the splicing of GRM7 mRNA CTD PMID:29427782
Imported Annotations - KEGG (archival)
17alpha-ethynylestradiol (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2-palmitoylglycerol (ISO) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-sulfonyldiphenol (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP) arsenite(3-) (ISO) benzo[a]pyrene (ISO) beta-naphthoflavone (EXP) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) chlorpyrifos (EXP) cocaine (EXP) crocidolite asbestos (ISO) Cuprizon (EXP) diazinon (EXP) dibutyl phthalate (EXP) diclofenac (ISO) Dicyclohexyl phthalate (EXP) epoxiconazole (ISO) ethanol (EXP,ISO) fonofos (ISO) linsidomine (EXP) mono(2-ethylhexyl) phthalate (ISO) N,N-diethyl-m-toluamide (EXP) N-methyl-4-phenylpyridinium (ISO) N-nitrosodiethylamine (EXP) parathion (ISO) permethrin (EXP) potassium dichromate (ISO) resveratrol (ISO) rotenone (EXP) sodium arsenite (ISO) taurine (ISO) terbufos (ISO) testosterone (ISO) titanium dioxide (ISO) toluene (EXP) triclosan (ISO) valproic acid (EXP,ISO)
1.
Subsynaptic mobility of presynaptic mGluR types is differentially regulated by intra- and extracellular interactions.
Bodzęta A, etal., Mol Biol Cell. 2022 Jul 1;33(8):ar66. doi: 10.1091/mbc.E21-10-0484. Epub 2022 May 5.
2.
Immunocytochemical localization of group III metabotropic glutamate receptors in the hippocampus with subtype-specific antibodies.
Bradley SR, etal., J Neurosci. 1996 Mar 15;16(6):2044-56.
3.
Compartmental localization of a metabotropic glutamate receptor (mGluR7): two different active sites at a retinal synapse.
Brandstatter JH, etal., J Neurosci. 1996 Aug 1;16(15):4749-56.
4.
Group I metabotropic glutamate receptors bind to protein phosphatase 1C. Mapping and modeling of interacting sequences.
Croci C, etal., J Biol Chem. 2003 Dec 12;278(50):50682-90. Epub 2003 Sep 30.
5.
Enrichment of mGluR7a in the presynaptic active zones of GABAergic and non-GABAergic terminals on interneurons in the rat somatosensory cortex.
Dalezios Y, etal., Cereb Cortex 2002 Sep;12(9):961-74.
6.
PICK1 interacts with and regulates PKC phosphorylation of mGLUR7.
Dev KK, etal., J Neurosci. 2000 Oct 1;20(19):7252-7.
7.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
8.
Expression of metabotropic glutamate receptors in rat meningeal and brain microvasculature and choroid plexus.
Gillard SE, etal., J Comp Neurol 2003 Jun 30;461(3):317-32.
9.
The PDZ proteins PICK1, GRIP, and syntenin bind multiple glutamate receptor subtypes. Analysis of PDZ binding motifs.
Hirbec H, etal., J Biol Chem. 2002 May 3;277(18):15221-4. Epub 2002 Mar 12.
10.
Immunolocalization of metabotropic glutamate receptor 7 in the rat olfactory bulb.
Kinzie JM, etal., J Comp Neurol. 1997 Sep 1;385(3):372-84.
11.
Constitutive endocytosis of the metabotropic glutamate receptor mGluR7 is clathrin-independent.
Lavezzari G and Roche KW, Neuropharmacology. 2007 Jan;52(1):100-7. Epub 2006 Aug 7.
12.
Immunohistochemical localization of a metabotropic glutamate receptor, mGluR7, in ganglion neurons of the rat; with special reference to the presence in glutamatergic ganglion neurons.
Li JL, etal., Neurosci Lett. 1996 Feb 2;204(1-2):9-12.
13.
The inhibition of glutamate release by metabotropic glutamate receptor 7 affects both [Ca2+]c and cAMP: evidence for a strong reduction of Ca2+ entry in single nerve terminals.
Millan C, etal., J Biol Chem 2002 Apr 19;277(16):14092-101.
14.
Co-expression of metabotropic glutamate receptor 7 and N-type Ca(2+) channels in single cerebrocortical nerve terminals of adult rats.
Millan C, etal., J Biol Chem. 2003 Jun 27;278(26):23955-62. Epub 2003 Apr 11.
15.
Expression, purification, crystallization and preliminary X-ray analysis of the ligand-binding domain of metabotropic glutamate receptor 7.
Muto T, etal., Acta Crystallogr Sect F Struct Biol Cryst Commun. 2007 Jul 1;63(Pt 7):627-30. Epub 2007 Jun 29.
16.
Ca2+-dependent binding of calcium-binding protein 1 to presynaptic group III metabotropic glutamate receptors and blockage by phosphorylation of the receptors.
Nakajima Y Biochem Biophys Res Commun. 2011 Sep 9;412(4):602-5. doi: 10.1016/j.bbrc.2011.08.006. Epub 2011 Aug 10.
17.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
18.
Molecular characterization of a new metabotropic glutamate receptor mGluR7 coupled to inhibitory cyclic AMP signal transduction.
Okamoto N, etal., J Biol Chem 1994 Jan 14;269(2):1231-6.
19.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
20.
GOA pipeline
RGD automated data pipeline
21.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
22.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
23.
Cloning and expression of a new member of the L-2-amino-4-phosphonobutyric acid-sensitive class of metabotropic glutamate receptors.
Saugstad JA, etal., Mol Pharmacol 1994 Mar;45(3):367-72.
24.
Differential presynaptic localization of metabotropic glutamate receptor subtypes in the rat hippocampus.
Shigemoto R, etal., J Neurosci. 1997 Oct 1;17(19):7503-22.
25.
High level of mGluR7 in the presynaptic active zones of select populations of GABAergic terminals innervating interneurons in the rat hippocampus.
Somogyi P, etal., Eur J Neurosci. 2003 Jun;17(12):2503-20.
26.
Dissociation of protein kinase-mediated regulation of metabotropic glutamate receptor 7 (mGluR7) interactions with calmodulin and regulation of mGluR7 function.
Sorensen SD, etal., Mol Pharmacol. 2002 Jun;61(6):1303-12.
27.
Beta-arrestin1 and 2 differently modulate metabotropic glutamate receptor 7 signaling in rat developmental sevoflurane-induced neuronal apoptosis.
Wang WY, etal., Neuroscience. 2016 Jan 28;313:199-212. doi: 10.1016/j.neuroscience.2015.11.038. Epub 2015 Nov 24.
Grm7 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 145,286,714 - 146,169,099 (+) NCBI GRCr8 mRatBN7.2 4 143,730,862 - 144,613,230 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 143,731,259 - 144,612,344 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 149,120,940 - 150,010,094 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 144,901,718 - 145,790,918 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 143,529,922 - 144,417,702 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 142,452,616 - 143,368,460 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 142,780,987 - 143,367,578 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 205,768,625 - 206,090,308 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Rnor_5.0 4 206,230,927 - 206,680,107 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 146,952,340 - 147,270,225 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 146,889,004 - 147,035,543 (-) NCBI Celera 4 132,321,261 - 133,197,545 (+) NCBI Celera Cytogenetic Map 4 q41 NCBI
GRM7 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 6,861,115 - 7,741,533 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 6,770,001 - 7,741,533 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 6,902,802 - 7,783,220 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 6,877,927 - 7,758,217 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 3 6,840,354 - 7,720,749 (+) NCBI Celera Cytogenetic Map 3 p26.1 NCBI HuRef 3 6,836,943 - 7,718,334 (+) NCBI HuRef CHM1_1 3 6,853,465 - 7,733,719 (+) NCBI CHM1_1 T2T-CHM13v2.0 3 6,851,699 - 7,732,437 (+) NCBI T2T-CHM13v2.0
Grm7 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 110,622,304 - 111,544,191 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 110,622,542 - 111,544,191 (+) Ensembl GRCm39 Ensembl GRCm38 6 110,645,349 - 111,567,230 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 110,645,581 - 111,567,230 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 110,595,592 - 111,517,224 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 110,611,375 - 111,533,007 (+) NCBI MGSCv36 mm8 Celera 6 112,489,164 - 113,410,129 (+) NCBI Celera Cytogenetic Map 6 E3 NCBI cM Map 6 51.19 NCBI
Grm7 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955421 5,724,797 - 6,542,475 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955421 5,723,662 - 6,542,557 (-) NCBI ChiLan1.0 ChiLan1.0
GRM7 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 6,869,865 - 7,750,342 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 6,874,635 - 7,755,095 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 6,811,005 - 7,691,344 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 6,907,165 - 7,934,655 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 6,907,180 - 7,933,536 (+) Ensembl panpan1.1 panPan2
GRM7 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 10,230,568 - 11,058,693 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 10,230,557 - 11,058,703 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 10,264,476 - 11,098,444 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 10,260,908 - 11,089,193 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 10,261,498 - 11,089,124 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 9,981,742 - 10,808,873 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 10,328,873 - 11,156,987 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 10,300,259 - 11,134,699 (-) NCBI UU_Cfam_GSD_1.0
Grm7 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404942 12,994,552 - 13,751,982 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936602 5,110,995 - 5,488,555 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936602 5,111,406 - 5,488,506 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
GRM7 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 63,318,171 - 64,203,173 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 63,318,002 - 64,203,982 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 70,580,925 - 71,026,770 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
GRM7
Grm7
.
Confirmed Target Of
Mir34a rno-miR-34a-5p Mirtarbase external_info Western blot Functional MTI 18704095
Predicted Target Of
Count of predictions: 149 Count of miRNA genes: 111 Interacting mature miRNAs: 121 Transcripts: ENSRNOT00000056570 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1582232 Gluco25 Glucose level QTL 25 3.6 0.0023 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 85253748 148090731 Rat 1358352 Srcrt3 Stress Responsive Cort QTL 3 2.29 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 38465774 146803430 Rat 1300116 Hrtrt5 Heart rate QTL 5 3.76 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 116179486 151161268 Rat 10755501 Bp390 Blood pressure QTL 390 2.5 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 4 26775591 168368347 Rat 631683 Bp116 Blood pressure QTL 116 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 124303370 169303370 Rat 61451 Ciaa4 CIA Autoantibody QTL 4 3.1 blood autoantibody amount (VT:0003725) calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281) 4 126395976 167139601 Rat 1331738 Bp209 Blood pressure QTL 209 2.979 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 138503169 179293946 Rat 1549827 Scl46 Serum cholesterol level QTL 46 3.5 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 4 132396220 177396220 Rat 731165 Uae21 Urinary albumin excretion QTL 21 2.4 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 4 106649412 151649412 Rat 737821 Hcar9 Hepatocarcinoma resistance QTL 9 3.7 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 4 109866907 167139601 Rat 7411558 Bw133 Body weight QTL 133 13.84 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 4 125590636 170590636 Rat 1549832 Bss3 Bone structure and strength QTL 3 11 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 4 109827074 154827074 Rat 70177 Xhs1 X-ray hypersensitivity QTL 1 25.1 intestine integrity trait (VT:0010554) post-insult time to onset of moribundity (CMO:0001896) 4 82798864 152731274 Rat 2303623 Vencon2 Ventilatory control QTL 2 3.8 respiration trait (VT:0001943) minute ventilation (CMO:0000132) 4 135204660 180204660 Rat 1578674 Bmd12 Bone mineral density QTL 12 3.8 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 4 135699135 180699135 Rat 1354660 Salc1 Saline consumption QTL 1 11.26 drinking behavior trait (VT:0001422) saline drink intake rate (CMO:0001627) 4 44463908 148090542 Rat 1298082 Stresp4 Stress response QTL 4 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 50119848 146803430 Rat 737978 Pia23 Pristane induced arthritis QTL 23 5.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 131730738 167139601 Rat 61362 Oia2 Oil induced arthritis QTL 2 0.001 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 138503169 173369699 Rat 70201 Gcr1 Gastric cancer resistance QTL 1 2.7 stomach morphology trait (VT:0000470) stomach tumor susceptibility score (CMO:0002043) 4 120260281 147278687 Rat 70200 Alc18 Alcohol consumption QTL 18 9.2 drinking behavior trait (VT:0001422) ethanol intake volume to total fluid intake volume ratio (CMO:0001591) 4 56647873 149491524 Rat 2293659 Bmd35 Bone mineral density QTL 35 4.5 0.0001 femur strength trait (VT:0010010) femoral neck ultimate force (CMO:0001703) 4 137755016 181392681 Rat 1331759 Hrtrt13 Heart rate QTL 13 3.54628 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 110275411 168266883 Rat 724535 Cm18 Cardiac mass QTL 18 2.6 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 4 118856416 163856416 Rat 2316958 Gluco58 Glucose level QTL 58 10 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 11320076 180699135 Rat 2302049 Pia32 Pristane induced arthritis QTL 32 5.1 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112) 4 105789505 150789505 Rat 724558 Plsm2 Polydactyly-luxate syndrome (PLS) morphotypes QTL 2 0.0003 hindlimb integrity trait (VT:0010563) hind foot phalanges count (CMO:0001949) 4 132422778 177422778 Rat 6478763 Anxrr46 Anxiety related response QTL 46 0.07428 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 110870972 155870972 Rat 6478760 Anxrr45 Anxiety related response QTL 45 0.06717 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 110870972 155870972 Rat 1331802 Srn5 Serum renin concentration QTL 5 3.045 renin activity (VT:0005581) plasma renin activity level (CMO:0000116) 4 119428175 157578333 Rat 1298524 Oia8 Oil induced arthritis QTL 8 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 138503169 173369699 Rat 738009 Sach4 Saccharine consumption QTL 4 4.9 0.000016 consumption behavior trait (VT:0002069) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 4 59948935 154902892 Rat 2312567 Glom19 Glomerulus QTL 19 1.9 0.006 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 4 45456990 146803430 Rat 7207480 Bss105 Bone structure and strength QTL 105 8.1 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 4 109827074 154827074 Rat 634335 Anxrr16 Anxiety related response QTL 16 7.22 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 4 93308457 167139447 Rat 6478778 Anxrr51 Anxiety related response QTL 51 0.25384 locomotor behavior trait (VT:0001392) measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957) 4 124778595 169778595 Rat 61406 Scwia1 Streptococcal cell wall induced arthritis QTL 1 2.3 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 4 106805662 151805662 Rat 631511 Pia7 Pristane induced arthritis QTL 7 4.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 131730738 167139601 Rat 1354612 Foco1 Food consumption QTL 1 8.87 eating behavior trait (VT:0001431) food intake rate (CMO:0000427) 4 44463908 148090542 Rat 634347 Hcar8 Hepatocarcinoma resistance QTL 8 5.8 liver integrity trait (VT:0010547) liver tumorous lesion area to total liver area ratio (CMO:0001075) 4 123143783 168143783 Rat 2303168 Bp330 Blood pressure QTL 330 4.25 0.017 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 5214602 146446691 Rat 738031 Alc14 Alcohol consumption QTL 14 7.6 0.00003 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1576316 Ept5 Estrogen-induced pituitary tumorigenesis QTL 5 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 4 83428419 177635233 Rat 1576305 Emca6 Estrogen-induced mammary cancer QTL 6 5.8 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 4 44463720 155883716 Rat 738016 Alc16 Alcohol consumption QTL 16 3.6 0.00015 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1358202 Gluco11 Glucose level QTL 11 2.4 0.02 adipocyte glucose uptake trait (VT:0004185) absolute change in adipocyte glucose uptake (CMO:0000873) 4 85379421 167139601 Rat 61422 Cia13 Collagen induced arthritis QTL 13 4.5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 132642577 167139601 Rat 631674 Iddm14 Insulin dependent diabetes mellitus QTL 14 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 4 64528739 157573521 Rat 2293840 Kiddil9 Kidney dilation QTL 9 2.9 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 4 120926564 148090731 Rat 12798519 Anxrr54 Anxiety related response QTL 54 2.54 0.05 locomotor behavior trait (VT:0001392) distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493) 4 114627026 159627026 Rat 12798523 Anxrr56 Anxiety related response QTL 56 2.83 0.05 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 85253748 150276390 Rat 61434 Cia3 Collagen induced arthritis QTL 3 4.8 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 103194656 148194656 Rat 12798527 Anxrr58 Anxiety related response QTL 58 4.11 0.05 locomotor behavior trait (VT:0001392) distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493) 4 119463257 147278687 Rat
D4Got234
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 144,208,084 - 144,208,275 (+) MAPPER mRatBN7.2 Rnor_6.0 4 142,957,340 - 142,957,530 NCBI Rnor6.0 Rnor_5.0 4 206,270,616 - 206,270,806 UniSTS Rnor5.0 RGSC_v3.4 4 146,613,244 - 146,613,434 UniSTS RGSC3.4 Celera 4 132,792,861 - 132,793,051 UniSTS Cytogenetic Map 4 q42 UniSTS
RH144597
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 144,525,486 - 144,525,662 (+) MAPPER mRatBN7.2 Rnor_6.0 4 143,281,069 - 143,281,244 NCBI Rnor6.0 Rnor_5.0 4 206,593,740 - 206,593,915 UniSTS Rnor5.0 RGSC_v3.4 4 147,181,968 - 147,182,143 UniSTS RGSC3.4 Celera 4 133,112,650 - 133,112,825 UniSTS RH 3.4 Map 4 950.8 UniSTS Cytogenetic Map 4 q42 UniSTS
This gene Grm7 is modified in the following models/strains:
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
8
5
12
102
45
36
19
5
19
3
95
32
85
31
51
17
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000056570 ⟹ ENSRNOP00000053411
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 143,731,259 - 144,612,344 (+) Ensembl Rnor_6.0 Ensembl 4 142,780,987 - 143,367,578 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000056996 ⟹ ENSRNOP00000053829
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 143,731,259 - 144,551,904 (+) Ensembl
RefSeq Acc Id:
NM_031040 ⟹ NP_112302
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 145,286,726 - 146,168,213 (+) NCBI mRatBN7.2 4 143,730,862 - 144,612,344 (+) NCBI Rnor_6.0 4 142,452,616 - 143,367,578 (+) NCBI Rnor_5.0 4 205,768,625 - 206,090,308 (+) NCBI Rnor_5.0 4 206,230,927 - 206,680,107 (+) NCBI RGSC_v3.4 4 146,952,340 - 147,270,225 (+) RGD Celera 4 132,321,261 - 133,197,545 (+) RGD
Sequence:
GGGGAGAGATGGATAGCAAGCAAGGGAGGGAGAGAGGGAGTGGGAGGAGGAGGAGGAGGAGAGGGAGCCCAACGACCATTTAAAGCGATAGCAATCCCTGCCCTCTCCCCAGTGCTTGGCTGTTGGAG
hide sequence
RefSeq Acc Id:
XM_039108422 ⟹ XP_038964350
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 145,286,754 - 146,168,028 (+) NCBI mRatBN7.2 4 143,730,899 - 144,612,326 (+) NCBI
RefSeq Acc Id:
XM_039108423 ⟹ XP_038964351
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 145,286,714 - 146,106,683 (+) NCBI mRatBN7.2 4 143,730,899 - 144,551,956 (+) NCBI
RefSeq Acc Id:
XM_039108424 ⟹ XP_038964352
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 145,286,754 - 146,169,099 (+) NCBI mRatBN7.2 4 143,730,898 - 144,613,230 (+) NCBI
RefSeq Acc Id:
XM_063286747 ⟹ XP_063142817
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 145,286,759 - 146,168,028 (+) NCBI
RefSeq Acc Id:
NP_112302 ⟸ NM_031040
- Peptide Label:
precursor
- UniProtKB:
P35400 (UniProtKB/Swiss-Prot), A6IBL9 (UniProtKB/TrEMBL), F1LZS5 (UniProtKB/TrEMBL)
- Sequence:
MVQLGKLLRVLTLMKFPCCVLEVLLCVLAAAARGQEMYAPHSIRIEGDVTLGGLFPVHAKGPSGVPCGDIKRENGIHRLEAMLYALDQINSDPNLLPNVTLGARILDTCSRDTYALEQSLTFVQALIQ
hide sequence
Ensembl Acc Id:
ENSRNOP00000053411 ⟸ ENSRNOT00000056570
RefSeq Acc Id:
XP_038964352 ⟸ XM_039108424
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_038964350 ⟸ XM_039108422
- Peptide Label:
isoform X1
- UniProtKB:
F1LWV8 (UniProtKB/TrEMBL), A6IBM0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038964351 ⟸ XM_039108423
- Peptide Label:
isoform X1
- UniProtKB:
F1LWV8 (UniProtKB/TrEMBL), A6IBM0 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000053829 ⟸ ENSRNOT00000056996
RefSeq Acc Id:
XP_063142817 ⟸ XM_063286747
- Peptide Label:
isoform X3
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-09-10
Grm7
glutamate receptor, metabotropic 7
metabotropic glutamate receptor mGluR7
Name updated
1299863 APPROVED
2002-08-07
Grm7
metabotropic glutamate receptor mGluR7
Symbol and Name status set to provisional
70820 PROVISIONAL
