Pim1 (Pim-1 proto-oncogene, serine/threonine kinase)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Pim1 (Pim-1 proto-oncogene, serine/threonine kinase) Rattus norvegicus

Analyze

Symbol:

Pim1

Name:

Pim-1 proto-oncogene, serine/threonine kinase

RGD ID:

3330

Description:

Predicted to enable several functions, including ATP binding activity; manganese ion binding activity; and ribosomal small subunit binding activity. Predicted to be involved in several processes, including positive regulation of brown fat cell differentiation; positive regulation of cell population proliferation; and regulation of DNA-templated transcription. Predicted to be located in cytosol; nuclear lumen; and plasma membrane. Predicted to be active in cytoplasm. Orthologous to human PIM1 (Pim-1 proto-oncogene, serine/threonine kinase); PARTICIPATES IN granulocyte-macrophage colony-stimulating factor signaling pathway; interleukin-3 signaling pathway; interleukin-5 signaling pathway; INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine; 2,5-hexanedione.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

non-specific serine/threonine protein kinase; pim-1 oncogene; proto-oncogene serine/threonine-protein kinase Pim-1; proviral integration site 1; serine/threonine-protein kinase pim-1

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

Allele / Splice:

Pim1_v1 Pim1_v2

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	20	7,554,921 - 7,559,174 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	7,554,921 - 7,559,174 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	8,258,177 - 8,262,426 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	20	7,619,707 - 7,623,956 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	20	8,092,540 - 8,096,790 (+)	NCBI	Rnor_WKY
Rnor_6.0	20	8,165,423 - 8,169,557 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	8,165,307 - 8,169,555 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	10,364,285 - 10,368,419 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	7,817,403 - 7,821,800 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	20	7,817,629 - 7,822,027 (+)	NCBI
Celera	20	9,096,543 - 9,100,794 (+)	NCBI		Celera
Cytogenetic Map	20	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

allergic contact dermatitis (ISO)

Animal Disease Models (ISO)

Breast Neoplasms (ISO)

congenital diaphragmatic hernia (ISO)

COVID-19 (ISO)

glioblastoma (ISO)

Neoplastic Cell Transformation (ISO)

pre-malignant neoplasm (ISO)

prostate carcinoma in situ (ISO)

pyelonephritis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(R)-pantothenic acid (ISO)

1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (ISO)

1,2-dimethylhydrazine (ISO)

1,4-dioxane (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,5-hexanedione (EXP)

2-butoxyethanol (ISO)

2-hydroxypropanoic acid (ISO)

3,4-methylenedioxymethamphetamine (ISO)

3-chloropropane-1,2-diol (EXP)

4,4'-diaminodiphenylmethane (ISO)

4-hydroxyphenyl retinamide (ISO)

4-vinylcyclohexene dioxide (ISO)

5-aza-2'-deoxycytidine (ISO)

acrylamide (EXP)

ageladine A (ISO)

aldehydo-D-glucose (ISO)

all-trans-retinoic acid (ISO)

amidotrizoic acid (ISO)

ammonium chloride (EXP)

antirheumatic drug (ISO)

arsenous acid (ISO)

atrazine (ISO)

azathioprine (ISO)

belinostat (ISO)

benzene (ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

benzoates (ISO)

bisphenol A (EXP,ISO)

cadmium dichloride (EXP)

calix[6]arene (ISO)

carbendazim (EXP)

carbon nanotube (ISO)

CGP 52608 (ISO)

chlorpromazine (ISO)

choline (ISO)

chromium atom (ISO)

chrysene (ISO)

ciglitazone (ISO)

cisplatin (ISO)

clofibrate (ISO)

cocaine (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

D-glucose (ISO)

decabromodiphenyl ether (EXP)

dexamethasone (EXP)

diarsenic trioxide (ISO)

dibenz[a,h]anthracene (ISO)

diethylstilbestrol (ISO)

dioxygen (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

endosulfan (EXP)

entinostat (ISO)

epoxiconazole (ISO)

flusilazole (ISO)

folic acid (ISO)

fulvestrant (ISO)

furan (EXP)

genistein (ISO)

gentamycin (EXP)

glucose (ISO)

glycidol (EXP)

glyphosate (ISO)

hexaconazole (ISO)

hydrogen peroxide (ISO)

hydroquinone (ISO)

ibrutinib (ISO)

indole-3-methanol (EXP)

iomeprol (ISO)

iron atom (ISO)

iron(0) (ISO)

L-methionine (ISO)

leflunomide (ISO)

lipopolysaccharide (ISO)

LY294002 (ISO)

methotrexate (ISO)

methoxychlor (ISO)

methylmercury chloride (ISO)

mifepristone (ISO)

N-acetyl-L-cysteine (EXP)

N-methyl-4-phenylpyridinium (ISO)

N-nitrosodiethylamine (EXP)

N-nitrosodimethylamine (ISO)

nickel atom (ISO)

nickel sulfate (ISO)

nitrofen (EXP)

organoselenium compound (ISO)

palbociclib (ISO)

panobinostat (ISO)

paracetamol (EXP,ISO)

phenobarbital (ISO)

phenol (ISO)

PhIP (ISO)

pirinixic acid (ISO)

potassium dichromate (ISO)

progesterone (ISO)

propiconazole (ISO)

protein kinase inhibitor (ISO)

rac-lactic acid (ISO)

raloxifene (ISO)

resveratrol (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

silver atom (ISO)

silver(0) (ISO)

sirolimus (ISO)

sodium arsenite (ISO)

sorafenib (ISO)

succimer (ISO)

sunitinib (ISO)

tamibarotene (ISO)

tamoxifen (ISO)

temozolomide (ISO)

testosterone (EXP,ISO)

tetraphene (ISO)

thalidomide (ISO)

thioacetamide (EXP)

tremolite asbestos (ISO)

triadimefon (ISO)

trichostatin A (ISO)

troglitazone (ISO)

urethane (ISO)

valproic acid (EXP,ISO)

vinclozolin (EXP)

vitamin E (ISO)

zearalenone (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

apoptotic process (IEA)

cellular detoxification (ISO,ISS)

negative regulation of apoptotic process (ISO,ISS)

negative regulation of DNA-binding transcription factor activity (ISO)

positive regulation of brown fat cell differentiation (ISO,ISS)

positive regulation of cardiac muscle cell proliferation (ISO)

positive regulation of cardioblast proliferation (ISO)

positive regulation of cyclin-dependent protein serine/threonine kinase activity (ISO)

positive regulation of DNA-templated transcription (ISO)

positive regulation of protein serine/threonine kinase activity (ISO)

protein autophosphorylation (IBA,ISO)

protein phosphorylation (ISO,ISS)

protein stabilization (ISO)

regulation of hematopoietic stem cell proliferation (ISO)

regulation of transmembrane transporter activity (ISO,ISS)

vitamin D receptor signaling pathway (ISO)

Cellular Component

cytoplasm (IBA,ISO,ISS)

cytosol (IEA,ISO)

nucleolus (IEA,ISO)

nucleoplasm (IEA,ISO)

nucleus (ISO)

plasma membrane (IEA,ISO)

Molecular Function

ATP binding (ISO,ISS)

manganese ion binding (ISO,ISS)

protein binding (ISO)

protein serine kinase activity (IEA)

protein serine/threonine kinase activator activity (ISO)

protein serine/threonine kinase activity (IBA,ISO,ISS)

ribosomal small subunit binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

acute myeloid leukemia pathway (IEA)

granulocyte-macrophage colony-stimulating factor signaling pathway (ISO)

interleukin-3 signaling pathway (ISO)

interleukin-5 signaling pathway (ISO)

Jak-Stat signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Hyaluronan mixed esters of butyric and retinoic acid affording myocardial survival and repair without stem cell transplantation.	Lionetti V, etal., J Biol Chem. 2010 Mar 26;285(13):9949-61. doi: 10.1074/jbc.M109.087254. Epub 2010 Jan 22.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
7.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
8.	GOA pipeline	RGD automated data pipeline
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
10.	Characterization of the testes-specific pim-1 transcript in rat.	Wingett D, etal., Nucleic Acids Res 1992 Jun 25;20(12):3183-9.

Additional References at PubMed

PMID:1825810	PMID:12668877	PMID:15471855	PMID:16123140	PMID:16186805	PMID:16266891	PMID:18037896	PMID:18056989	PMID:18438430	PMID:18519946	PMID:18593906	PMID:18784362
PMID:21147132	PMID:21474815	PMID:21680901	PMID:22720752	PMID:23495171	PMID:23530233	PMID:24047441	PMID:24916111	PMID:25812446	PMID:27103465	PMID:27923061	PMID:29544221
PMID:30257237	PMID:30299595	PMID:31969012	PMID:32145290

Genomics

Comparative Map Data

Pim1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	20	7,554,921 - 7,559,174 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	7,554,921 - 7,559,174 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	8,258,177 - 8,262,426 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	20	7,619,707 - 7,623,956 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	20	8,092,540 - 8,096,790 (+)	NCBI	Rnor_WKY
Rnor_6.0	20	8,165,423 - 8,169,557 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	8,165,307 - 8,169,555 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	10,364,285 - 10,368,419 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	7,817,403 - 7,821,800 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	20	7,817,629 - 7,822,027 (+)	NCBI
Celera	20	9,096,543 - 9,100,794 (+)	NCBI		Celera
Cytogenetic Map	20	p12	NCBI

PIM1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	37,170,152 - 37,175,428 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	6	37,170,152 - 37,175,428 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	37,137,928 - 37,143,204 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	37,245,964 - 37,251,182 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	37,245,963 - 37,251,180	NCBI
Celera	6	38,693,003 - 38,698,282 (+)	NCBI		Celera
Cytogenetic Map	6	p21.2	NCBI
HuRef	6	36,856,808 - 36,862,087 (+)	NCBI		HuRef
CHM1_1	6	37,139,777 - 37,145,056 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	6	36,993,698 - 36,998,970 (+)	NCBI		T2T-CHM13v2.0

Pim1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	29,709,759 - 29,715,085 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	29,709,727 - 29,715,086 (+)	Ensembl		GRCm39 Ensembl
GRCm38	17	29,490,785 - 29,496,111 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	29,490,753 - 29,496,112 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	17	29,627,990 - 29,632,410 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	17	29,217,824 - 29,222,468 (+)	NCBI		MGSCv36	mm8
Celera	17	30,034,650 - 30,039,059 (+)	NCBI		Celera
Cytogenetic Map	17	A3.3	NCBI
cM Map	17	15.38	NCBI

Pim1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955437	5,942,106 - 5,945,431 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955437	5,940,825 - 5,945,367 (-)	NCBI	ChiLan1.0	ChiLan1.0

PIM1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	6	37,923,556 - 37,928,841 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
Mhudiblu_PPA_v0	6	36,730,669 - 36,735,954 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

PIM1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	12	6,213,504 - 6,217,933 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	12	6,211,867 - 6,217,933 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	12	6,231,727 - 6,236,155 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	12	6,677,872 - 6,682,310 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	12	6,562,116 - 6,682,883 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	12	6,215,069 - 6,219,497 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	12	6,296,443 - 6,300,872 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	12	6,395,246 - 6,399,674 (+)	NCBI		UU_Cfam_GSD_1.0

Pim1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	41,660,075 - 41,664,724 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936476	22,295,021 - 22,300,161 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936476	22,295,023 - 22,300,155 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PIM1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	32,788,291 - 32,793,878 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	32,788,246 - 32,793,882 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	37,691,993 - 37,697,470 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PIM1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	17	34,968,661 - 34,973,920 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	17	34,968,429 - 34,973,760 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666044	37,109,813 - 37,115,081 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pim1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624754	20,808,701 - 20,815,206 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624754	20,810,398 - 20,815,182 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Pim1
12 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	76
Count of miRNA genes:	66
Interacting mature miRNAs:	73
Transcripts:	ENSRNOT00000000637
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354642	Despr15	Despair related QTL 15		0.0027	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	20	1	24159021	Rat
1600382	Edcs3	Endometrial carcinoma susceptibility QTL3	3.5	0.003	uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	20	1	25159026	Rat
2317851	Alcrsp22	Alcohol response QTL 22	3.2	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27339237	Rat
1641893	Alcrsp7	Alcohol response QTL 7			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27339237	Rat
8694189	Bw153	Body weight QTL 153	3.13	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	20	1	29191651	Rat
9590275	Scort15	Serum corticosterone level QTL 15	3.48	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	29191651	Rat
7411650	Foco23	Food consumption QTL 23	20.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	29191651	Rat
9590109	Sffal8	Serum free fatty acids level QTL 8	5.32	0.01	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	20	1	29191651	Rat
9589155	Insul32	Insulin level QTL 32	6.38	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	20	1	29191651	Rat
6893685	Bw111	Body weight QTL 111	2.7	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	20	1	32578807	Rat
7411668	Foco32	Food consumption QTL 32	8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	36600972	Rat
9590252	Scort12	Serum corticosterone level QTL 12	20.46	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	36600972	Rat
2305926	Iddm37	Insulin dependent diabetes mellitus QTL 37	6		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	20	1527842	46527842	Rat
1641915	Colcr9	Colorectal carcinoma resistance QTL 9	2.97	0.0024	intestine integrity trait (VT:0010554)	benign colorectal tumor number (CMO:0001795)	20	1530655	46530655	Rat
1598816	Memor12	Memory QTL 12	2.4		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	20	2606836	47606836	Rat
2317057	Aia27	Adjuvant induced arthritis QTL 27	2.83		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	20	2892597	26381954	Rat
1300152	Bp195	Blood pressure QTL 195	3.46		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	20	3621649	9243559	Rat
1331772	Cdexp2	CD45RC expression in CD8 T cells QTL 2	5.7		CD8-positive T cell quantity (VT:0008077)	blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990)	20	3621649	10078919	Rat
61432	Cia1	Collagen induced arthritis QTL 1			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	20	3621656	14101050	Rat
4889857	Pur27	Proteinuria QTL 27	12.2	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	20	4606607	17617956	Rat
1558640	Prcs2	Prostate cancer susceptibility QTL 2	3.3		prostate integrity trait (VT:0010571)	percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943)	20	4606607	17617956	Rat
70154	Insul2	Insulin level QTL 2	3.75		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	20	6691706	17489458	Rat

Markers in Region

PMC275438P1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	7,554,935 - 7,555,727 (+)	MAPPER	mRatBN7.2
Rnor_6.0	20	8,165,438 - 8,166,229	NCBI	Rnor6.0
Rnor_5.0	20	10,364,300 - 10,365,091	UniSTS	Rnor5.0
RGSC_v3.4	20	7,817,418 - 7,818,209	UniSTS	RGSC3.4
Celera	20	9,096,558 - 9,097,349	UniSTS
Cytogenetic Map	20	p12	UniSTS

PMC133764P3

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	7,555,160 - 7,555,318 (+)	MAPPER	mRatBN7.2
Rnor_6.0	20	8,165,663 - 8,165,820	NCBI	Rnor6.0
Rnor_5.0	20	10,364,525 - 10,364,682	UniSTS	Rnor5.0
RGSC_v3.4	20	7,817,643 - 7,817,800	UniSTS	RGSC3.4
Celera	20	9,096,783 - 9,096,940	UniSTS
Cytogenetic Map	20	p12	UniSTS

PMC133764P4

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	7,555,181 - 7,555,318 (+)	MAPPER	mRatBN7.2
Rnor_6.0	20	8,165,684 - 8,165,820	NCBI	Rnor6.0
Rnor_5.0	20	10,364,546 - 10,364,682	UniSTS	Rnor5.0
RGSC_v3.4	20	7,817,664 - 7,817,800	UniSTS	RGSC3.4
Celera	20	9,096,804 - 9,096,940	UniSTS
Cytogenetic Map	20	p12	UniSTS

Pim1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	7,555,309 - 7,555,801 (+)	MAPPER	mRatBN7.2
Rnor_6.0	20	8,165,812 - 8,166,303	NCBI	Rnor6.0
Rnor_5.0	20	10,364,674 - 10,365,165	UniSTS	Rnor5.0
RGSC_v3.4	20	7,817,792 - 7,818,283	UniSTS	RGSC3.4
Celera	20	9,096,932 - 9,097,423	UniSTS
Cytogenetic Map	20	p12	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	2	26	37	22	19	22	1	1	34	18	40	11	1
Low	1	17	20	19		19	7	10	40	17	1		7
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_017034	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473988	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000324	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X63675	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000000637 ⟹ ENSRNOP00000000637

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	7,554,921 - 7,559,174 (+)	Ensembl
Rnor_6.0 Ensembl	20	8,165,307 - 8,169,555 (+)	Ensembl

RefSeq Acc Id:

NM_017034 ⟹ NP_058730

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	20	7,554,921 - 7,559,174 (+)	NCBI
Rnor_6.0	20	8,165,423 - 8,169,557 (+)	NCBI
Rnor_5.0	20	10,364,285 - 10,368,419 (+)	NCBI
RGSC_v3.4	20	7,817,403 - 7,821,800 (+)	RGD
Celera	20	9,096,543 - 9,100,794 (+)	RGD

Sequence:

show sequence

GGGATGCTCTTGTCCAAGATCAACTCCCTGGCCCACCTGCGCGCAGCCCCTTGCAACGACCTGC
ACGCCAACAAGCTGGCGCCGGGCAAAGAGAAGGAGCCCCTGGAGTCGCAGTACCAGGTGGGCCC
GCTGTTGGGCAGCGGTGGCTTCGGCTCGGTCTACTCGGGCATCCGCGTCGCCGACAACTTGCCG
GTGGCCATCAAGCACGTGGAGAAGGACCGGATTTCCGACTGGGGGGAACTGCCCAACGGCACCC
GAGTGCCCATGGAAGTGGTCCTGCTGAAGAAGGTGAGCTCGGGCTTCTCGGGCGTCATTAGACT
TCTGGACTGGTTCGAGAGGCCCGATAGTTTCGTGCTGATCCTGGAGAGGCCCGAACCCGTGCAA
GACCTCTTCGACTTCATCACCGAGCGAGGAGCCCTCCAGGAGGAGCTGGCCCGGAGCTTCTTCT
GGCAGGTGCTGGAGGCCGTGCGGCATTGCCACAACTGCGGGGTTCTCCACCGCGACATCAAGGA
CGAGAACATCTTAATCGACCTGAACCGCGGCGAACTCAAACTCATCGACTTCGGGTCGGGGGCG
CTGCTCAAGGACACAGTCTACACGGACTTTGACGGAACCCGAGTGTACAGTCCTCCAGAGTGGA
TTCGCTACCATCGCTACCACGGCAGGTCGGCTGCTGTTTGGTCCCTGGGGATCCTGCTCTATGA
CATGGTCTGCGGAGATATTCCATTTGAGCACGACGAAGAGATCGTCAAGGGCCAAGTGTACTTT
AGGCAAAGGGTCTCTTCAGAATGTCAACATCTTATTAGATGGTGCCTGTCCCTGAGACCATCGG
ACCGGCCCTCCTTTGAAGAAATCCAGAACCATCCGTGGATGCAGGATGTTCTCCTGCCCCAGGC
CACCGCCGAGATTCATCTGCACAGCCTGTCACCATCACCCAGCAAATAGCAGCCATTCTGTCAG
ACCCTCCAGGGAAGAGAGAGCTTGTCTGCTGGCCTCCAACAGGACCCTGCTCTACGATGCAGGG
ACAGAAATGACAACTCATTCCAGGCTCCGGGGTCCCTGGAGCAACCTCCCTCAAGGAGAAGAGA
CTAGTTCACTCGTCCTGGACCCCGCTTTGCCCCTCACAGACTCAGTGGCGTCCAGTGTGGCTGG
CGTCCGCAGAGTCCCGGGTGTTGGGGGGGGAGGTGGGAGTGGGTCAGAGCCCTGTCATGGAACT
TTAGTCACCATGGAGACTGTGGGTCACCAAGATGGGCCAGGGTAGGGGAAAAACATTTGGGGGG
TGGGATTAAAAACTAGCACCAT

hide sequence

Protein Sequences


Protein RefSeqs	NP_058730	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	CAA45214	(Get FASTA)	NCBI Sequence Viewer
	EDL96966	(Get FASTA)	NCBI Sequence Viewer
	EDL96967	(Get FASTA)	NCBI Sequence Viewer
	P26794	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_058730 ⟸ NM_017034

- UniProtKB:

P26794 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MLLSKINSLAHLRAAPCNDLHANKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVADNLPV
AIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQD
LFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGAL
LKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIVKGQVYFR
QRVSSECQHLIRWCLSLRPSDRPSFEEIQNHPWMQDVLLPQATAEIHLHSLSPSPSK

hide sequence

RefSeq Acc Id:

ENSRNOP00000000637 ⟸ ENSRNOT00000000637

Protein Domains

Protein kinase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P26794-F1-model_v2	AlphaFold	P26794	1-313	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3330	AgrOrtholog
BioCyc Gene	G2FUF-4370	BioCyc
Ensembl Genes	ENSRNOG00000000529	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSRNOP00000000637	ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000000637	ENTREZGENE, UniProtKB/Swiss-Prot
InterPro	Kinase-like_dom_sf	UniProtKB/Swiss-Prot
	PIM1/2/3	UniProtKB/Swiss-Prot
	Prot_kinase_dom	UniProtKB/Swiss-Prot
	Protein_kinase_ATP_BS	UniProtKB/Swiss-Prot
	Ser/Thr_kinase_AS	UniProtKB/Swiss-Prot
KEGG Report	rno:24649	UniProtKB/Swiss-Prot
NCBI Gene	24649	ENTREZGENE
Pfam	Pkinase	UniProtKB/Swiss-Prot
PhenoGen	Pim1	PhenoGen
PIRSF	STPK_Pim-1	UniProtKB/Swiss-Prot
PROSITE	PROTEIN_KINASE_ATP	UniProtKB/Swiss-Prot
	PROTEIN_KINASE_DOM	UniProtKB/Swiss-Prot
	PROTEIN_KINASE_ST	UniProtKB/Swiss-Prot
SMART	S_TKc	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF56112	UniProtKB/Swiss-Prot
UniProt	P26794	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2014-07-10	Pim1	Pim-1 proto-oncogene, serine/threonine kinase	Pim1	pim-1 oncogene	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-09	Pim1	pim-1 oncogene	Pim1	proviral integration site 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-11-06	Pim1	proviral integration site 1		Pim-1 oncogene	Name updated	625702	APPROVED
2002-06-10	Pim1	Pim-1 oncogene			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	2.8 kb transcript is detected in somatic cells and a 2.3 kb transcript using an alternate polyadenylation signal is expressed in testis	633536

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)