Symbol:
Cpd
Name:
carboxypeptidase D
RGD ID:
2393
Description:
Enables protein phosphatase 2A binding activity. Involved in cellular response to interleukin-2. Located in nucleus; perinuclear region of cytoplasm; and trans-Golgi network. Orthologous to human CPD (carboxypeptidase D); INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
Carboxypeptidase D precursor; gp180; metallocarboxypeptidase D
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CPD (carboxypeptidase D) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Cpd (carboxypeptidase D) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Cpd (carboxypeptidase D) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CPD (carboxypeptidase D) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CPD (carboxypeptidase D) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Cpd (carboxypeptidase D) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CPD (carboxypeptidase D) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CPD (carboxypeptidase D) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Cpd (carboxypeptidase D) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Cpd (carboxypeptidase D)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
CPD (carboxypeptidase D)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
cpdb (carboxypeptidase D, b)
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Danio rerio (zebrafish):
cpda (carboxypeptidase D, a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
cpd-1
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoInspector|SonicParanoid)
Drosophila melanogaster (fruit fly):
svr
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 62,121,681 - 62,185,638 (-) NCBI GRCr8 mRatBN7.2 10 61,623,528 - 61,687,491 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 61,623,526 - 61,687,491 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 66,269,189 - 66,333,145 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 65,774,660 - 65,838,616 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 61,244,000 - 61,309,462 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 63,325,764 - 63,389,811 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 63,325,199 - 63,389,817 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 63,024,264 - 63,088,486 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 67,327,272 - 67,390,836 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 67,340,894 - 67,404,459 (+) NCBI Celera 10 60,635,370 - 60,698,539 (-) NCBI Celera Cytogenetic Map 10 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Cpd Rat 1,1,1-trichloroethane decreases expression ISO RGD:10388 6480464 1,1,1-trichloroethane results in decreased expression of CPD mRNA CTD PMID:25270620 Cpd Rat 1,1-dichloroethene increases expression ISO RGD:10388 6480464 vinylidene chloride results in increased expression of CPD mRNA CTD PMID:26682919 Cpd Rat 1,2-dichloroethane decreases expression ISO RGD:10388 6480464 ethylene dichloride results in decreased expression of CPD mRNA CTD PMID:28189721|PMID:28960355 Cpd Rat 1,2-dimethylhydrazine decreases expression ISO RGD:10388 6480464 1,2-Dimethylhydrazine results in decreased expression of CPD mRNA CTD PMID:22206623 Cpd Rat 17alpha-ethynylestradiol increases expression ISO RGD:10388 6480464 Ethinyl Estradiol results in increased expression of CPD mRNA CTD PMID:17942748 Cpd Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of CPD mRNA CTD PMID:29097150 Cpd Rat 17alpha-ethynylestradiol multiple interactions ISO RGD:10388 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of CPD mRNA CTD PMID:17942748 Cpd Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of CPD mRNA; [Estradiol co-treated with more ... CTD PMID:11375906|PMID:26496021 Cpd Rat 17beta-estradiol increases expression ISO RGD:10388 6480464 Estradiol results in increased expression of CPD mRNA CTD PMID:39298647 Cpd Rat 17beta-estradiol affects expression EXP 6480464 Estradiol affects the expression of CPD mRNA CTD PMID:32145629 Cpd Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:10388 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of CPD mRNA CTD PMID:17942748 Cpd Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of CPD mRNA CTD PMID:34747641 Cpd Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of CPD mRNA CTD PMID:32109520 Cpd Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of CPD mRNA CTD PMID:16054898|PMID:33387578 Cpd Rat 2-hydroxypropanoic acid increases expression ISO RGD:731463 6480464 Lactic Acid results in increased expression of CPD mRNA CTD PMID:30851411 Cpd Rat 3,4-methylenedioxymethamphetamine decreases expression EXP 6480464 N-Methyl-3,4-methylenedioxyamphetamine results in decreased expression of CPD mRNA CTD PMID:30071829 Cpd Rat 4,4'-sulfonyldiphenol decreases expression ISO RGD:10388 6480464 bisphenol S results in decreased expression of CPD mRNA CTD PMID:39298647 Cpd Rat 4,4'-sulfonyldiphenol affects expression ISO RGD:731463 6480464 bisphenol S affects the expression of CPD protein CTD PMID:31945527 Cpd Rat 5-fluorouracil affects response to substance ISO RGD:731463 6480464 CPD protein affects the susceptibility to Fluorouracil CTD PMID:16217747 Cpd Rat 5-fluorouracil multiple interactions ISO RGD:731463 6480464 TP53 protein affects the reaction [Fluorouracil results in decreased expression of CPD mRNA] CTD PMID:15016801 Cpd Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of CPD mRNA CTD PMID:24780913 Cpd Rat aflatoxin B1 affects expression ISO RGD:731463 6480464 Aflatoxin B1 affects the expression of CPD protein CTD PMID:20106945 Cpd Rat aflatoxin B1 decreases methylation ISO RGD:731463 6480464 Aflatoxin B1 results in decreased methylation of CPD gene CTD PMID:27153756 Cpd Rat all-trans-retinoic acid increases expression ISO RGD:731463 6480464 Tretinoin results in increased expression of CPD mRNA CTD PMID:33167477 Cpd Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of CPD mRNA CTD PMID:16483693 Cpd Rat amphotericin B decreases expression ISO RGD:731463 6480464 Amphotericin B analog results in decreased expression of CPD mRNA CTD PMID:28534445 Cpd Rat arsane multiple interactions ISO RGD:731463 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of CPD more ... CTD PMID:39836092 Cpd Rat arsenic atom multiple interactions ISO RGD:731463 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of CPD more ... CTD PMID:39836092 Cpd Rat benzo[a]pyrene decreases expression ISO RGD:10388 6480464 Benzo(a)pyrene results in decreased expression of CPD mRNA CTD PMID:22228805 Cpd Rat benzo[a]pyrene affects methylation ISO RGD:731463 6480464 Benzo(a)pyrene affects the methylation of CPD promoter CTD PMID:27901495 Cpd Rat bilirubin IXalpha decreases expression ISO RGD:731463 6480464 Bilirubin results in decreased expression of CPD mRNA CTD PMID:20196124 Cpd Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of CPD mRNA CTD PMID:26496021 Cpd Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of CPD mRNA CTD PMID:32145629 Cpd Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CPD mRNA CTD PMID:30816183|PMID:34947998 Cpd Rat bisphenol A increases expression ISO RGD:731463 6480464 bisphenol A results in increased expression of CPD mRNA CTD PMID:29275510|PMID:36232920 Cpd Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of CPD mRNA CTD PMID:25181051|PMID:29097150 Cpd Rat butan-1-ol multiple interactions ISO RGD:731463 6480464 [[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic more ... CTD PMID:29432896 Cpd Rat butanal decreases expression ISO RGD:731463 6480464 butyraldehyde results in decreased expression of CPD mRNA CTD PMID:26079696 Cpd Rat caffeine affects phosphorylation ISO RGD:731463 6480464 Caffeine affects the phosphorylation of CPD protein CTD PMID:35688186 Cpd Rat calcitriol increases expression ISO RGD:731463 6480464 Calcitriol results in increased expression of CPD mRNA CTD PMID:16002434 Cpd Rat cannabidiol multiple interactions ISO RGD:10388 6480464 [lipopolysaccharide, E coli O55-B5 co-treated with Cannabidiol] results in decreased expression of CPD mRNA CTD PMID:30742662 Cpd Rat CGP 52608 multiple interactions ISO RGD:731463 6480464 CGP 52608 promotes the reaction [RORA protein binds to CPD gene] CTD PMID:28238834 Cpd Rat chloropicrin increases expression ISO RGD:731463 6480464 chloropicrin results in increased expression of CPD mRNA CTD PMID:26352163 Cpd Rat chloroprene increases expression EXP 6480464 Chloroprene results in increased expression of CPD mRNA CTD PMID:23125180 Cpd Rat choline multiple interactions ISO RGD:10388 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ... CTD PMID:20938992 Cpd Rat clorgyline increases expression ISO RGD:731463 6480464 Clorgyline results in increased expression of CPD mRNA CTD PMID:19691856 Cpd Rat copper atom multiple interactions ISO RGD:10388 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in increased expression more ... CTD PMID:15467011 Cpd Rat copper(0) multiple interactions ISO RGD:10388 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in increased expression more ... CTD PMID:15467011 Cpd Rat cyclosporin A decreases expression ISO RGD:731463 6480464 Cyclosporine results in decreased expression of CPD mRNA CTD PMID:25562108 Cpd Rat Dibutyl phosphate affects expression ISO RGD:731463 6480464 di-n-butylphosphoric acid affects the expression of CPD mRNA CTD PMID:37042841 Cpd Rat dibutyl phthalate increases expression ISO RGD:10388 6480464 Dibutyl Phthalate results in increased expression of CPD mRNA CTD PMID:21266533 Cpd Rat dichlorine multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in decreased expression of CPD mRNA CTD PMID:18636392 Cpd Rat dimethylarsinic acid decreases expression EXP 6480464 Cacodylic Acid results in decreased expression of CPD mRNA CTD PMID:17720352 Cpd Rat dorsomorphin multiple interactions ISO RGD:731463 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Cpd Rat doxorubicin decreases expression ISO RGD:731463 6480464 Doxorubicin results in decreased expression of CPD mRNA CTD PMID:29803840 Cpd Rat elemental selenium decreases expression ISO RGD:731463 6480464 Selenium results in decreased expression of CPD mRNA CTD PMID:19244175 Cpd Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of CPD mRNA CTD PMID:29391264 Cpd Rat epoxiconazole decreases expression ISO RGD:10388 6480464 epoxiconazole results in decreased expression of CPD mRNA CTD PMID:35436446 Cpd Rat ethanol increases expression EXP 6480464 Ethanol results in increased expression of CPD mRNA CTD PMID:15353170 Cpd Rat ethanol affects splicing ISO RGD:10388 6480464 Ethanol affects the splicing of CPD mRNA CTD PMID:30319688 Cpd Rat ethanol multiple interactions ISO RGD:731463 6480464 [[Gasoline co-treated with Ethanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic more ... CTD PMID:29432896 Cpd Rat folic acid multiple interactions ISO RGD:10388 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ... CTD PMID:20938992 Cpd Rat folic acid decreases expression ISO RGD:10388 6480464 Folic Acid results in decreased expression of CPD mRNA CTD PMID:25629700 Cpd Rat FR900359 affects phosphorylation ISO RGD:731463 6480464 FR900359 affects the phosphorylation of CPD protein CTD PMID:37730182 Cpd Rat gamma-hexachlorocyclohexane increases expression EXP 6480464 Hexachlorocyclohexane results in increased expression of CPD mRNA CTD PMID:17785943 Cpd Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of CPD mRNA CTD PMID:22061828 Cpd Rat hydrogen cyanide increases expression ISO RGD:10388 6480464 Hydrogen Cyanide results in increased expression of CPD mRNA CTD PMID:33914522 Cpd Rat isobutanol multiple interactions ISO RGD:731463 6480464 [[Gasoline co-treated with isobutyl alcohol] results in increased abundance of [Particulate Matter co-treated with Polycyclic more ... CTD PMID:29432896 Cpd Rat isotretinoin decreases expression ISO RGD:731463 6480464 Isotretinoin results in decreased expression of CPD mRNA CTD PMID:20436886 Cpd Rat ivermectin decreases expression ISO RGD:731463 6480464 Ivermectin results in decreased expression of CPD protein CTD PMID:32959892 Cpd Rat L-methionine multiple interactions ISO RGD:10388 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ... CTD PMID:20938992 Cpd Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of CPD mRNA CTD PMID:30467583 Cpd Rat methylmercury chloride increases expression ISO RGD:731463 6480464 methylmercuric chloride results in increased expression of CPD mRNA CTD PMID:23179753 Cpd Rat nitric oxide affects chemical synthesis ISO RGD:731463 6480464 CPD affects the chemical synthesis of Nitric Oxide CTD PMID:21688280 Cpd Rat nitric oxide multiple interactions ISO RGD:731463 6480464 [PRL results in increased expression of CPD mRNA] which results in increased chemical synthesis of more ... CTD PMID:21688280 Cpd Rat ozone multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in decreased expression of CPD mRNA CTD PMID:18636392 Cpd Rat perfluorooctanoic acid decreases expression EXP 6480464 perfluorooctanoic acid results in decreased expression of CPD mRNA CTD PMID:19162173 Cpd Rat phenobarbital decreases expression ISO RGD:10388 6480464 Phenobarbital results in decreased expression of CPD mRNA CTD PMID:23091169 Cpd Rat pirinixic acid multiple interactions ISO RGD:731463 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ... CTD PMID:19710929 Cpd Rat pirinixic acid decreases expression ISO RGD:10388 6480464 pirinixic acid results in decreased expression of CPD mRNA CTD PMID:23811191 Cpd Rat potassium cyanide increases expression ISO RGD:10388 6480464 Potassium Cyanide results in increased expression of CPD mRNA CTD PMID:33914522 Cpd Rat procymidone increases expression EXP 6480464 procymidone results in increased expression of CPD mRNA CTD PMID:15686871 Cpd Rat protein kinase inhibitor multiple interactions ISO RGD:731463 6480464 Protein Kinase Inhibitors inhibits the reaction [gardiquimod results in increased expression of CPD mRNA] CTD PMID:28003376 Cpd Rat rac-lactic acid increases expression ISO RGD:731463 6480464 Lactic Acid results in increased expression of CPD mRNA CTD PMID:30851411 Cpd Rat resveratrol multiple interactions ISO RGD:731463 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of CPD mRNA CTD PMID:23557933 Cpd Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of CPD protein CTD PMID:35544339 Cpd Rat SB 431542 multiple interactions ISO RGD:731463 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Cpd Rat selenium atom decreases expression ISO RGD:731463 6480464 Selenium results in decreased expression of CPD mRNA CTD PMID:19244175 Cpd Rat silicon dioxide decreases expression ISO RGD:731463 6480464 Silicon Dioxide analog results in decreased expression of CPD mRNA CTD PMID:25895662 Cpd Rat sodium arsenate increases expression ISO RGD:10388 6480464 sodium arsenate results in increased expression of CPD mRNA CTD PMID:21795629 Cpd Rat sodium arsenite increases expression ISO RGD:731463 6480464 sodium arsenite results in increased expression of CPD mRNA CTD PMID:38568856 Cpd Rat sodium arsenite multiple interactions ISO RGD:731463 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of CPD more ... CTD PMID:39836092 Cpd Rat succimer multiple interactions ISO RGD:10388 6480464 [Succimer binds to Magnetite Nanoparticles] which results in increased expression of CPD mRNA; [Succimer co-treated more ... CTD PMID:21641980|PMID:26378955 Cpd Rat sulforaphane increases expression ISO RGD:731463 6480464 sulforaphane results in increased expression of CPD mRNA CTD PMID:26833863 Cpd Rat testosterone multiple interactions ISO RGD:731463 6480464 [Testosterone results in increased expression of CPD mRNA] which results in increased chemical synthesis of more ... CTD PMID:21688280 Cpd Rat testosterone multiple interactions EXP 6480464 [Estradiol co-treated with Testosterone] results in increased expression of CPD mRNA CTD PMID:11375906 Cpd Rat testosterone increases expression ISO RGD:731463 6480464 Testosterone results in increased expression of CPD mRNA; Testosterone results in increased expression of CPD more ... CTD PMID:21688280 Cpd Rat tetrachloroethene increases expression ISO RGD:10388 6480464 Tetrachloroethylene results in increased expression of CPD mRNA CTD PMID:28973375 Cpd Rat tetrachloromethane affects expression ISO RGD:10388 6480464 Carbon Tetrachloride affects the expression of CPD mRNA CTD PMID:17484886 Cpd Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of CPD mRNA CTD PMID:34492290 Cpd Rat titanium dioxide decreases methylation ISO RGD:10388 6480464 titanium dioxide results in decreased methylation of CPD gene CTD PMID:35295148 Cpd Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of CPD gene CTD PMID:27618143 Cpd Rat trichostatin A decreases expression ISO RGD:731463 6480464 trichostatin A results in decreased expression of CPD mRNA CTD PMID:26272509 Cpd Rat trichostatin A multiple interactions ISO RGD:731463 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Cpd Rat triphenyl phosphate affects expression ISO RGD:731463 6480464 triphenyl phosphate affects the expression of CPD mRNA CTD PMID:37042841 Cpd Rat triptonide increases expression ISO RGD:10388 6480464 triptonide results in increased expression of CPD mRNA CTD PMID:33045310 Cpd Rat troglitazone decreases expression ISO RGD:10388 6480464 troglitazone results in decreased expression of CPD mRNA CTD PMID:28973697 Cpd Rat tungsten decreases expression ISO RGD:10388 6480464 Tungsten results in decreased expression of CPD mRNA CTD PMID:30912803 Cpd Rat tunicamycin decreases expression ISO RGD:10388 6480464 Tunicamycin results in decreased expression of CPD mRNA CTD PMID:17127020 Cpd Rat urethane decreases expression ISO RGD:10388 6480464 Urethane results in decreased expression of CPD mRNA CTD PMID:16289808 Cpd Rat valproic acid increases expression ISO RGD:731463 6480464 Valproic Acid results in increased expression of CPD mRNA CTD PMID:23179753|PMID:29154799 Cpd Rat valproic acid affects splicing EXP 6480464 Valproic Acid affects the splicing of CPD mRNA CTD PMID:29427782 Cpd Rat venlafaxine hydrochloride increases expression EXP 6480464 Venlafaxine Hydrochloride results in increased expression of CPD mRNA CTD PMID:25423262 Cpd Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of CPD mRNA CTD PMID:23034163 Cpd Rat zoledronic acid increases expression ISO RGD:731463 6480464 zoledronic acid results in increased expression of CPD mRNA CTD PMID:20977926
1,1,1-trichloroethane (ISO) 1,1-dichloroethene (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-hydroxypropanoic acid (ISO) 3,4-methylenedioxymethamphetamine (EXP) 4,4'-sulfonyldiphenol (ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP) amphotericin B (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) bilirubin IXalpha (ISO) bisphenol A (EXP,ISO) butan-1-ol (ISO) butanal (ISO) caffeine (ISO) calcitriol (ISO) cannabidiol (ISO) CGP 52608 (ISO) chloropicrin (ISO) chloroprene (EXP) choline (ISO) clorgyline (ISO) copper atom (ISO) copper(0) (ISO) cyclosporin A (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) dichlorine (EXP) dimethylarsinic acid (EXP) dorsomorphin (ISO) doxorubicin (ISO) elemental selenium (ISO) endosulfan (EXP) epoxiconazole (ISO) ethanol (EXP,ISO) folic acid (ISO) FR900359 (ISO) gamma-hexachlorocyclohexane (EXP) gentamycin (EXP) hydrogen cyanide (ISO) isobutanol (ISO) isotretinoin (ISO) ivermectin (ISO) L-methionine (ISO) methapyrilene (EXP) methylmercury chloride (ISO) nitric oxide (ISO) ozone (EXP) perfluorooctanoic acid (EXP) phenobarbital (ISO) pirinixic acid (ISO) potassium cyanide (ISO) procymidone (EXP) protein kinase inhibitor (ISO) rac-lactic acid (ISO) resveratrol (ISO) rotenone (EXP) SB 431542 (ISO) selenium atom (ISO) silicon dioxide (ISO) sodium arsenate (ISO) sodium arsenite (ISO) succimer (ISO) sulforaphane (ISO) testosterone (EXP,ISO) tetrachloroethene (ISO) tetrachloromethane (ISO) thioacetamide (EXP) titanium dioxide (ISO) trichloroethene (EXP) trichostatin A (ISO) triphenyl phosphate (ISO) triptonide (ISO) troglitazone (ISO) tungsten (ISO) tunicamycin (ISO) urethane (ISO) valproic acid (EXP,ISO) venlafaxine hydrochloride (EXP) vinclozolin (EXP) zoledronic acid (ISO)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
3.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
4.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.
Characterization of a novel, cytokine-inducible carboxypeptidase D isoform in haematopoietic tumour cells.
O'Malley PG, etal., Biochem J. 2005 Sep 15;390(Pt 3):665-73.
6.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
8.
Identification and nuclear localization of a novel prolactin and cytokine-responsive carboxypeptidase D.
Too CK, etal., Endocrinology 2001 Mar;142(3):1357-67.
9.
Cloning and sequence analysis of cDNA encoding rat carboxypeptidase D.
Xin X, etal., DNA Cell Biol 1997 Jul;16(7):897-909.
Cpd Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 62,121,681 - 62,185,638 (-) NCBI GRCr8 mRatBN7.2 10 61,623,528 - 61,687,491 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 61,623,526 - 61,687,491 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 66,269,189 - 66,333,145 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 65,774,660 - 65,838,616 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 61,244,000 - 61,309,462 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 63,325,764 - 63,389,811 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 63,325,199 - 63,389,817 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 63,024,264 - 63,088,486 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 67,327,272 - 67,390,836 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 67,340,894 - 67,404,459 (+) NCBI Celera 10 60,635,370 - 60,698,539 (-) NCBI Celera Cytogenetic Map 10 q24 NCBI
CPD Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 30,378,927 - 30,469,989 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 30,378,927 - 30,469,989 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 28,705,945 - 28,797,007 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 25,730,110 - 25,819,825 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 17 25,730,109 - 25,819,825 NCBI Celera 17 25,567,489 - 25,657,199 (+) NCBI Celera Cytogenetic Map 17 q11.2 NCBI HuRef 17 24,915,981 - 25,006,704 (+) NCBI HuRef CHM1_1 17 28,768,174 - 28,859,153 (+) NCBI CHM1_1 T2T-CHM13v2.0 17 31,323,558 - 31,414,615 (+) NCBI T2T-CHM13v2.0
Cpd Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 76,668,034 - 76,737,834 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 76,669,250 - 76,737,844 (-) Ensembl GRCm39 Ensembl GRCm38 11 76,777,208 - 76,847,008 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 76,778,424 - 76,847,018 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 76,590,710 - 76,660,510 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 76,598,184 - 76,663,191 (-) NCBI MGSCv36 mm8 Celera 11 84,282,160 - 84,345,782 (-) NCBI Celera Cytogenetic Map 11 B5 NCBI cM Map 11 46.05 NCBI
Cpd Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955481 2,889,156 - 2,951,495 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955481 2,885,243 - 2,951,574 (-) NCBI ChiLan1.0 ChiLan1.0
CPD Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 33,983,409 - 34,070,840 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 35,864,051 - 35,951,350 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 26,302,112 - 26,389,049 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 26,821,641 - 26,908,252 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 26,821,641 - 26,908,257 (-) Ensembl panpan1.1 panPan2
CPD Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 9 44,388,147 - 44,469,775 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 9 44,388,219 - 44,466,074 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 9 43,539,778 - 43,621,450 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 9 45,207,559 - 45,287,811 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 9 45,207,487 - 45,286,195 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 9 43,987,222 - 44,067,108 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 9 44,274,017 - 44,354,213 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 9 44,358,343 - 44,440,254 (+) NCBI UU_Cfam_GSD_1.0
Cpd Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 43,502,080 - 43,576,174 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936538 6,379,999 - 6,454,122 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936538 6,380,046 - 6,454,117 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CPD Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 12 46,462,265 - 46,533,022 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 12 46,462,203 - 46,533,032 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 12 48,551,808 - 48,622,822 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CPD Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 16 24,106,406 - 24,196,998 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 16 24,106,883 - 24,193,129 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666075 5,862,697 - 5,952,891 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Cpd
.
Predicted Target Of
Count of predictions: 126 Count of miRNA genes: 95 Interacting mature miRNAs: 108 Transcripts: ENSRNOT00000005262 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
61441 Btemp1 Thermal response to stress QTL 1 4 body temperature trait (VT:0005535) core body temperature (CMO:0001036) 10 35392457 63642539 Rat 1549846 Scl47 Serum cholesterol level QTL 47 3.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 50574707 95574707 Rat 152025229 Scl83 Serum cholesterol level QTL 83 4.33 blood cholesterol amount (VT:0000180) 10 35710580 68663659 Rat 1578779 Tcas10 Tongue tumor susceptibility QTL 10 3.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 10 31297439 76297439 Rat 152025227 Bw195 Body weight QTL 195 5.73 body mass (VT:0001259) 10 46989699 68663659 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 2293669 Bmd33 Bone mineral density QTL 33 4.5 0.0001 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 10 49444551 81709989 Rat 152025224 Bw193 Body weight QTL 193 6.47 body mass (VT:0001259) 10 51663405 75085664 Rat 631552 Vetf2 Vascular elastic tissue fragility QTL 2 4.5 0.0002 aorta elastic tissue integrity trait (VT:0010556) artery internal elastic lamina non-tumorous lesion count (CMO:0001913) 10 41142633 86142633 Rat 631554 Bp133 Blood pressure QTL 133 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 743364 63851208 Rat 631557 Bp136 Blood pressure QTL 136 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 30632053 75632053 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1298078 Stresp5 Stress response QTL 5 2.99 0.00025 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 42045676 104670812 Rat 2293679 Bmd30 Bone mineral density QTL 30 3.5 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 1549831 Bss6 Bone structure and strength QTL 6 4 lumbar vertebra strength trait (VT:0010574) vertebra ultimate force (CMO:0001678) 10 57576521 102576521 Rat 2298544 Neuinf9 Neuroinflammation QTL 9 4.6 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 10 5801990 62146030 Rat 70164 Bw21 Body weight QTL 21 4.36 0.00005 body mass (VT:0001259) body weight (CMO:0000012) 10 53797494 98952626 Rat 61463 Bp12 Blood pressure QTL 12 6.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 41333258 86333258 Rat 8694173 Bw149 Body weight QTL 149 4.38 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 10 44441699 89441699 Rat 2300218 Hpcl2 Hepatic cholesterol level QTL 2 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 45029650 95600334 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 70171 Cari1 Carrageenan-induced inflammation QTL 1 4.9 0.0005 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 10 53797385 107211142 Rat 1598852 Anxrr19 Anxiety related response QTL 19 5.07 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 10 18167841 63167841 Rat 724527 Bp148 Blood pressure QTL 148 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 28453136 73453136 Rat 1358897 Stresp6 Stress response QTL 6 4.17 0.022 blood norepinephrine amount (VT:0005663) plasma norepinephrine level (CMO:0001010) 10 35392267 64155584 Rat 1331762 Rf40 Renal function QTL 40 3.873 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 10 29299504 64155584 Rat 2300171 Bmd58 Bone mineral density QTL 58 4.9 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 26944628 71944628 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2301967 Cm73 Cardiac mass QTL 73 4.55 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 10 14487011 89062041 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 70188 BpQTLcluster1 Blood pressure QTL cluster 1 4.864 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 42323132 87323132 Rat 9589030 Epfw9 Epididymal fat weight QTL 9 19.24 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 10 44441699 89441699 Rat 10402859 Bp381 Blood pressure QTL 381 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 2293652 Bmd22 Bone mineral density QTL 22 4.9 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 70198 BpQTLcluster9 Blood pressure QTL cluster 9 2.94 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 42323132 87323132 Rat 2306970 Anxrr22 Anxiety related response QTL 22 5.95 fear/anxiety-related behavior trait (VT:1000241) number of periods of voluntary immobility (CMO:0001045) 10 61345276 98211570 Rat 1359017 Hrtrt21 Heart rate QTL 21 2.4 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 10 51772940 96772940 Rat 2306787 Ean3 Experimental allergic neuritis QTL 3 3.1 nervous system integrity trait (VT:0010566) body weight loss (CMO:0001399) 10 53797385 66979128 Rat 2312672 Insul15 Insulin level QTL 15 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 10 57134272 102134272 Rat 724556 Pur2 Proteinuria QTL 2 5.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 22427500 90627625 Rat 8662860 Vetf10 Vascular elastic tissue fragility QTL 10 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 10 6154182 73453136 Rat 61387 Bp1 Blood pressure QTL 1 5.1 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 51770177 107211142 Rat 70223 Bp57 Blood pressure QTL 57 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 1 80676123 Rat 2317043 Aia7 Adjuvant induced arthritis QTL 7 3.82 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 37565079 82565079 Rat 2317042 Aia20 Adjuvant induced arthritis QTL 20 3.38 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 37565079 82565079 Rat 70363 Bp71 Blood pressure QTL 71 0.04 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 61345276 81714865 Rat 61402 Niddm3 Non-insulin dependent diabetes mellitus QTL 3 4.58 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 61345413 82564856 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 2313087 Bmd80 Bone mineral density QTL 80 3.2 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 10 19606483 64606483 Rat 70364 Bp72 Blood pressure QTL 72 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 51121100 96121100 Rat 2293698 Bss43 Bone structure and strength QTL 43 5.33 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 10 59209888 104209888 Rat 631530 Tls3 T-lymphoma susceptibility QTL 3 0 0.0001 thymus integrity trait (VT:0010555) percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911) 10 51774612 95600334 Rat 1354608 Cm33 Cardiac mass QTL 33 2.8 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 10 54809292 99809292 Rat 1558643 Cm44 Cardiac mass QTL 44 4.8 0.0000368 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 61345276 99703528 Rat 631535 Cm51 Cardiac mass QTL 51 3 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 10 51786282 91669536 Rat 1576319 Cia29 Collagen induced arthritis QTL 29 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 33973921 78973921 Rat 8552805 Bw145 Body weight QTL 145 2.2 body mass (VT:0001259) change in body weight to body weight ratio (CMO:0002216) 10 41944526 78307017 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2293705 Bmd25 Bone mineral density QTL 25 7.1 0.0001 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 10 49444551 81709989 Rat 1331839 Eae18b Experimental allergic encephalomyelitis QTL 18b 5.8 0.03 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis severity score (CMO:0001419) 10 61248303 67785171 Rat 1576308 Schws1 Schwannoma susceptibility QTL 1 0.0041 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 40035094 102359817 Rat 631269 Cia22 Collagen induced arthritis QTL 22 8.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 7207811 Bmd90 Bone mineral density QTL 90 5.2 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 10 49444551 81709989 Rat 1576311 Pia26 Pristane induced arthritis QTL 26 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 31224026 75632053 Rat 631270 Cia23 Collagen induced arthritis QTL 23 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 7411614 Foco18 Food consumption QTL 18 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 44441699 89441699 Rat 631526 Bp76 Blood pressure QTL 76 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 61345413 66743655 Rat 6893336 Cm75 Cardiac mass QTL 75 0.1 0.87 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 61345276 99703528 Rat 631547 Bp87 Blood pressure QTL 87 4.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 47369470 92369470 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 2312662 Slep8 Serum leptin concentration QTL 8 0.05 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 10 57134272 102134272 Rat 6893342 Cm78 Cardiac mass QTL 78 0.1 0.88 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 42876766 79813922 Rat 2292441 Bp308 Blood pressure QTL 308 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2313055 Bw96 Body weight QTL 96 3.6 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 10 19606483 64606483 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat 2312668 Scl65 Serum cholesterol level QTL 65 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 57134272 102134272 Rat
D85391
Rat Assembly Chr Position (strand) Source JBrowse RGSC_v3.4 10 67,390,633 - 67,390,766 UniSTS RGSC3.4 Celera 10 60,635,440 - 60,635,534 UniSTS Cytogenetic Map 10 q26 UniSTS
STS-H01467
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 61,620,069 - 61,620,200 (-) MAPPER mRatBN7.2 Rnor_6.0 10 63,393,139 - 63,393,269 NCBI Rnor6.0 Rnor_5.0 10 63,091,814 - 63,091,944 UniSTS Rnor5.0 RGSC_v3.4 10 67,394,164 - 67,394,294 UniSTS RGSC3.4 Celera 10 60,631,912 - 60,632,042 UniSTS Cytogenetic Map 10 q26 UniSTS
AA960140
Rat Assembly Chr Position (strand) Source JBrowse Celera 10 60,632,010 - 60,632,110 UniSTS Cytogenetic Map 10 q26 UniSTS
RH142190
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 61,623,567 - 61,623,718 (-) MAPPER mRatBN7.2 Rnor_6.0 10 63,389,621 - 63,389,771 NCBI Rnor6.0 Rnor_5.0 10 63,088,296 - 63,088,446 UniSTS Rnor5.0 RGSC_v3.4 10 67,390,646 - 67,390,796 UniSTS RGSC3.4 Celera 10 60,635,410 - 60,635,560 UniSTS Cytogenetic Map 10 q26 UniSTS
BE120708
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 61,638,720 - 61,638,917 (-) MAPPER mRatBN7.2 Rnor_6.0 10 63,374,281 - 63,374,477 NCBI Rnor6.0 Rnor_5.0 10 63,072,956 - 63,073,152 UniSTS Rnor5.0 RGSC_v3.4 10 67,375,448 - 67,375,644 UniSTS RGSC3.4 Celera 10 60,650,562 - 60,650,758 UniSTS Cytogenetic Map 10 q26 UniSTS
D85391
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 61,623,597 - 61,623,731 (-) MAPPER mRatBN7.2 Rnor_6.0 10 63,389,608 - 63,389,741 NCBI Rnor6.0 Rnor_5.0 10 63,088,283 - 63,088,416 UniSTS Rnor5.0 RGSC_v3.4 10 67,390,633 - 67,390,766 UniSTS RGSC3.4 Celera 10 60,635,440 - 60,635,573 UniSTS Cytogenetic Map 10 q26 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000005262 ⟹ ENSRNOP00000005262
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 61,623,526 - 61,687,491 (-) Ensembl Rnor_6.0 Ensembl 10 63,325,199 - 63,389,817 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000084535 ⟹ ENSRNOP00000070498
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 10 63,327,555 - 63,389,813 (+) Ensembl
RefSeq Acc Id:
NM_012836 ⟹ NP_036968
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 62,121,681 - 62,185,638 (-) NCBI mRatBN7.2 10 61,623,528 - 61,687,491 (-) NCBI Rnor_6.0 10 63,325,764 - 63,389,811 (+) NCBI Rnor_5.0 10 63,024,264 - 63,088,486 (+) NCBI RGSC_v3.4 10 67,327,272 - 67,390,836 (+) RGD Celera 10 60,635,370 - 60,698,539 (-) RGD
Sequence:
TGCGGAGCCGCTGGAGCGGAGCGGTGTTAGCGGCGTTGCTGGAAGATGGCGAGCGGCTGGGATGAGCGGCCGCCCTGGCGGCTGGAAAGCCTGCGGCTGCTACCGCCGCCACCGCTGCTGCTGCTACT
hide sequence
RefSeq Acc Id:
NP_036968 ⟸ NM_012836
- Peptide Label:
precursor
- UniProtKB:
O35850 (UniProtKB/Swiss-Prot), Q9JHW1 (UniProtKB/Swiss-Prot), F1LPC6 (UniProtKB/TrEMBL)
- Sequence:
MASGWDERPPWRLESLRLLPPPPLLLLLLLLRSSAQAAHIKKAEATTTTVGGSEAAEGQFDHYYHEAALGEALEAAAAAGPPGLARLFSIGNSVEGRPLWVLRLTAGLGPPPTPAAVGLDAAGPLLPG
hide sequence
Ensembl Acc Id:
ENSRNOP00000070498 ⟸ ENSRNOT00000084535
Ensembl Acc Id:
ENSRNOP00000005262 ⟸ ENSRNOT00000005262
RGD ID: 13697434 Promoter ID: EPDNEW_R7959 Type: initiation region Name: Cpd_1 Description: carboxypeptidase D SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 63,325,760 - 63,325,820 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-11-06
Cpd
carboxypeptidase D
Carboxypeptidase D precursor
Name updated
625702 APPROVED
2002-06-10
Cpd
Carboxypeptidase D precursor
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_expression
expressed in most tissues examined; highest expression in hippocampus, spinal cord, heart, colon, testis and ovaries
1298781
gene_process
may participate in peptide processing in the secretory pathway
1298781
gene_product
putative carboxypeptidase protein
1298781
gene_regulation
CPD-N alternative transcript is induced by prolactin treatment in lymphoma cell lines
1298782
gene_transcript
CPD-N alternative transcript is nuclear targeted
1298782
