Stx7 (syntaxin 7) - Rat Genome Database

Name: Stx7
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Stx7 (syntaxin 7) Rattus norvegicus

Analyze

Symbol:

Stx7

Name:

syntaxin 7

RGD ID:

619747

Description:

Enables SNAP receptor activity and SNARE binding activity. Involved in endosome to lysosome transport and vesicle fusion. Located in late endosome membrane and lysosomal membrane. Part of SNARE complex. Is active in synaptic vesicle membrane. Orthologous to human STX7 (syntaxin 7); PARTICIPATES IN phagocytosis pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC100910446; syntaxin-7; syntaxin-7-like

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	STX7 (syntaxin 7)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Stx7 (syntaxin 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Stx7 (syntaxin 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	STX7 (syntaxin 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	STX7 (syntaxin 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Stx7 (syntaxin 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	STX7 (syntaxin 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	STX7 (syntaxin 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Stx7 (syntaxin 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Stx7 (syntaxin 7)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	STX7 (syntaxin 7)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	stx7l (syntaxin 7-like)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):	PEP12	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Syx7	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	syx-7	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	stx7	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	1	21,197,075 - 21,237,320 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	21,197,075 - 21,237,279 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	20,973,496 - 21,014,331 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	26,973,523 - 27,014,359 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	21,173,353 - 21,214,086 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	22,241,655 - 22,281,850 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	22,241,661 - 22,281,788 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	23,721,812 - 23,762,002 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	21,721,897 - 21,762,024 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	21,724,841 - 21,764,969 (-)	NCBI
Celera	1	19,947,867 - 19,987,994 (-)	NCBI		Celera
Cytogenetic Map	1	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

1,2-dimethylhydrazine (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2-hydroxypropanoic acid (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

Aroclor 1254 (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

caffeine (ISO)

chlorohydrocarbon (EXP)

ciglitazone (ISO)

coumestrol (ISO)

decabromodiphenyl ether (ISO)

dicrotophos (ISO)

diuron (EXP)

endosulfan (EXP)

Enterolactone (ISO)

ethanol (ISO)

finasteride (EXP)

folic acid (ISO)

gentamycin (EXP)

glafenine (EXP)

haloperidol (EXP)

indole-3-methanol (EXP)

ivermectin (ISO)

LY294002 (ISO)

methoxychlor (EXP)

N-methyl-4-phenylpyridinium (ISO)

nefazodone (EXP)

nickel atom (ISO)

ochratoxin A (ISO)

paracetamol (EXP)

perfluorooctanoic acid (ISO)

potassium chromate (ISO)

rac-lactic acid (ISO)

resveratrol (ISO)

sodium arsenite (ISO)

sulindac (EXP)

sunitinib (ISO)

tert-butyl hydroperoxide (ISO)

tetrachloromethane (EXP,ISO)

trichostatin A (ISO)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

endosome to lysosome transport (IDA)

intracellular protein transport (IBA,IEA)

membrane fusion (IEA)

organelle assembly (IEA,ISO)

organelle localization (IEA,ISO)

positive regulation of receptor localization to synapse (IEA,ISO)

positive regulation of T cell mediated cytotoxicity (IEA,ISO)

regulation of protein localization to plasma membrane (IEA,ISO)

synaptic vesicle exocytosis (TAS)

vesicle docking (IBA)

vesicle fusion (IBA,IDA)

vesicle-mediated transport (IDA,IEA)

Cellular Component

azurophil granule (IEA,ISO)

early endosome (IEA,ISO)

early endosome membrane (IEA)

endocytic vesicle (IEA,ISO)

endomembrane system (IBA)

endosome (IDA,ISO)

immunological synapse (IEA,ISO)

late endosome (IEA,ISO)

late endosome membrane (IDA)

lysosomal membrane (IDA)

lysosome (ISO)

membrane (IEA)

perinuclear region of cytoplasm (IEA,ISO)

plasma membrane (ISO)

recycling endosome (IEA,ISO)

SNARE complex (IBA,IDA)

synaptic vesicle (IBA)

synaptic vesicle membrane (EXP,IDA)

terminal bouton (HDA)

tertiary granule (IEA,ISO)

vesicle (ISO)

Molecular Function

chloride channel inhibitor activity (IEA,ISO)

protein binding (IPI,ISO)

protein-containing complex binding (IDA)

SNAP receptor activity (IBA,IDA,IEA)

SNARE binding (IBA,IPI,ISO)

syntaxin binding (IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

phagocytosis pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Crystal structure of the endosomal SNARE complex reveals common structural principles of all SNAREs.	Antonin W, etal., Nat Struct Biol 2002 Feb;9(2):107-11.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
7.	Combinatorial SNARE complexes with VAMP7 or VAMP8 define different late endocytic fusion events.	Pryor PR, etal., EMBO Rep. 2004 Jun;5(6):590-5. Epub 2004 May 7.
8.	GOA pipeline	RGD automated data pipeline
9.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
11.	Mammalian late vacuole protein sorting orthologues participate in early endosomal fusion and interact with the cytoskeleton.	Richardson SC, etal., Mol Biol Cell 2004 Mar;15(3):1197-210. Epub 2003 Dec 10.
12.	Molecular anatomy of a trafficking organelle.	Takamori S, etal., Cell. 2006 Nov 17;127(4):831-46.
13.	Composition of isolated synaptic boutons reveals the amounts of vesicle trafficking proteins.	Wilhelm BG, etal., Science. 2014 May 30;344(6187):1023-8. doi: 10.1126/science.1252884.
14.	Syntaxin 7, a novel syntaxin member associated with the early endosomal compartment.	Wong SH, etal., J Biol Chem 1998 Jan 2;273(1):375-80.

Additional References at PubMed

PMID:10564279	PMID:11101518	PMID:12477932	PMID:17897319	PMID:18321981	PMID:18570918	PMID:18980942	PMID:19549681	PMID:20170677	PMID:20458337	PMID:21438968	PMID:21700703
PMID:22871113	PMID:23376485	PMID:24550300

Genomics

Comparative Map Data

Stx7
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	1	21,197,075 - 21,237,320 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	21,197,075 - 21,237,279 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	20,973,496 - 21,014,331 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	26,973,523 - 27,014,359 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	21,173,353 - 21,214,086 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	22,241,655 - 22,281,850 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	22,241,661 - 22,281,788 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	23,721,812 - 23,762,002 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	21,721,897 - 21,762,024 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	21,724,841 - 21,764,969 (-)	NCBI
Celera	1	19,947,867 - 19,987,994 (-)	NCBI		Celera
Cytogenetic Map	1	p12	NCBI

STX7
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	132,445,867 - 132,513,472 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	132,445,867 - 132,513,198 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	132,767,006 - 132,834,611 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	132,822,848 - 132,875,859 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	132,822,847 - 132,875,859	NCBI
Celera	6	133,525,518 - 133,581,174 (-)	NCBI		Celera
Cytogenetic Map	6	q23.2	NCBI
HuRef	6	130,353,519 - 130,409,169 (-)	NCBI		HuRef
CHM1_1	6	133,042,339 - 133,098,018 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	6	133,640,859 - 133,708,445 (-)	NCBI		T2T-CHM13v2.0

Stx7
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	24,025,182 - 24,064,859 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	24,025,200 - 24,066,120 (+)	Ensembl		GRCm39 Ensembl
GRCm38	10	24,149,289 - 24,188,961 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	24,149,302 - 24,190,222 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	23,869,123 - 23,908,765 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	10	23,838,776 - 23,878,375 (+)	NCBI		MGSCv36	mm8
Celera	10	25,082,517 - 25,122,173 (+)	NCBI		Celera
Cytogenetic Map	10	A4	NCBI
cM Map	10	11.45	NCBI

Stx7
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955436	12,928,274 - 12,975,745 (-)	NCBI	ChiLan1.0	ChiLan1.0

STX7
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	6	150,345,389 - 150,402,661 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	130,232,041 - 130,289,326 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	134,342,305 - 134,397,533 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	134,342,304 - 134,398,215 (-)	Ensembl	panpan1.1		panPan2

STX7
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	25,544,283 - 25,607,179 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	25,546,596 - 25,607,231 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	26,531,632 - 26,594,249 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	25,455,483 - 25,518,496 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	25,458,138 - 25,518,571 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	25,501,729 - 25,564,656 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	25,400,189 - 25,462,818 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	25,663,904 - 25,726,563 (-)	NCBI		UU_Cfam_GSD_1.0

Stx7
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	120,685,451 - 120,733,071 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936560	464,617 - 513,009 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936560	464,667 - 512,322 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

STX7
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	31,184,947 - 31,235,865 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	31,184,905 - 31,237,052 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	34,705,635 - 34,757,859 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

STX7
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	13	41,029,992 - 41,086,589 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	13	41,030,073 - 41,088,308 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666040	13,220,150 - 13,275,468 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Stx7
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624753	6,514,056 - 6,547,480 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624753	6,511,516 - 6,554,406 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Stx7
176 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	144
Count of miRNA genes:	104
Interacting mature miRNAs:	127
Transcripts:	ENSRNOT00000021318
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354647	Despr8	Despair related QTL 8		0.0000341	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	1	24744506	Rat
2298546	Neuinf4	Neuroinflammation QTL 4	5.1		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	1	1	28736750	Rat
2313053	Bss51	Bone structure and strength QTL 51	3.8	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	1	32356093	Rat
2313070	Bss52	Bone structure and strength QTL 52	4.4	0.0001	body length (VT:0001256)	body length (CMO:0000013)	1	1	32356093	Rat
2313090	Bmd69	Bone mineral density QTL 69	4.4	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	1	32356093	Rat
738020	Pia8	Pristane induced arthritis QTL 8	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	1	65833076	Rat
1578650	Bmd6	Bone mineral density QTL 6	12.2		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	1	509108	43284926	Rat
1578651	Bmd7	Bone mineral density QTL 7	14.2		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	1	509108	43284926	Rat
1578669	Bss9	Bone structure and strength QTL 9	6.3		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	1	509108	43284926	Rat
1554320	Bmd1	Bone mineral density QTL 1	12.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	509108	86060548	Rat
1600360	Mcs16	Mammary carcinoma susceptibility QTL 16	2.4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	1	2244390	43433040	Rat
7421626	Bp360	Blood pressure QTL 360		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	4393289	49393289	Rat
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	5925874	115540829	Rat
4889451	Eae29	Experimental allergic encephalomyelitis QTL 29	5.51		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	1	5925877	24697545	Rat
631508	Sald1	Serum aldosterone level QTL 1	3.7		blood aldosterone amount (VT:0005346)	serum aldosterone level (CMO:0000487)	1	9856001	54856001	Rat
2302038	Pia31	Pristane induced arthritis QTL 31	5.5	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111)	1	10992065	55992065	Rat
1300167	Hrtrt2	Heart rate QTL 2	4.35		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	11481312	75088344	Rat
2313062	Bmd73	Bone mineral density QTL 73	3.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	11481312	82174945	Rat
2313065	Bss67	Bone structure and strength QTL 67	3.1	0.0001	tibia area (VT:1000281)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
2313069	Bss68	Bone structure and strength QTL 68	2.9	0.0001	tibia size trait (VT:0100001)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
2313075	Bss66	Bone structure and strength QTL 66	3.4	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	11481312	82174945	Rat
2313077	Bss69	Bone structure and strength QTL 69	3.5	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	11481312	82174945	Rat
2313092	Bmd72	Bone mineral density QTL 72	2.5	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	11481312	82174945	Rat
2313097	Bss70	Bone structure and strength QTL 70	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
2317755	Glom22	Glomerulus QTL 22	3.8		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	1	11481482	32355910	Rat
1578756	Iddm22	Insulin dependent diabetes mellitus QTL 22	2.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	11835181	56835181	Rat
5684998	Bss101	Bone structure and strength QTL 101	3.6		tibia strength trait (VT:1000284)	tibia ultimate force (CMO:0001734)	1	15431621	49361612	Rat
5684999	Bss102	Bone structure and strength QTL 102	5.5	0.00000072	tibia strength trait (VT:1000284)	tibia stiffness (CMO:0001735)	1	15431621	49361612	Rat
631494	Bp95	Blood pressure QTL 95	40	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	16206210	49268520	Rat
634353	Rends2	Renal damage susceptibility QTL 2		0.05	kidney blood vessel morphology trait (VT:0000530)	organ lesion measurement (CMO:0000677)	1	19333571	56983283	Rat
1558642	Prcr2	Prostate cancer resistance QTL 2	4.3		prostate integrity trait (VT:0010571)	area of ventral prostate occupied by tumorous lesions to total ventral prostate area ratio (CMO:0000899)	1	20763158	44095856	Rat
724520	Bp145	Blood pressure QTL 145	2.1	0.0024	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	20784828	65784828	Rat

Markers in Region

BF403910

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	21,204,403 - 21,204,523 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	23,549,705 - 23,549,824	NCBI	Rnor6.0
Rnor_6.0	1	22,248,984 - 22,249,103	NCBI	Rnor6.0
Rnor_5.0	1	25,019,330 - 25,019,449	UniSTS	Rnor5.0
Rnor_5.0	1	23,729,141 - 23,729,260	UniSTS	Rnor5.0
RGSC_v3.4	1	21,729,220 - 21,729,339	UniSTS	RGSC3.4
Celera	1	19,955,195 - 19,955,314	UniSTS
RH 3.4 Map	1	208.7	UniSTS
Cytogenetic Map	1	p12	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	41	52	36	19	36	1	1	74	35	34	11	1
Low		2	5	5		5	7	10			7		7
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_021869	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017589644	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017589645	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017589646	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039089032	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC116279	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF031430	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC085737	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000021318 ⟹ ENSRNOP00000021318

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	21,197,078 - 21,237,279 (-)	Ensembl
Rnor_6.0 Ensembl	1	22,241,661 - 22,281,788 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000072943 ⟹ ENSRNOP00000065991

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	21,197,075 - 21,209,264 (-)	Ensembl
Rnor_6.0 Ensembl	1	23,543,426 - 23,556,241 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000081804 ⟹ ENSRNOP00000073994

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	21,197,075 - 21,226,124 (-)	Ensembl
Rnor_6.0 Ensembl	1	22,242,718 - 22,269,831 (-)	Ensembl

RefSeq Acc Id:

NM_021869 ⟹ NP_068641

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	1	21,197,081 - 21,237,213 (-)	NCBI
Rnor_6.0	1	22,241,661 - 22,281,788 (-)	NCBI
Rnor_5.0	1	23,721,812 - 23,762,002 (-)	NCBI
RGSC_v3.4	1	21,721,897 - 21,762,024 (-)	RGD
Celera	1	19,947,867 - 19,987,994 (-)	RGD

Sequence:

show sequence

GCAGCTGGAGGTGACAGAGGAAGCCAACGAGGTGACTCCTAGAAAACCCGACAGCCTGCTTGCA
TCTGATGAAATCGGCCAGTCATCCAGCCAGCCATGTCTTACACTCCGGGGATTGGTGGGGACCC
TGCCCAGCTGGCGCAACGCATCTCCTCTAACATCCAAAAGATCACACAGTGCTCCGCGGAAATA
CAAAGGACTCTGAATCAACTGGGAACACCTCAGGATACACCGGAGTTGAGGCAACAGCTGCAGC
AGGAGCAGCAGTATACTAACCAACTTGCGAAAGAAACAGATAAGTACATTAAGGAGTTTGGCTT
TCTGCCCACCACCCCCAGTGAACAGCGTCAAAGGAAGATACAGAAAGACCGATTGGTGGCAGAA
TTCACCACAGCGCTAACAAACTTTCAGAAAGTGCAGAGGCAAGCTGCTGAGAGAGAGAAAGAGT
TCGTGGCCCGAGTGCGAGCCAGTTCCAGAGTATCGGGTGGCTTTCCTGAAGACAGCTCAAAAGA
GAAGAATTTTGTATCTTGGGAAAGCCAAACACAGCCTCAAGTGCAAGTCCAAGATGAAGAAATC
ACAGAGGATGACCTCCGGCTCATTCATGAGAGAGAGTCTTCAATCAGACAGCTGGAAGCTGACA
TTATGGACATTAACGAAATATTCAAAGACTTGGGGATGATGATTCATGAACAAGGAGATGTTAT
TGACAGCATAGAAGCCAATGTAGAAAGTGCGGAAGTTCACGTACAGCAGGCAAACCAGCAGCTG
TCAAGAGCGGCAAATTATCAGCGCAAATCCAGAAAAACCCTCTGCATCATCATTTTAATCCTGG
TGGTCGGAATCGTGATCATCTTCTTCATCGTATGGGGTCTGAAAGGCTGAGACCGACCGAAGGC
GCGGACGACTGCATGATGTTATCAGCGAGACGTAGGCAGGCTCTCGGGATCACTTTCTTTTGTC
GATGTTCTGACGCTGTTGTGTAAAAGATGGCTCCGCACTTCGTCGTTTTTACCAGGGGGTTGTG
GGGGGGTGGGTGTTCTTTTGGATTCAATCTGATATTTTCTAATACCCAAGTTTTTTAAAATTCC
CTTTGCTGGCCCAATTTCCCTGCTTTTTAGTCCAACAACTGTTGGGTTTTTTGCTCACGTTGTA
TATGCCCTTCATTTATAATTTATTTATATTGTTTAACTTTTGGGGAATTATCTGATTGGCATGT
GTGCTCTGCCTACACCTCTGTCACTGTGTAACCCGTGTAACATGATTGTGCTATCTTATTAAAA
AAAAATCCGAGTTTAAGTTTCATTTGTCCAGTAAATGTTCTCAGTAGGCAAACCCTAGCAGCCC
CATCTGTGGGACATTTTATCCCCTGTGGTCCAGGGCAGTGCAGATCATTATTGCTCTGCCATTA
TTGGATGGCTCTCATCATCCCTGAATAAAATCAGTGAATCTCTTCCCTATGTGTATATATGCAT
TTGCTGCAGATTGCATCATAAAGATAGTGAGGATAGATTGTTTTTAATGTGGACTATTTAATCC
ACTACATACTAAGGGCAGAAGCGTCTGAAAAACCCATACCAATGTCTGTTCTGTTTAGATGCTA
AAGATGCCAGTTTCGTACTGCACGGAACCACTTTTCCCACACGGTCTTGTTTTATTTGGCCATT
AGTTACTTTCCCTTGTGTCCCTCAGAACACTCATTAGACATGTATCTTTGGGTCCCGTCTTCGC
AAAGTAATGTTCCTACAATTACAGATTTGGGATTTCATTTTTATACTTAAATTTAATACTTAAA
TGTTAAGAGTTCGTTTAGATGCCACTTTTTTTCTTAAAACCATTCTTCATTCAAATAAGAATCA
GATGTCTGCCAATGAACTCACTTGTCTTTTTGAATCAATGTTTTAATGCACTAATATGAATGCT
GTAAAAGGGGCTATCTTAGATTATCGCTTGTGTTTTATAATGTTCTTACACAGCCGTCTGCTAA
TGCTGGCACTGTTTAATGTGGCTCTGAAACCTTTAAATGGGAACAAGTGAAATATTAACAATGG
AAGCAGAATAAAGGTGATTCTGGACATGTCAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_017589644 ⟹ XP_017445133

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	1	21,197,075 - 21,237,320 (-)	NCBI
Rnor_6.0	1	22,241,655 - 22,281,850 (-)	NCBI

Sequence:

show sequence

GTGCTTGCGCCACCGCCCATTCGCTGAGACTGGCTGCGCAGGGCCGTGGGCCCTCGGTGACAGC
AGCTGGAGGTGACAGAGGAAGCCAACGAGGTCAGGGTGACTCCTAGAAAACCCGACAGCCTGCT
TGCATCTGATGAAATCGGCCAGTCATCCAGCCAGCCATGTCTTACACTCCGGGGATTGGTGGGG
ACCCTGCCCAGCTGGCGCAACGCATCTCCTCTAACATCCAAAAGATCACACAGTGCTCCGCGGA
AATACAAAGGACTCTGAATCAACTGGGAACACCTCAGGATACACCGGAGTTGAGGCAACAGCTG
CAGCAGGAGCAGCAGTATACTAACCAACTTGCGAAAGAAACAGATAAGTACATTAAGGAGTTTG
GCTTTCTGCCCACCACCCCCAGTGAACAGCGTCAAAGGAAGATACAGAAAGACCGATTGGTGGC
AGAATTCACCACAGCGCTAACAAACTTTCAGAAAGTGCAGAGGCAAGCTGCTGAGAGAGAGAAA
GAGTTCGTGGCCCGAGTGCGAGCCAGTTCCAGAGTATCGGGTGGCTTTCCTGAAGACAGCTCAA
AAGAGAAGAATTTTGTATCTTGGGAAAGCCAAACACAGCCTCAAGTGCAAGTCCAAGATGAAGA
AATCACAGAGGATGACCTCCGGCTCATTCATGAGAGAGAGTCTTCAATCAGACAGCTGGAAGCT
GACATTATGGACATTAACGAAATATTCAAAGACTTGGGGATGATGATTCATGAACAAGGAGATG
TTATTGACAGCATAGAAGCCAATGTAGAAAGTGCGGAAGTTCACGTACAGCAGGCAAACCAGCA
GCTGTCAAGAGCGGCAAATTATCAGCGCAAATCCAGAAAAACCCTCTGCATCATCATTTTAATC
CTGGTGGTCGGAATCGTGATCATCTTCTTCATCGTATGGGGTCTGAAAGGCTGAGACCGACCGA
AGGCGCGGACGACTGCATGATGTTATCAGCGAGACGTAGGCAGGCTCTCGGGATCACTTTCTTT
TGTCGATGTTCTGACGCTGTTGTGTAAAAGATGGCTCCGCACTTCGTCGTTTTTACCAGGGGGT
TGTGGGGGGGTGGGTGTTCTTTTGGATTCAATCTGATATTTTCTAATACCCAAGTTTTTTAAAA
TTCCCTTTGCTGGCCCAATTTCCCTGCTTTTTAGTCCAACAACTGTTGGGTTTTTTGCTCACGT
TGTATATGCCCTTCATTTATAATTTATTTATATTGTTTAACTTTTGGGGAATTATCTGATTGGC
ATGTGTGCTCTGCCTACACCTCTGTCACTGTGTAACCCGTGTAACATGATTGTGCTATCTTATT
AAAAAAAAATCCGAGTTTAAGTTTCATTTGTCCAGTAAATGTTCTCAGTAGGCAAACCCTAGCA
GCCCCATCTGTGGGACATTTTATCCCCTGTGGTCCAGGGCAGTGCAGATCATTATTGCTCTGCC
ATTATTGGATGGCTCTCATCATCCCTGAATAAAATCAGTGAATCTCTTCCCTATGTGTATATAT
GCATTTGCTGCAGATTGCATCATAAAGATAGTGAGGATAGATTGTTTTTAATGTGGACTATTTA
ATCCACTACATACTAAGGGCAGAAGCGTCTGAAAAACCCATACCAATGTCTGTTCTGTTTAGAT
GCTAAAGATGCCAGTTTCGTACTGCACGGAACCACTTTTCCCACACGGTCTTGTTTTATTTGGC
CATTAGTTACTTTCCCTTGTGTCCCTCAGAACACTCATTAGACATGTATCTTTGGGTCCCGTCT
TCGCAAAGTAATGTTCCTACAATTACAGATTTGGGATTTCATTTTTATACTTAAATTTAATACT
TAAATGTTAAGAGTTCGTTTAGATGCCACTTTTTTTCTTAAAACCATTCTTCATTCAAATAAGA
ATCAGATGTCTGCCAATGAACTCACTTGTCTTTTTGAATCAATGTTTTAATGCACTAATATGAA
TGCTGTAAAAGGGGCTATCTTAGATTATCGCTTGTGTTTTATAATGTTCTTACACAGCCGTCTG
CTAATGCTGGCACTGTTTAATGTGGCTCTGAAACCTTTAAATGGGAACAAGTGAAATATTAACA
ATGGAAGCAGAATAAAGGTGATTCTGGACATGTCTGCTAA

hide sequence

RefSeq Acc Id:

XM_039089032 ⟹ XP_038944960

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	1	21,197,085 - 21,237,268 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_068641	(Get FASTA)	NCBI Sequence Viewer
	XP_017445133	(Get FASTA)	NCBI Sequence Viewer
	XP_038944960	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAC17131	(Get FASTA)	NCBI Sequence Viewer
	AAH85737	(Get FASTA)	NCBI Sequence Viewer
	EDL87765	(Get FASTA)	NCBI Sequence Viewer
	EDL87766	(Get FASTA)	NCBI Sequence Viewer
	EDL87767	(Get FASTA)	NCBI Sequence Viewer
	EDL87768	(Get FASTA)	NCBI Sequence Viewer
	O70257	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_068641 ⟸ NM_021869

- UniProtKB:

Q5U337 (UniProtKB/Swiss-Prot), O70257 (UniProtKB/Swiss-Prot), A6JUL4 (UniProtKB/TrEMBL), A0A0G2K6Y9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSYTPGIGGDPAQLAQRISSNIQKITQCSAEIQRTLNQLGTPQDTPELRQQLQQEQQYTNQLAK
ETDKYIKEFGFLPTTPSEQRQRKIQKDRLVAEFTTALTNFQKVQRQAAEREKEFVARVRASSRV
SGGFPEDSSKEKNFVSWESQTQPQVQVQDEEITEDDLRLIHERESSIRQLEADIMDINEIFKDL
GMMIHEQGDVIDSIEANVESAEVHVQQANQQLSRAANYQRKSRKTLCIIILILVVGIVIIFFIV
WGLKG

hide sequence

RefSeq Acc Id:	XP_017445133 ⟸ XM_017589644
- Peptide Label:	isoform X1
- UniProtKB:	Q5U337 (UniProtKB/Swiss-Prot), O70257 (UniProtKB/Swiss-Prot), A6JUL4 (UniProtKB/TrEMBL), A0A0G2K6Y9 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSYTPGIGGDPAQLAQRISSNIQKITQCSAEIQRTLNQLGTPQDTPELRQQLQQEQQYTNQLAK ETDKYIKEFGFLPTTPSEQRQRKIQKDRLVAEFTTALTNFQKVQRQAAEREKEFVARVRASSRV SGGFPEDSSKEKNFVSWESQTQPQVQVQDEEITEDDLRLIHERESSIRQLEADIMDINEIFKDL GMMIHEQGDVIDSIEANVESAEVHVQQANQQLSRAANYQRKSRKTLCIIILILVVGIVIIFFIV WGLKG hide sequence

RefSeq Acc Id:

ENSRNOP00000021318 ⟸ ENSRNOT00000021318

RefSeq Acc Id:

ENSRNOP00000073994 ⟸ ENSRNOT00000081804

RefSeq Acc Id:	XP_038944960 ⟸ XM_039089032
- Peptide Label:	isoform X1
- UniProtKB:	O70257 (UniProtKB/Swiss-Prot), Q5U337 (UniProtKB/Swiss-Prot), A6JUL4 (UniProtKB/TrEMBL), A0A0G2K6Y9 (UniProtKB/TrEMBL)

RefSeq Acc Id:

ENSRNOP00000065991 ⟸ ENSRNOT00000072943

Protein Domains

Syntaxin N-terminal t-SNARE coiled-coil homology

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-M0R930-F1-model_v2	AlphaFold	M0R930	1-252	view protein structure
AF-O70257-F1-model_v2	AlphaFold	O70257	1-261	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:619747	AgrOrtholog
BioCyc Gene	G2FUF-62103	BioCyc
Ensembl Genes	ENSRNOG00000015670	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
	ENSRNOG00000048248	Ensembl
Ensembl Protein	ENSRNOP00000021318	ENTREZGENE
	ENSRNOP00000021318.3	UniProtKB/TrEMBL
	ENSRNOP00000065991.3	UniProtKB/TrEMBL
	ENSRNOP00000073994.2	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000021318	ENTREZGENE
	ENSRNOT00000021318.5	UniProtKB/TrEMBL
	ENSRNOT00000072943.3	UniProtKB/TrEMBL
	ENSRNOT00000081804.2	UniProtKB/TrEMBL
Gene3D-CATH	1.20.5.110	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	1.20.58.70	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7193349	IMAGE-MGC_LOAD
InterPro	SNARE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Syntaxin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Syntaxin/epimorphin_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Syntaxin_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	T_SNARE_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:60466	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:93455	IMAGE-MGC_LOAD
NCBI Gene	60466	ENTREZGENE
PANTHER	PTHR19957	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SYNTAXIN-7	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	SNARE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Syntaxin_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Stx7	PhenoGen
PROSITE	SYNTAXIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	T_SNARE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	SynN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	t_SNARE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF47661	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0G2K6Y9	ENTREZGENE, UniProtKB/TrEMBL
	A0A8L2QAN2_RAT	UniProtKB/TrEMBL
	A6JUL2_RAT	UniProtKB/TrEMBL
	A6JUL4	ENTREZGENE, UniProtKB/TrEMBL
	M0R930_RAT	UniProtKB/TrEMBL
	O70257	ENTREZGENE
	Q5U337	ENTREZGENE
	STX7_RAT	UniProtKB/Swiss-Prot
UniProt Secondary	Q5U337	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Stx7	syntaxin 7	LOC100910446	syntaxin-7-like	Data Merged	737654	PROVISIONAL
2012-07-05	LOC100910446	syntaxin-7-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2004-02-26	Stx7	syntaxin 7			Symbol and Name status set to approved	625702	APPROVED
2002-08-07	Stx7	syntaxin 7			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_expression	mRNA widely expressed in all tissues	634188
gene_process	involved with vesicle docking and fusion events with membrane	634188

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)