Symbol:
Arnt
Name:
aryl hydrocarbon receptor nuclear translocator
RGD ID:
2153
Description:
Contributes to sequence-specific DNA binding activity. Involved in several processes, including G1 to G0 transition; nitric oxide metabolic process; and response to dexamethasone. Predicted to be located in cytoplasm and nuclear body. Predicted to be part of RNA polymerase II transcription regulator complex and nuclear aryl hydrocarbon receptor complex. Predicted to be active in nucleus. Biomarker of hypertension. Human ortholog(s) of this gene implicated in renal cell carcinoma. Orthologous to human ARNT (aryl hydrocarbon receptor nuclear translocator); PARTICIPATES IN aryl hydrocarbon receptor signaling pathway; hypoxia inducible factor pathway; renal cell carcinoma pathway; INTERACTS WITH (S)-nicotine; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Arnt1; Aryl hydrocarbon receptor nuclear translocator 1; dioxin receptor, nuclear translocator; HIF-1 beta; HIF-1-beta; HIF1-beta; hypoxia-inducible factor 1 beta; hypoxia-inducible factor 1-beta
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 185,686,703 - 185,745,546 (+) NCBI GRCr8 mRatBN7.2 2 182,997,731 - 183,056,584 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 182,997,736 - 183,056,580 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 190,662,514 - 190,721,330 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 188,458,053 - 188,516,629 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 183,295,003 - 183,353,822 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 196,594,178 - 196,651,486 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 196,594,303 - 196,651,179 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 216,092,481 - 216,150,842 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 190,333,978 - 190,391,015 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 190,296,731 - 190,353,769 (+) NCBI Celera 2 175,530,933 - 175,587,940 (+) NCBI Celera Cytogenetic Map 2 q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Arnt Rat (-)-epigallocatechin 3-gallate multiple interactions ISO ARNT (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of ARNT mRNA and epigallocatechin gallate inhibits the reaction [Tetrachlorodibenzodioxin results in increased phosphorylation of ARNT protein] CTD PMID:20450880 and PMID:22079256 Arnt Rat (-)-epigallocatechin 3-gallate multiple interactions ISO Arnt (Mus musculus) 6480464 epigallocatechin gallate inhibits the reaction [Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to ARNT protein]] CTD PMID:20450880 Arnt Rat (1->4)-beta-D-glucan multiple interactions ISO Arnt (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of ARNT mRNA CTD PMID:36331819 Arnt Rat (S)-naringenin multiple interactions ISO ARNT (Homo sapiens) 6480464 naringenin inhibits the reaction [Tetrachlorodibenzodioxin results in increased phosphorylation of ARNT protein] CTD PMID:20450880 Arnt Rat (S)-naringenin multiple interactions ISO Arnt (Mus musculus) 6480464 naringenin inhibits the reaction [Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to ARNT protein]] CTD PMID:20450880 Arnt Rat (S)-nicotine decreases expression EXP 6480464 Nicotine results in decreased expression of ARNT protein CTD PMID:35577041 Arnt Rat 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane decreases expression ISO Arnt (Mus musculus) 6480464 o more ... CTD PMID:28263910 Arnt Rat 1,2-dimethylhydrazine decreases expression ISO Arnt (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of ARNT mRNA CTD PMID:22206623 Arnt Rat 1,2-naphthoquinone multiple interactions ISO Arnt (Mus musculus) 6480464 1 and 2-naphthoquinone promotes the reaction [AHR protein binds to ARNT protein] CTD PMID:26558468 and PMID:27853106 Arnt Rat 17alpha-ethynylestradiol affects expression ISO Arnt (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of ARNT mRNA CTD PMID:17555576 Arnt Rat 17beta-estradiol multiple interactions ISO ARNT (Homo sapiens) 6480464 [Tetrachlorodibenzodioxin binds to and results in increased activity of [AHR protein binds to ARNT protein]] inhibits the reaction [Estradiol results in increased expression of CTSD mRNA] more ... CTD PMID:11165043 more ... Arnt Rat 17beta-estradiol decreases expression ISO ARNT (Homo sapiens) 6480464 Estradiol results in decreased expression of ARNT mRNA CTD PMID:31614463 Arnt Rat 17beta-estradiol decreases expression ISO Arnt (Mus musculus) 6480464 Estradiol results in decreased expression of ARNT mRNA CTD PMID:39298647 Arnt Rat 17beta-estradiol affects response to substance ISO ARNT (Homo sapiens) 6480464 ARNT protein affects the susceptibility to Estradiol CTD PMID:22235307 Arnt Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of ARNT mRNA CTD PMID:22127542 Arnt Rat 17beta-estradiol multiple interactions EXP 6480464 11-fluoro-7-(14 more ... CTD PMID:22127542 and PMID:24777823 Arnt Rat 17beta-estradiol affects expression EXP 6480464 Estradiol affects the expression of ARNT mRNA CTD PMID:24777823 Arnt Rat 17beta-estradiol multiple interactions ISO Arnt (Mus musculus) 6480464 Estradiol promotes the reaction [ARNT protein binds to FOS promoter] and Tetrachlorodibenzodioxin inhibits the reaction [Estradiol promotes the reaction [ARNT protein binds to FOS promoter]] CTD PMID:17991765 Arnt Rat 1H-indole multiple interactions ISO ARNT (Homo sapiens) 6480464 indole results in increased activity of [AHR protein binds to ARNT protein] CTD PMID:9407059 Arnt Rat 2,3,4,7,8-Pentachlorodibenzofuran multiple interactions ISO ARNT (Homo sapiens) 6480464 2 more ... CTD PMID:11294989 and PMID:21703235 Arnt Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Arnt (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of ARNT mRNA CTD PMID:21570461 and PMID:24058054 Arnt Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Arnt (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of ARNT mRNA CTD PMID:10048155 and PMID:24709672 Arnt Rat 2,3,7,8-tetrachlorodibenzodioxine affects localization ISO ARNT (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the localization of ARNT protein CTD PMID:25826687 Arnt Rat 2,3,7,8-tetrachlorodibenzodioxine increases phosphorylation EXP 6480464 Tetrachlorodibenzodioxin results in increased phosphorylation of ARNT protein CTD PMID:23298284 Arnt Rat 2,3,7,8-tetrachlorodibenzodioxine increases phosphorylation ISO Arnt (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased phosphorylation of ARNT protein CTD PMID:17880909 Arnt Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO ARNT (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of ARNT mRNA and Tetrachlorodibenzodioxin results in increased expression of ARNT protein CTD PMID:12727795 more ... Arnt Rat 2,3,7,8-tetrachlorodibenzodioxine affects binding EXP 6480464 [[Tetrachlorodibenzodioxin binds to AHR protein] which binds to ARNT protein] which binds to CYP1A1 enhancer and [Tetrachlorodibenzodioxin binds to AHR protein] which binds to ARNT protein CTD PMID:7808420 and PMID:9056263 Arnt Rat 2,3,7,8-tetrachlorodibenzodioxine affects response to substance ISO Arnt (Mus musculus) 6480464 ARNT protein affects the susceptibility to Tetrachlorodibenzodioxin CTD PMID:14530333 and PMID:9624117 Arnt Rat 2,3,7,8-tetrachlorodibenzodioxine increases phosphorylation ISO ARNT (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased phosphorylation of ARNT protein CTD PMID:20450880 Arnt Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of ARNT mRNA CTD PMID:20959002 and PMID:21215274 Arnt Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Arnt (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of ARNT mRNA CTD PMID:15667827 more ... Arnt Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of ARNT mRNA and Tetrachlorodibenzodioxin results in increased expression of ARNT protein CTD PMID:12128104 and PMID:28341572 Arnt Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 ARNT protein affects the reaction [Tetrachlorodibenzodioxin results in increased expression of CYP1A1 mRNA] more ... CTD PMID:12859982 more ... Arnt Rat 2,3,7,8-tetrachlorodibenzodioxine increases localization ISO Arnt (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased localization of ARNT protein CTD PMID:14761680 Arnt Rat 2,3,7,8-tetrachlorodibenzodioxine increases response to substance ISO Arnt (Mus musculus) 6480464 ARNT results in increased susceptibility to Tetrachlorodibenzodioxin CTD PMID:20935161 Arnt Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Arnt (Mus musculus) 6480464 3'-methoxy-4'-nitroflavone inhibits the reaction [Tetrachlorodibenzodioxin results in increased activity of [AHR protein binds to ARNT protein]] more ... CTD PMID:10581206 more ... Arnt Rat 2,3,7,8-tetrachlorodibenzodioxine increases activity ISO ARNT (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased activity of ARNT protein CTD PMID:15982688 Arnt Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO ARNT (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of ARNT mRNA and Tetrachlorodibenzodioxin results in decreased expression of ARNT protein CTD PMID:15075337 and PMID:9783729 Arnt Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO ARNT (Homo sapiens) 6480464 3 more ... CTD PMID:11165043 more ... Arnt Rat 2,3,7,8-Tetrachlorodibenzofuran multiple interactions ISO ARNT (Homo sapiens) 6480464 2 more ... CTD PMID:11294989 and PMID:21703235 Arnt Rat 2,3,7,8-Tetrachlorodibenzofuran multiple interactions EXP 6480464 2 more ... CTD PMID:20951181 Arnt Rat 2-hydroxypropanoic acid multiple interactions ISO Arnt (Mus musculus) 6480464 ARNT promotes the reaction [beta-Naphthoflavone results in decreased abundance of Lactic Acid] CTD PMID:21849270 Arnt Rat 3',4'-dimethoxyflavone decreases expression ISO ARNT (Homo sapiens) 6480464 3' and 4'-dimethoxyflavone results in decreased expression of ARNT protein CTD PMID:22138065 Arnt Rat 3',4'-dimethoxyflavone multiple interactions ISO ARNT (Homo sapiens) 6480464 3' more ... CTD PMID:22138065 Arnt Rat 3',5'-cyclic AMP multiple interactions EXP 6480464 Cyclic AMP inhibits the reaction [AHR protein binds to ARNT protein] CTD PMID:12859982 Arnt Rat 3,3',4,4',5-pentachlorobiphenyl multiple interactions EXP 6480464 AHR gene mutant form inhibits the reaction [3 more ... CTD PMID:34256052 Arnt Rat 3,3',4,4',5-pentachlorobiphenyl affects expression ISO Arnt (Mus musculus) 6480464 3 more ... CTD PMID:37080397 Arnt Rat 3,3',4,4',5-pentachlorobiphenyl increases expression EXP 6480464 3 more ... CTD PMID:34256052 Arnt Rat 3,3',4,4'-tetrachlorobiphenyl multiple interactions EXP 6480464 3 more ... CTD PMID:18708364 Arnt Rat 3,3',4,4'-tetrachlorobiphenyl multiple interactions ISO ARNT (Homo sapiens) 6480464 3 more ... CTD PMID:11294989 more ... Arnt Rat 3,3'-diindolylmethane multiple interactions ISO ARNT (Homo sapiens) 6480464 3 and 3'-diindolylmethane promotes the reaction [ARNT protein binds to CYP1A1 promoter] CTD PMID:16972788 Arnt Rat 3,4-methylenedioxymethamphetamine increases expression ISO Arnt (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of ARNT mRNA CTD PMID:20188158 Arnt Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Arnt (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of ARNT mRNA CTD PMID:26251327 Arnt Rat 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione multiple interactions ISO Arnt (Mus musculus) 6480464 bisindolylmaleimide I inhibits the reaction [benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased expression of ARNT mRNA] CTD PMID:14529614 Arnt Rat 3-methylcholanthrene multiple interactions ISO ARNT (Homo sapiens) 6480464 [AHR gene mutant form binds to ARNT protein] which results in decreased susceptibility to Methylcholanthrene more ... CTD PMID:11768231 more ... Arnt Rat 3-methylcholanthrene increases expression EXP 6480464 Methylcholanthrene results in increased expression of ARNT mRNA CTD PMID:19951702 and PMID:23273579 Arnt Rat 3-methylcholanthrene increases localization ISO ARNT (Homo sapiens) 6480464 Methylcholanthrene results in increased localization of ARNT protein CTD PMID:21756928 Arnt Rat 3-methylcholanthrene multiple interactions ISO Arnt (Mus musculus) 6480464 Cycloheximide promotes the reaction [Methylcholanthrene promotes the reaction [ARNT protein binds to CYP1A1 enhancer]] and Methylcholanthrene promotes the reaction [ARNT protein binds to CYP1A1 enhancer] CTD PMID:20570689 Arnt Rat 4,4'-sulfonyldiphenol decreases expression ISO Arnt (Mus musculus) 6480464 bisphenol S results in decreased expression of ARNT mRNA CTD PMID:39298647 Arnt Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of ARNT mRNA CTD PMID:36041667 Arnt Rat 4,4'-sulfonyldiphenol multiple interactions ISO ARNT (Homo sapiens) 6480464 [bisphenol S co-treated with Fulvestrant] results in increased methylation of ARNT gene CTD PMID:31601247 Arnt Rat 4-vinylcyclohexene dioxide affects expression ISO Arnt (Mus musculus) 6480464 4-vinyl-1-cyclohexene dioxide affects the expression of ARNT mRNA CTD PMID:20829426 Arnt Rat 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole affects localization ISO ARNT (Homo sapiens) 6480464 Omeprazole affects the localization of ARNT protein CTD PMID:25826687 Arnt Rat 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole multiple interactions EXP 6480464 Omeprazole affects the localization of [ARNT protein co-treated with AHR protein] CTD PMID:9395520 Arnt Rat 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole multiple interactions ISO ARNT (Homo sapiens) 6480464 Omeprazole promotes the reaction [ARNT protein binds to CYP1A1 promoter] and Omeprazole promotes the reaction [ARNT protein binds to CYP1B1 promoter] CTD PMID:21703235 Arnt Rat 7,12-dimethyltetraphene increases expression EXP 6480464 9 more ... CTD PMID:33759307 Arnt Rat 7,12-dimethyltetraphene multiple interactions EXP 6480464 betulin inhibits the reaction [9 more ... CTD PMID:33759307 Arnt Rat acrolein multiple interactions ISO ARNT (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of ARNT mRNA more ... CTD PMID:32699268 and PMID:32845096 Arnt Rat acteoside increases localization ISO ARNT (Homo sapiens) 6480464 acteoside results in increased localization of ARNT protein CTD PMID:21756928 Arnt Rat actinomycin D multiple interactions ISO Arnt (Mus musculus) 6480464 ARNT protein promotes the reaction [Dactinomycin inhibits the reaction [Tetrachlorodibenzodioxin results in increased degradation of AHR protein]] CTD PMID:16226227 Arnt Rat afimoxifene multiple interactions ISO ARNT (Homo sapiens) 6480464 afimoxifene promotes the reaction [AHR protein binds to ARNT protein] CTD PMID:19901195 Arnt Rat aflatoxin B1 increases methylation ISO ARNT (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of ARNT gene CTD PMID:27153756 Arnt Rat aflatoxin B1 affects response to substance ISO ARNT (Homo sapiens) 6480464 ARNT protein affects the susceptibility to Aflatoxin B1 CTD PMID:28882572 Arnt Rat aflatoxin B1 multiple interactions ISO ARNT (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of and affects the localization of ARNT protein and ARNT protein affects the reaction [Aflatoxin B1 results in increased phosphorylation of H2AX protein] CTD PMID:28882572 and PMID:36442682 Arnt Rat Aflatoxin B2 alpha decreases methylation ISO ARNT (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of ARNT intron CTD PMID:30157460 Arnt Rat aldehydo-D-glucose increases activity ISO Arnt (Mus musculus) 6480464 Glucose results in increased activity of ARNT protein CTD PMID:15767253 Arnt Rat aldehydo-D-glucose multiple interactions ISO Arnt (Mus musculus) 6480464 [Glucose co-treated with Oxygen deficiency] inhibits the reaction [ARNT protein binds to HIF1A protein] CTD PMID:18227068 Arnt Rat aldehydo-D-glucose multiple interactions ISO ARNT (Homo sapiens) 6480464 [Glucose co-treated with Deferoxamine] results in increased expression of ARNT mRNA more ... CTD PMID:15767253 and PMID:33962019 Arnt Rat all-trans-retinoic acid multiple interactions ISO ARNT (Homo sapiens) 6480464 [Tetrachlorodibenzodioxin co-treated with Tretinoin] results in decreased expression of ARNT mRNA CTD PMID:15075337 Arnt Rat alpha-naphthoflavone multiple interactions ISO ARNT (Homo sapiens) 6480464 alpha-naphthoflavone analog results in increased activity of [AHR protein binds to ARNT protein] more ... CTD PMID:11768231 and PMID:21127131 Arnt Rat alpha-naphthoflavone multiple interactions ISO Arnt (Mus musculus) 6480464 ARNT protein affects the reaction [alpha-naphthoflavone results in increased expression of DDIT3 protein] CTD PMID:30508555 Arnt Rat alpha-pinene multiple interactions ISO ARNT (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of ARNT mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of ARNT mRNA CTD PMID:32699268 Arnt Rat Alpinetin multiple interactions ISO ARNT (Homo sapiens) 6480464 ARNT protein affects the reaction [alpinetin inhibits the reaction [TNF protein results in decreased expression of CYP1A1 protein]] CTD PMID:31676321 Arnt Rat alternariol affects response to substance ISO Arnt (Mus musculus) 6480464 ARNT protein affects the susceptibility to alternariol CTD PMID:22120949 Arnt Rat alternariol multiple interactions ISO Arnt (Mus musculus) 6480464 ARNT protein affects the reaction [alternariol results in increased expression of CYP1A1 protein] CTD PMID:22120949 Arnt Rat amphotericin B multiple interactions ISO ARNT (Homo sapiens) 6480464 Amphotericin B inhibits the reaction [[HIF1A protein binds to ARNT protein] which binds to EPO enhancer] CTD PMID:16189267 Arnt Rat anthracene multiple interactions ISO ARNT (Homo sapiens) 6480464 [naphthalene co-treated with phenanthrene co-treated with anthracene co-treated with fluoranthene co-treated with pyrene] affects the expression of ARNT protein more ... CTD PMID:28710019 Arnt Rat apigenin multiple interactions ISO Arnt (Mus musculus) 6480464 Apigenin inhibits the reaction [Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to ARNT protein]] CTD PMID:20450880 Arnt Rat apigenin multiple interactions ISO ARNT (Homo sapiens) 6480464 Apigenin inhibits the reaction [Tetrachlorodibenzodioxin results in increased phosphorylation of ARNT protein] CTD PMID:20450880 Arnt Rat Aroclor 1254 multiple interactions EXP 6480464 Chlorodiphenyl (54% Chlorine) promotes the reaction [[AHR protein binds to ARNT protein] which binds to RAF1 promoter] CTD PMID:18708364 Arnt Rat arsenite(3-) multiple interactions EXP 6480464 arsenite inhibits the reaction [Tetrachlorodibenzodioxin promotes the reaction [[AHR protein co-treated with ARNT protein] binds to CYP1A1 promoter]] and arsenite inhibits the reaction [Tetrachlorodibenzodioxin results in increased activity of and results in increased localization of [AHR protein co-treated with ARNT protein]] CTD PMID:22159698 Arnt Rat atrazine increases expression ISO ARNT (Homo sapiens) 6480464 Atrazine results in increased expression of ARNT mRNA CTD PMID:22378314 Arnt Rat atrazine increases expression ISO Arnt (Mus musculus) 6480464 Atrazine results in increased expression of ARNT mRNA CTD PMID:36216167 Arnt Rat atrazine multiple interactions ISO Arnt (Mus musculus) 6480464 Lycopene inhibits the reaction [Atrazine results in increased expression of ARNT mRNA] CTD PMID:36216167 Arnt Rat Azaspiracid decreases expression ISO ARNT (Homo sapiens) 6480464 azaspiracid results in decreased expression of ARNT mRNA CTD PMID:28939011 Arnt Rat benzo[a]pyrene multiple interactions ISO ARNT (Homo sapiens) 6480464 [AHR gene mutant form binds to ARNT protein] which results in decreased susceptibility to Benzo(a)pyrene more ... CTD PMID:11768231 more ... Arnt Rat benzo[a]pyrene increases expression ISO Arnt (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of ARNT mRNA and Benzo(a)pyrene results in increased expression of ARNT protein CTD PMID:33663268 Arnt Rat benzo[a]pyrene increases methylation ISO ARNT (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of ARNT promoter CTD PMID:27901495 Arnt Rat benzo[a]pyrene affects methylation ISO ARNT (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of ARNT intron CTD PMID:30157460 Arnt Rat benzo[a]pyrene decreases methylation ISO ARNT (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of ARNT 3' UTR CTD PMID:27901495 Arnt Rat benzo[a]pyrene multiple interactions ISO Arnt (Mus musculus) 6480464 [lipopolysaccharide more ... CTD PMID:28987381 and PMID:33663268 Arnt Rat benzo[a]pyrene affects response to substance ISO ARNT (Homo sapiens) 6480464 ARNT protein affects the susceptibility to Benzo(a)pyrene CTD PMID:28882572 Arnt Rat benzo[a]pyrene affects localization ISO ARNT (Homo sapiens) 6480464 Benzo(a)pyrene affects the localization of ARNT protein CTD PMID:26350169 Arnt Rat benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of ARNT mRNA CTD PMID:26303333 and PMID:26466350 Arnt Rat benzo[a]pyrene multiple interactions EXP 6480464 Benzo(a)pyrene inhibits the reaction [ARNT protein binds to GNMT protein] more ... CTD PMID:21445860 more ... Arnt Rat benzo[a]pyrene decreases expression ISO Arnt (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of ARNT mRNA CTD PMID:22228805 Arnt Rat benzo[a]pyrene decreases expression ISO ARNT (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of ARNT mRNA CTD PMID:21256954 Arnt Rat benzo[a]pyrene increases response to substance ISO Arnt (Mus musculus) 6480464 ARNT protein results in increased susceptibility to Benzo(a)pyrene CTD PMID:19755658 Arnt Rat benzo[a]pyrene increases expression ISO ARNT (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of ARNT mRNA CTD PMID:18247414 Arnt Rat benzo[a]pyrene-7,8-dione multiple interactions ISO Arnt (Mus musculus) 6480464 ARNT protein affects the reaction [benzo(a)pyrene-7 and 8-dione results in increased expression of CYP1A1 mRNA] CTD PMID:10706104 Arnt Rat beta-naphthoflavone multiple interactions ISO ARNT (Homo sapiens) 6480464 AHR gene mutant form inhibits the reaction [beta-Naphthoflavone results in increased activity of [AHR protein binds to ARNT protein]] more ... CTD PMID:19901195 more ... Arnt Rat beta-naphthoflavone multiple interactions ISO Arnt (Mus musculus) 6480464 ARNT affects the reaction [beta-Naphthoflavone results in increased expression of CYP1A1 mRNA] more ... CTD PMID:17012224 and PMID:21849270 Arnt Rat betulin multiple interactions EXP 6480464 betulin inhibits the reaction [9 more ... CTD PMID:33759307 Arnt Rat bifenthrin increases expression ISO Arnt (Mus musculus) 6480464 bifenthrin results in increased expression of ARNT mRNA CTD PMID:26071804 Arnt Rat bis(2-ethylhexyl) phthalate increases expression ISO Arnt (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of ARNT mRNA and Diethylhexyl Phthalate results in increased expression of ARNT protein CTD PMID:36403809 Arnt Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Arnt (Mus musculus) 6480464 [Diethylhexyl Phthalate co-treated with Lycopene] results in decreased expression of ARNT mRNA more ... CTD PMID:34670089 and PMID:36403809 Arnt Rat bisphenol A increases expression ISO Arnt (Mus musculus) 6480464 bisphenol A results in increased expression of ARNT mRNA CTD PMID:16284450 and PMID:38042274 Arnt Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of ARNT mRNA more ... CTD PMID:31489946 and PMID:36041667 Arnt Rat bisphenol A affects methylation ISO Arnt (Mus musculus) 6480464 bisphenol A affects the methylation of ARNT promoter CTD PMID:27334623 Arnt Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ARNT mRNA CTD PMID:25181051 and PMID:30816183 Arnt Rat bisphenol A decreases expression ISO Arnt (Mus musculus) 6480464 bisphenol A results in decreased expression of ARNT mRNA CTD PMID:23928317 Arnt Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of ARNT mRNA CTD PMID:36041667 Arnt Rat Butylbenzyl phthalate increases expression ISO ARNT (Homo sapiens) 6480464 butylbenzyl phthalate results in increased expression of ARNT mRNA and butylbenzyl phthalate results in increased expression of ARNT protein CTD PMID:22138065 Arnt Rat Butylbenzyl phthalate multiple interactions ISO ARNT (Homo sapiens) 6480464 3' more ... CTD PMID:22138065 Arnt Rat captan decreases expression ISO Arnt (Mus musculus) 6480464 Captan results in decreased expression of ARNT mRNA CTD PMID:31558096 Arnt Rat carbamazepine affects expression ISO ARNT (Homo sapiens) 6480464 Carbamazepine affects the expression of ARNT mRNA CTD PMID:24752500 Arnt Rat chromium(6+) affects localization ISO ARNT (Homo sapiens) 6480464 chromium hexavalent ion affects the localization of ARNT protein CTD PMID:17382205 Arnt Rat chrysin multiple interactions ISO ARNT (Homo sapiens) 6480464 chrysin promotes the reaction [ARNT protein binds to CYP1A1 promoter] CTD PMID:16972788 Arnt Rat cisplatin multiple interactions ISO ARNT (Homo sapiens) 6480464 ARNT protein affects the reaction [Cisplatin results in increased expression of FTL protein] CTD PMID:33969609 Arnt Rat cobalt dichloride multiple interactions ISO ARNT (Homo sapiens) 6480464 ARNT gene mutant form inhibits the reaction [cobaltous chloride results in increased expression of CA9 mRNA] more ... CTD PMID:10939628 more ... Arnt Rat cobalt dichloride increases expression ISO ARNT (Homo sapiens) 6480464 cobaltous chloride results in increased expression of ARNT mRNA CTD PMID:29960020 Arnt Rat cobalt dichloride affects localization ISO ARNT (Homo sapiens) 6480464 cobaltous chloride affects the localization of ARNT protein CTD PMID:25826687 and PMID:26350169 Arnt Rat cobalt dichloride multiple interactions EXP 6480464 cobaltous chloride promotes the reaction [[HIF1A protein co-treated with ARNT protein] results in increased expression of LOX mRNA] CTD PMID:23161664 Arnt Rat cobalt dichloride multiple interactions ISO Arnt (Mus musculus) 6480464 ARNT affects the reaction [cobaltous chloride results in increased expression of HMOX1 mRNA] and ARNT affects the reaction [cobaltous chloride results in increased expression of SLC2A1 mRNA] CTD PMID:11043581 Arnt Rat cobalt dichloride increases expression EXP 6480464 cobaltous chloride results in increased expression of ARNT protein CTD PMID:10559391 Arnt Rat copper atom multiple interactions ISO Arnt (Mus musculus) 6480464 Copper results in increased activity of [AHR protein binds to ARNT protein] CTD PMID:16093525 Arnt Rat copper(0) multiple interactions ISO Arnt (Mus musculus) 6480464 Copper results in increased activity of [AHR protein binds to ARNT protein] CTD PMID:16093525 Arnt Rat coumestrol decreases expression ISO ARNT (Homo sapiens) 6480464 Coumestrol results in decreased expression of ARNT mRNA CTD PMID:19167446 Arnt Rat crocidolite asbestos decreases expression ISO Arnt (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of ARNT mRNA CTD PMID:29279043 Arnt Rat curcumin multiple interactions ISO ARNT (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [Curcumin results in increased degradation of ARNT protein] more ... CTD PMID:16880289 Arnt Rat curcumin multiple interactions ISO Arnt (Mus musculus) 6480464 Curcumin inhibits the reaction [Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to ARNT protein]] more ... CTD PMID:17880909 Arnt Rat curcumin increases degradation ISO ARNT (Homo sapiens) 6480464 Curcumin results in increased degradation of ARNT protein CTD PMID:19018768 Arnt Rat curcumin decreases expression ISO ARNT (Homo sapiens) 6480464 Curcumin results in decreased expression of ARNT protein CTD PMID:18682687 Arnt Rat cycloheximide multiple interactions ISO Arnt (Mus musculus) 6480464 [Cycloheximide results in increased activity of [AHR protein binds to ARNT protein]] which results in increased expression of CYP1A1 mRNA more ... CTD PMID:12002481 and PMID:20570689 Arnt Rat cyprodinil multiple interactions ISO Arnt (Mus musculus) 6480464 ARNT protein affects the reaction [cyprodinil results in increased expression of CYP1A1 protein] CTD PMID:23228475 Arnt Rat D-glucose multiple interactions ISO ARNT (Homo sapiens) 6480464 [Glucose co-treated with Deferoxamine] results in increased expression of ARNT mRNA more ... CTD PMID:15767253 and PMID:33962019 Arnt Rat D-glucose multiple interactions ISO Arnt (Mus musculus) 6480464 [Glucose co-treated with Oxygen deficiency] inhibits the reaction [ARNT protein binds to HIF1A protein] CTD PMID:18227068 Arnt Rat D-glucose increases activity ISO Arnt (Mus musculus) 6480464 Glucose results in increased activity of ARNT protein CTD PMID:15767253 Arnt Rat DDE increases expression ISO Arnt (Mus musculus) 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of ARNT mRNA CTD PMID:32721735 Arnt Rat decabromodiphenyl ether increases expression ISO Arnt (Mus musculus) 6480464 decabromobiphenyl ether results in increased expression of ARNT mRNA CTD PMID:35266255 Arnt Rat decabromodiphenyl ether increases expression ISO ARNT (Homo sapiens) 6480464 decabromobiphenyl ether results in increased expression of ARNT mRNA and decabromobiphenyl ether results in increased expression of ARNT protein CTD PMID:34571075 Arnt Rat decabromodiphenyl ether multiple interactions ISO ARNT (Homo sapiens) 6480464 2-methyl-2H-pyrazole-3-carboxylic acid (2-methyl-4-o-tolylazophenyl)amide inhibits the reaction [decabromobiphenyl ether results in increased expression of ARNT protein] CTD PMID:34571075 Arnt Rat deguelin increases expression ISO ARNT (Homo sapiens) 6480464 deguelin results in increased expression of ARNT mRNA CTD PMID:33512557 Arnt Rat delphinidin multiple interactions ISO ARNT (Homo sapiens) 6480464 delphinidin inhibits the reaction [Hydrogen Peroxide results in increased expression of ARNT protein] CTD PMID:18603805 Arnt Rat desferrioxamine B increases activity EXP 6480464 Deferoxamine results in increased activity of ARNT protein CTD PMID:10559391 Arnt Rat desferrioxamine B increases expression ISO ARNT (Homo sapiens) 6480464 Deferoxamine results in increased expression of ARNT mRNA CTD PMID:33962019 Arnt Rat desferrioxamine B multiple interactions ISO ARNT (Homo sapiens) 6480464 [Deferoxamine co-treated with tert-Butylhydroperoxide] results in increased expression of ARNT mRNA more ... CTD PMID:33962019 and PMID:35690295 Arnt Rat dexamethasone increases expression EXP 6480464 Dexamethasone results in increased expression of ARNT mRNA CTD PMID:19615983 Arnt Rat dibutyl phthalate decreases expression ISO Arnt (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of ARNT mRNA CTD PMID:21266533 Arnt Rat diclofenac affects expression ISO ARNT (Homo sapiens) 6480464 Diclofenac affects the expression of ARNT mRNA CTD PMID:24752500 Arnt Rat dicyclanil multiple interactions ISO Arnt (Mus musculus) 6480464 [dicyclanil co-treated with Diethylnitrosamine] results in increased expression of ARNT mRNA and Plant Extracts inhibits the reaction [[Diethylnitrosamine co-treated with dicyclanil] results in increased expression of ARNT mRNA] CTD PMID:19182440 Arnt Rat dimethyl sulfoxide multiple interactions ISO ARNT (Homo sapiens) 6480464 Dimethyl Sulfoxide promotes the reaction [ARNT protein binds to CAD promoter] CTD PMID:16675542 Arnt Rat dimethyl sulfoxide multiple interactions ISO Arnt (Mus musculus) 6480464 Dimethyl Sulfoxide promotes the reaction [ARNT protein binds to AHR promoter] and JDP2 protein affects the reaction [Dimethyl Sulfoxide promotes the reaction [ARNT protein binds to AHR promoter]] CTD PMID:33723743 Arnt Rat dioxygen multiple interactions ISO ARNT (Homo sapiens) 6480464 (+)-JQ1 compound inhibits the reaction [Oxygen deficiency promotes the reaction [ARNT protein binds to CA9 promoter]] more ... CTD PMID:10777486 more ... Arnt Rat dioxygen decreases response to substance ISO ARNT (Homo sapiens) 6480464 ARNT protein results in decreased susceptibility to Oxygen deficiency CTD PMID:24355420 Arnt Rat dioxygen decreases response to substance ISO Arnt (Mus musculus) 6480464 ARNT gene mutant form results in decreased susceptibility to Oxygen deficiency CTD PMID:20412331 Arnt Rat dioxygen affects localization ISO ARNT (Homo sapiens) 6480464 Oxygen deficiency affects the localization of ARNT protein CTD PMID:11739637 Arnt Rat dioxygen multiple interactions ISO Arnt (Mus musculus) 6480464 [Glucose co-treated with Oxygen deficiency] inhibits the reaction [ARNT protein binds to HIF1A protein] more ... CTD PMID:18227068 more ... Arnt Rat dorsomorphin multiple interactions ISO ARNT (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of ARNT mRNA CTD PMID:27188386 Arnt Rat doxorubicin decreases expression ISO ARNT (Homo sapiens) 6480464 Doxorubicin results in decreased expression of ARNT mRNA CTD PMID:29803840 Arnt Rat enzyme inhibitor multiple interactions ISO ARNT (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of ARNT protein CTD PMID:23301498 Arnt Rat epoxiconazole decreases expression ISO Arnt (Mus musculus) 6480464 epoxiconazole results in decreased expression of ARNT mRNA CTD PMID:35436446 Arnt Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of ARNT mRNA CTD PMID:15353170 Arnt Rat ethanol increases expression EXP 6480464 Ethanol results in increased expression of ARNT mRNA CTD PMID:23273579 Arnt Rat etoposide multiple interactions ISO ARNT (Homo sapiens) 6480464 ARNT protein affects the reaction [Etoposide results in increased expression of FTL protein] CTD PMID:33969609 Arnt Rat fluoranthene multiple interactions ISO ARNT (Homo sapiens) 6480464 [naphthalene co-treated with phenanthrene co-treated with anthracene co-treated with fluoranthene co-treated with pyrene] affects the expression of ARNT protein more ... CTD PMID:28710019 Arnt Rat folpet decreases expression ISO Arnt (Mus musculus) 6480464 folpet results in decreased expression of ARNT mRNA CTD PMID:31558096 Arnt Rat fulvestrant multiple interactions ISO ARNT (Homo sapiens) 6480464 [bisphenol S co-treated with Fulvestrant] results in increased methylation of ARNT gene CTD PMID:31601247 Arnt Rat galangin multiple interactions ISO Arnt (Mus musculus) 6480464 galangin inhibits the reaction [Benzo(a)pyrene results in increased expression of ARNT mRNA] and galangin inhibits the reaction [Benzo(a)pyrene results in increased expression of ARNT protein] CTD PMID:33663268 Arnt Rat gamma-hexachlorocyclohexane increases expression EXP 6480464 Hexachlorocyclohexane results in increased expression of ARNT mRNA CTD PMID:25572523 Arnt Rat gemcitabine increases expression ISO ARNT (Homo sapiens) 6480464 Gemcitabine results in increased expression of ARNT mRNA CTD PMID:20103597 Arnt Rat genistein multiple interactions ISO ARNT (Homo sapiens) 6480464 Genistein affects the reaction [cobaltous chloride promotes the reaction [HIF1A protein binds to ARNT protein binds to EDN1 promoter]] and Genistein affects the reaction [Oxygen deficiency promotes the reaction [HIF1A protein binds to ARNT protein binds to EDN1 promoter]] CTD PMID:10939628 Arnt Rat glucose multiple interactions ISO ARNT (Homo sapiens) 6480464 [Glucose co-treated with Deferoxamine] results in increased expression of ARNT mRNA more ... CTD PMID:15767253 and PMID:33962019 Arnt Rat glucose multiple interactions ISO Arnt (Mus musculus) 6480464 [Glucose co-treated with Oxygen deficiency] inhibits the reaction [ARNT protein binds to HIF1A protein] CTD PMID:18227068 Arnt Rat glucose increases activity ISO Arnt (Mus musculus) 6480464 Glucose results in increased activity of ARNT protein CTD PMID:15767253 Arnt Rat hydrogen peroxide multiple interactions ISO ARNT (Homo sapiens) 6480464 [Hydrogen Peroxide co-treated with Theophylline] results in increased expression of ARNT protein and delphinidin inhibits the reaction [Hydrogen Peroxide results in increased expression of ARNT protein] CTD PMID:18603805 and PMID:18951874 Arnt Rat hydrogen peroxide decreases expression ISO ARNT (Homo sapiens) 6480464 Hydrogen Peroxide results in decreased expression of ARNT protein CTD PMID:16880289 and PMID:22387692 Arnt Rat hydrogen peroxide increases expression ISO ARNT (Homo sapiens) 6480464 Hydrogen Peroxide results in increased expression of ARNT protein CTD PMID:18603805 Arnt Rat hydroquinone increases expression ISO ARNT (Homo sapiens) 6480464 hydroquinone results in increased expression of ARNT protein CTD PMID:35123993 Arnt Rat hydroquinone multiple interactions ISO ARNT (Homo sapiens) 6480464 2-methyl-2H-pyrazole-3-carboxylic acid (2-methyl-4-o-tolylazophenyl)amide inhibits the reaction [hydroquinone results in increased expression of ARNT protein] CTD PMID:35123993 Arnt Rat indirubin multiple interactions EXP 6480464 indirubin promotes the reaction [AHR protein binds to ARNT protein] CTD PMID:20951181 Arnt Rat indirubin increases activity ISO ARNT (Homo sapiens) 6480464 indirubin results in increased activity of ARNT protein CTD PMID:12972062 Arnt Rat indole-3-acetic acid multiple interactions ISO ARNT (Homo sapiens) 6480464 indoleacetic acid results in increased activity of [AHR protein binds to ARNT protein] CTD PMID:9407059 Arnt Rat indole-3-methanol multiple interactions ISO ARNT (Homo sapiens) 6480464 ARNT protein affects the reaction [indole-3-carbinol results in decreased expression of AHR protein] CTD PMID:37217010 Arnt Rat indoxyl sulfate multiple interactions ISO Arnt (Mus musculus) 6480464 Indican promotes the reaction [[AHR protein binds to ARNT protein] which binds to CCL20 promoter] CTD PMID:26259605 Arnt Rat iron atom multiple interactions ISO ARNT (Homo sapiens) 6480464 ARNT protein affects the reaction [Iron deficiency results in increased activity of CP promoter] CTD PMID:10777486 Arnt Rat iron(0) multiple interactions ISO ARNT (Homo sapiens) 6480464 ARNT protein affects the reaction [Iron deficiency results in increased activity of CP promoter] CTD PMID:10777486 Arnt Rat kaempferol multiple interactions ISO Arnt (Mus musculus) 6480464 kaempferol inhibits the reaction [beta-Naphthoflavone promotes the reaction [AHR protein binds to ARNT protein]] more ... CTD PMID:17012224 and PMID:20450880 Arnt Rat kaempferol multiple interactions ISO ARNT (Homo sapiens) 6480464 kaempferol inhibits the reaction [Tetrachlorodibenzodioxin promotes the reaction [ARNT protein binds to CYP1A1 enhancer]] more ... CTD PMID:20450880 and PMID:20846786 Arnt Rat L-mimosine increases activity EXP 6480464 Mimosine results in increased activity of ARNT protein CTD PMID:10559391 Arnt Rat lead(0) multiple interactions ISO Arnt (Mus musculus) 6480464 Lead results in increased activity of [AHR protein binds to ARNT protein] CTD PMID:16093525 Arnt Rat lead(0) increases expression ISO ARNT (Homo sapiens) 6480464 Lead results in increased expression of ARNT mRNA CTD PMID:19921347 Arnt Rat linuron multiple interactions ISO Arnt (Mus musculus) 6480464 XBP1 gene promotes the reaction [Linuron results in increased expression of ARNT mRNA] CTD PMID:30661753 Arnt Rat lycopene increases expression ISO Arnt (Mus musculus) 6480464 Lycopene results in increased expression of ARNT mRNA CTD PMID:36216167 Arnt Rat lycopene multiple interactions ISO Arnt (Mus musculus) 6480464 [Diethylhexyl Phthalate co-treated with Lycopene] results in decreased expression of ARNT mRNA more ... CTD PMID:34670089 more ... Arnt Rat manganese(II) chloride multiple interactions ISO Arnt (Mus musculus) 6480464 ARNT gene mutant form inhibits the reaction [manganese chloride results in increased secretion of VEGFA protein] CTD PMID:19263519 Arnt Rat MeIQx affects response to substance ISO ARNT (Homo sapiens) 6480464 ARNT protein affects the susceptibility to 2-amino-3 more ... CTD PMID:23208499 Arnt Rat melatonin multiple interactions ISO ARNT (Homo sapiens) 6480464 Melatonin inhibits the reaction [[Glucose co-treated with Deferoxamine] results in increased expression of ARNT mRNA] CTD PMID:33962019 Arnt Rat mercury atom multiple interactions ISO Arnt (Mus musculus) 6480464 Mercury results in increased activity of [AHR protein binds to ARNT protein] CTD PMID:16093525 Arnt Rat mercury(0) multiple interactions ISO Arnt (Mus musculus) 6480464 Mercury results in increased activity of [AHR protein binds to ARNT protein] CTD PMID:16093525 Arnt Rat methotrexate affects expression ISO Arnt (Mus musculus) 6480464 Methotrexate affects the expression of ARNT mRNA CTD PMID:18502557 Arnt Rat methotrexate decreases expression ISO ARNT (Homo sapiens) 6480464 Methotrexate results in decreased expression of ARNT mRNA CTD PMID:24449571 Arnt Rat methoxychlor decreases expression EXP 6480464 Methoxychlor results in decreased expression of ARNT mRNA CTD PMID:23303685 Arnt Rat mevinphos multiple interactions EXP 6480464 ARNT protein affects the reaction [Mevinphos results in increased expression of NOS1 protein] more ... CTD PMID:21390240 Arnt Rat mono(2-ethylhexyl) phthalate multiple interactions ISO Arnt (Mus musculus) 6480464 [monoethyl phthalate co-treated with mono-(2-ethylhexyl)phthalate co-treated with mono-isobutyl phthalate co-treated with monoisononylphthalate co-treated with mono-benzyl phthalate] affects the expression of ARNT mRNA CTD PMID:31884101 Arnt Rat mono(2-ethylhexyl) phthalate increases expression ISO Arnt (Mus musculus) 6480464 mono-(2-ethylhexyl)phthalate results in increased expression of ARNT mRNA and mono-(2-ethylhexyl)phthalate results in increased expression of ARNT protein CTD PMID:34863575 Arnt Rat monobenzyl phthalate multiple interactions ISO Arnt (Mus musculus) 6480464 [monoethyl phthalate co-treated with mono-(2-ethylhexyl)phthalate co-treated with mono-isobutyl phthalate co-treated with monoisononylphthalate co-treated with mono-benzyl phthalate] affects the expression of ARNT mRNA CTD PMID:31884101 Arnt Rat monoethyl phthalate multiple interactions ISO Arnt (Mus musculus) 6480464 [monoethyl phthalate co-treated with mono-(2-ethylhexyl)phthalate co-treated with mono-isobutyl phthalate co-treated with monoisononylphthalate co-treated with mono-benzyl phthalate] affects the expression of ARNT mRNA CTD PMID:31884101 Arnt Rat N(4)-hydroxycytidine decreases expression ISO Arnt (Mus musculus) 6480464 N(4)-hydroxycytidine results in decreased expression of ARNT mRNA CTD PMID:37748715 Arnt Rat N-acetyl-L-cysteine multiple interactions ISO ARNT (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [Curcumin results in increased degradation of ARNT protein] CTD PMID:16880289 Arnt Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal decreases expression ISO ARNT (Homo sapiens) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in decreased expression of ARNT protein CTD PMID:15899923 Arnt Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions ISO Arnt (Mus musculus) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde promotes the reaction [SP1 protein binds to ARNT promoter] and bisindolylmaleimide I inhibits the reaction [benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased expression of ARNT mRNA] CTD PMID:14529614 Arnt Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal increases expression ISO Arnt (Mus musculus) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased expression of ARNT mRNA CTD PMID:14529614 Arnt Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions ISO ARNT (Homo sapiens) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [Curcumin results in increased degradation of ARNT protein] CTD PMID:16880289 Arnt Rat N-nitrosodiethylamine multiple interactions ISO Arnt (Mus musculus) 6480464 [dicyclanil co-treated with Diethylnitrosamine] results in increased expression of ARNT mRNA and Plant Extracts inhibits the reaction [[Diethylnitrosamine co-treated with dicyclanil] results in increased expression of ARNT mRNA] CTD PMID:19182440 Arnt Rat naphthalene multiple interactions ISO ARNT (Homo sapiens) 6480464 [naphthalene co-treated with phenanthrene co-treated with anthracene co-treated with fluoranthene co-treated with pyrene] affects the expression of ARNT protein more ... CTD PMID:28710019 Arnt Rat nevirapine increases expression EXP 6480464 Nevirapine metabolite results in increased expression of ARNT mRNA CTD PMID:23947594 Arnt Rat nickel dichloride multiple interactions ISO Arnt (Mus musculus) 6480464 HIF1A affects the reaction [nickel chloride results in increased expression of ARNT mRNA] CTD PMID:12729255 Arnt Rat nickel dichloride multiple interactions ISO ARNT (Homo sapiens) 6480464 nickel chloride promotes the reaction [HIF1A protein binds to ARNT protein] CTD PMID:29355601 Arnt Rat nickel sulfate affects localization ISO ARNT (Homo sapiens) 6480464 nickel sulfate affects the localization of ARNT protein CTD PMID:17382205 Arnt Rat nicotine decreases expression EXP 6480464 Nicotine results in decreased expression of ARNT protein CTD PMID:35577041 Arnt Rat Nonidet P-40 decreases expression ISO ARNT (Homo sapiens) 6480464 Nonidet P-40 results in decreased expression of ARNT mRNA CTD PMID:26552463 Arnt Rat okadaic acid increases expression ISO ARNT (Homo sapiens) 6480464 Okadaic Acid results in increased expression of ARNT mRNA CTD PMID:28939011 Arnt Rat omeprazole multiple interactions EXP 6480464 Omeprazole affects the localization of [ARNT protein co-treated with AHR protein] CTD PMID:9395520 Arnt Rat omeprazole affects localization ISO ARNT (Homo sapiens) 6480464 Omeprazole affects the localization of ARNT protein CTD PMID:25826687 Arnt Rat omeprazole multiple interactions ISO ARNT (Homo sapiens) 6480464 Omeprazole promotes the reaction [ARNT protein binds to CYP1A1 promoter] and Omeprazole promotes the reaction [ARNT protein binds to CYP1B1 promoter] CTD PMID:21703235 Arnt Rat ozone increases expression ISO ARNT (Homo sapiens) 6480464 Ozone results in increased expression of ARNT mRNA CTD PMID:27206323 Arnt Rat ozone multiple interactions ISO ARNT (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of ARNT mRNA more ... CTD PMID:32699268 and PMID:32845096 Arnt Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Arnt (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of ARNT mRNA CTD PMID:36331819 Arnt Rat perfluorooctanoic acid decreases expression ISO Arnt (Mus musculus) 6480464 perfluorooctanoic acid results in decreased expression of ARNT mRNA CTD PMID:23626681 Arnt Rat perfluorooctanoic acid multiple interactions ISO Arnt (Mus musculus) 6480464 [perfluorooctanoic acid co-treated with Dietary Fats and Unsaturated] results in decreased expression of ARNT mRNA CTD PMID:23626681 Arnt Rat phenanthrene multiple interactions ISO ARNT (Homo sapiens) 6480464 [naphthalene co-treated with phenanthrene co-treated with anthracene co-treated with fluoranthene co-treated with pyrene] affects the expression of ARNT protein more ... CTD PMID:28710019 Arnt Rat phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of ARNT mRNA CTD PMID:23273579 Arnt Rat phenylmercury acetate decreases expression ISO ARNT (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of ARNT mRNA CTD PMID:26272509 Arnt Rat phenylmercury acetate multiple interactions ISO ARNT (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of ARNT mRNA CTD PMID:27188386 Arnt Rat phorbol 13-acetate 12-myristate multiple interactions ISO Arnt (Mus musculus) 6480464 ARNT protein affects the reaction [Tetradecanoylphorbol Acetate results in increased expression of CYP1A1 protein] and ARNT protein affects the reaction [Tetradecanoylphorbol Acetate results in increased expression of NQO1 protein] CTD PMID:24481452 Arnt Rat potassium chromate multiple interactions ISO ARNT (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of ARNT mRNA CTD PMID:22079256 Arnt Rat potassium chromate decreases expression ISO ARNT (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of ARNT mRNA CTD PMID:22079256 Arnt Rat potassium chromate affects localization ISO ARNT (Homo sapiens) 6480464 potassium chromate(VI) affects the localization of ARNT protein CTD PMID:17382205 Arnt Rat potassium dichromate increases expression ISO Arnt (Mus musculus) 6480464 Potassium Dichromate results in increased expression of ARNT mRNA CTD PMID:23608068 Arnt Rat prochloraz affects expression EXP 6480464 prochloraz affects the expression of ARNT mRNA CTD PMID:25182419 Arnt Rat progesterone multiple interactions EXP 6480464 [Progesterone co-treated with Estradiol] affects the expression of ARNT mRNA CTD PMID:24777823 Arnt Rat progesterone affects expression EXP 6480464 Progesterone affects the expression of ARNT mRNA CTD PMID:24777823 Arnt Rat pyrene multiple interactions ISO ARNT (Homo sapiens) 6480464 [naphthalene co-treated with phenanthrene co-treated with anthracene co-treated with fluoranthene co-treated with pyrene] affects the expression of ARNT protein more ... CTD PMID:28710019 Arnt Rat quercetin multiple interactions ISO ARNT (Homo sapiens) 6480464 Quercetin promotes the reaction [6-formylindolo(3 more ... CTD PMID:21256954 and PMID:21756928 Arnt Rat quercetin decreases expression ISO ARNT (Homo sapiens) 6480464 Quercetin results in decreased expression of ARNT mRNA CTD PMID:21256954 Arnt Rat quercetin increases localization ISO ARNT (Homo sapiens) 6480464 Quercetin results in increased localization of ARNT protein CTD PMID:21756928 Arnt Rat rac-lactic acid multiple interactions ISO Arnt (Mus musculus) 6480464 ARNT promotes the reaction [beta-Naphthoflavone results in decreased abundance of Lactic Acid] CTD PMID:21849270 Arnt Rat raloxifene multiple interactions ISO Arnt (Mus musculus) 6480464 ARNT protein affects the reaction [Raloxifene Hydrochloride results in increased expression of CYP1A1 protein] and ARNT protein affects the reaction [Raloxifene Hydrochloride results in increased expression of NQO1 protein] CTD PMID:24481452 Arnt Rat resveratrol multiple interactions EXP 6480464 Resveratrol inhibits the reaction [3 more ... CTD PMID:18708364 and PMID:31489946 Arnt Rat resveratrol increases localization ISO ARNT (Homo sapiens) 6480464 resveratrol results in increased localization of ARNT protein CTD PMID:21756928 Arnt Rat resveratrol multiple interactions ISO ARNT (Homo sapiens) 6480464 resveratrol inhibits the reaction [3 more ... CTD PMID:18708364 more ... Arnt Rat rotenone increases expression ISO ARNT (Homo sapiens) 6480464 Rotenone results in increased expression of ARNT mRNA CTD PMID:33512557 Arnt Rat rutin increases localization ISO ARNT (Homo sapiens) 6480464 Rutin results in increased localization of ARNT protein CTD PMID:21756928 Arnt Rat S-butyl-DL-homocysteine (S,R)-sulfoximine decreases expression ISO ARNT (Homo sapiens) 6480464 Buthionine Sulfoximine results in decreased expression of ARNT protein CTD PMID:16880289 Arnt Rat sanguinarine multiple interactions ISO ARNT (Homo sapiens) 6480464 sanguinarine promotes the reaction [AHR protein binds to ARNT protein] CTD PMID:15993743 Arnt Rat SB 431542 multiple interactions ISO ARNT (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of ARNT mRNA CTD PMID:27188386 Arnt Rat Sudan III multiple interactions ISO ARNT (Homo sapiens) 6480464 [sudan III affects the localization of AHR protein] promotes the reaction [AHR protein binds to ARNT protein] CTD PMID:22287322 Arnt Rat sulpiride multiple interactions EXP 6480464 Sulpiride inhibits the reaction [Benzo(a)pyrene results in increased expression of ARNT mRNA] CTD PMID:26466350 Arnt Rat tamoxifen affects expression ISO Arnt (Mus musculus) 6480464 Tamoxifen affects the expression of ARNT mRNA CTD PMID:17555576 Arnt Rat tert-butyl hydroperoxide multiple interactions ISO ARNT (Homo sapiens) 6480464 [Deferoxamine co-treated with tert-Butylhydroperoxide] results in increased expression of ARNT mRNA and MIR184 mRNA inhibits the reaction [[Deferoxamine co-treated with tert-Butylhydroperoxide] results in increased expression of ARNT mRNA] CTD PMID:35690295 Arnt Rat tetracycline increases expression ISO Arnt (Mus musculus) 6480464 Tetracycline results in increased expression of ARNT mRNA CTD PMID:16917069 Arnt Rat theophylline multiple interactions ISO ARNT (Homo sapiens) 6480464 [Hydrogen Peroxide co-treated with Theophylline] results in increased expression of ARNT protein CTD PMID:18951874 Arnt Rat thimerosal decreases expression ISO ARNT (Homo sapiens) 6480464 Thimerosal results in decreased expression of ARNT mRNA CTD PMID:27188386 Arnt Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of ARNT mRNA CTD PMID:34492290 Arnt Rat trans-piceid increases localization ISO ARNT (Homo sapiens) 6480464 polydatin results in increased localization of ARNT protein CTD PMID:21756928 Arnt Rat triptonide decreases expression ISO Arnt (Mus musculus) 6480464 triptonide results in decreased expression of ARNT mRNA CTD PMID:33045310 Arnt Rat Tryptanthrine multiple interactions ISO Arnt (Mus musculus) 6480464 tryptanthrine promotes the reaction [[AHR protein binds to ARNT protein] which binds to CCL20 promoter] CTD PMID:26259605 Arnt Rat tryptophan increases expression EXP 401793718 tryptophan in pregnant dams increases expression of mRNA in kidney of male offspring RGD Arnt Rat ursodeoxycholic acid multiple interactions ISO Arnt (Mus musculus) 6480464 Ursodeoxycholic Acid inhibits the reaction [Tetrachlorodibenzodioxin results in increased localization of ARNT protein] CTD PMID:14761680 Arnt Rat valdecoxib decreases expression EXP 6480464 valdecoxib results in decreased expression of ARNT mRNA CTD PMID:24136188 Arnt Rat valproic acid decreases expression ISO ARNT (Homo sapiens) 6480464 Valproic Acid results in decreased expression of ARNT mRNA CTD PMID:23179753 and PMID:28001369 Arnt Rat valproic acid decreases methylation ISO ARNT (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of ARNT gene CTD PMID:29154799 Arnt Rat valproic acid affects expression ISO ARNT (Homo sapiens) 6480464 Valproic Acid affects the expression of ARNT mRNA CTD PMID:25979313 Arnt Rat vanadium atom multiple interactions ISO ARNT (Homo sapiens) 6480464 Vanadium inhibits the reaction [[AHR protein binds to ARNT protein] which binds to CYP1A1 promoter] CTD PMID:18541696 Arnt Rat vanadium(0) multiple interactions ISO ARNT (Homo sapiens) 6480464 Vanadium inhibits the reaction [[AHR protein binds to ARNT protein] which binds to CYP1A1 promoter] CTD PMID:18541696 Arnt Rat vanadyl sulfate decreases expression ISO ARNT (Homo sapiens) 6480464 vanadyl sulfate results in decreased expression of ARNT mRNA CTD PMID:16330358 Arnt Rat vosaroxin multiple interactions ISO ARNT (Homo sapiens) 6480464 vosaroxin inhibits the reaction [Oxygen deficiency promotes the reaction [HIF1A protein binds to ARNT protein]] CTD PMID:29800573 Arnt Rat wortmannin multiple interactions EXP 6480464 wortmannin inhibits the reaction [INS1 protein inhibits the reaction [Benzo(a)pyrene results in increased expression of ARNT mRNA]] and wortmannin inhibits the reaction [INS1 protein results in decreased expression of ARNT mRNA] CTD PMID:26466350 Arnt Rat zearalenone increases expression EXP 6480464 Zearalenone results in increased expression of ARNT mRNA CTD PMID:20607812 Arnt Rat zinc atom multiple interactions ISO ARNT (Homo sapiens) 6480464 [Zinc results in decreased localization of ARNT protein] inhibits the reaction [ARNT protein binds to HIF1A protein] more ... CTD PMID:11739637 Arnt Rat zinc atom decreases localization ISO ARNT (Homo sapiens) 6480464 Zinc results in decreased localization of ARNT protein CTD PMID:11739637 Arnt Rat zinc(0) multiple interactions ISO ARNT (Homo sapiens) 6480464 [Zinc results in decreased localization of ARNT protein] inhibits the reaction [ARNT protein binds to HIF1A protein] more ... CTD PMID:11739637 Arnt Rat zinc(0) decreases localization ISO ARNT (Homo sapiens) 6480464 Zinc results in decreased localization of ARNT protein CTD PMID:11739637
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(-)-epigallocatechin 3-gallate (ISO) (1->4)-beta-D-glucan (ISO) (S)-naringenin (ISO) (S)-nicotine (EXP) 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (ISO) 1,2-dimethylhydrazine (ISO) 1,2-naphthoquinone (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 1H-indole (ISO) 2,3,4,7,8-Pentachlorodibenzofuran (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP,ISO) 2-hydroxypropanoic acid (ISO) 3',4'-dimethoxyflavone (ISO) 3',5'-cyclic AMP (EXP) 3,3',4,4',5-pentachlorobiphenyl (EXP,ISO) 3,3',4,4'-tetrachlorobiphenyl (EXP,ISO) 3,3'-diindolylmethane (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione (ISO) 3-methylcholanthrene (EXP,ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 4-vinylcyclohexene dioxide (ISO) 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP,ISO) 7,12-dimethyltetraphene (EXP) acrolein (ISO) acteoside (ISO) actinomycin D (ISO) afimoxifene (ISO) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) aldehydo-D-glucose (ISO) all-trans-retinoic acid (ISO) alpha-naphthoflavone (ISO) alpha-pinene (ISO) Alpinetin (ISO) alternariol (ISO) amphotericin B (ISO) anthracene (ISO) apigenin (ISO) Aroclor 1254 (EXP) arsenite(3-) (EXP) atrazine (ISO) Azaspiracid (ISO) benzo[a]pyrene (EXP,ISO) benzo[a]pyrene-7,8-dione (ISO) beta-naphthoflavone (ISO) betulin (EXP) bifenthrin (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (EXP) Butylbenzyl phthalate (ISO) captan (ISO) carbamazepine (ISO) chromium(6+) (ISO) chrysin (ISO) cisplatin (ISO) cobalt dichloride (EXP,ISO) copper atom (ISO) copper(0) (ISO) coumestrol (ISO) crocidolite asbestos (ISO) curcumin (ISO) cycloheximide (ISO) cyprodinil (ISO) D-glucose (ISO) DDE (ISO) decabromodiphenyl ether (ISO) deguelin (ISO) delphinidin (ISO) desferrioxamine B (EXP,ISO) dexamethasone (EXP) dibutyl phthalate (ISO) diclofenac (ISO) dicyclanil (ISO) dimethyl sulfoxide (ISO) dioxygen (ISO) dorsomorphin (ISO) doxorubicin (ISO) enzyme inhibitor (ISO) epoxiconazole (ISO) ethanol (EXP) etoposide (ISO) fluoranthene (ISO) folpet (ISO) fulvestrant (ISO) galangin (ISO) gamma-hexachlorocyclohexane (EXP) gemcitabine (ISO) genistein (ISO) glucose (ISO) hydrogen peroxide (ISO) hydroquinone (ISO) indirubin (EXP,ISO) indole-3-acetic acid (ISO) indole-3-methanol (ISO) indoxyl sulfate (ISO) iron atom (ISO) iron(0) (ISO) kaempferol (ISO) L-mimosine (EXP) lead(0) (ISO) linuron (ISO) lycopene (ISO) manganese(II) chloride (ISO) MeIQx (ISO) melatonin (ISO) mercury atom (ISO) mercury(0) (ISO) methotrexate (ISO) methoxychlor (EXP) mevinphos (EXP) mono(2-ethylhexyl) phthalate (ISO) monobenzyl phthalate (ISO) monoethyl phthalate (ISO) N(4)-hydroxycytidine (ISO) N-acetyl-L-cysteine (ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) N-nitrosodiethylamine (ISO) naphthalene (ISO) nevirapine (EXP) nickel dichloride (ISO) nickel sulfate (ISO) nicotine (EXP) Nonidet P-40 (ISO) okadaic acid (ISO) omeprazole (EXP,ISO) ozone (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenanthrene (ISO) phenobarbital (EXP) phenylmercury acetate (ISO) phorbol 13-acetate 12-myristate (ISO) potassium chromate (ISO) potassium dichromate (ISO) prochloraz (EXP) progesterone (EXP) pyrene (ISO) quercetin (ISO) rac-lactic acid (ISO) raloxifene (ISO) resveratrol (EXP,ISO) rotenone (ISO) rutin (ISO) S-butyl-DL-homocysteine (S,R)-sulfoximine (ISO) sanguinarine (ISO) SB 431542 (ISO) Sudan III (ISO) sulpiride (EXP) tamoxifen (ISO) tert-butyl hydroperoxide (ISO) tetracycline (ISO) theophylline (ISO) thimerosal (ISO) thioacetamide (EXP) trans-piceid (ISO) triptonide (ISO) Tryptanthrine (ISO) tryptophan (EXP) ursodeoxycholic acid (ISO) valdecoxib (EXP) valproic acid (ISO) vanadium atom (ISO) vanadium(0) (ISO) vanadyl sulfate (ISO) vosaroxin (ISO) wortmannin (EXP) zearalenone (EXP) zinc atom (ISO) zinc(0) (ISO)
Biological Process
cell differentiation (IEA,ISO) cellular response to oxidative stress (IEA,ISO) circadian rhythm (IEP) embryonic placenta development (IEA,ISO) G1 to G0 transition (IMP) intracellular receptor signaling pathway (IEA) negative regulation of inflammatory response (IEA,ISO) nitric oxide metabolic process (IEP) positive regulation of DNA-templated transcription (IEA,ISO) positive regulation of glycolytic process (IEA,ISO) positive regulation of hormone biosynthetic process (IEA,ISO) positive regulation of protein sumoylation (IEA,ISO) positive regulation of transcription by RNA polymerase II (IEA,ISO,ISS) positive regulation of vascular endothelial growth factor production (IEA,ISO) regulation of DNA-templated transcription (IEA) regulation of transcription by RNA polymerase II (IBA) response to dexamethasone (IEP) response to hypoxia (IEA,IEP,ISO) response to toxic substance (NAS)
Molecular Function
aryl hydrocarbon receptor binding (IEA,ISO) cis-regulatory region sequence-specific DNA binding (IEA,ISO) DNA binding (IEA) DNA-binding transcription factor activity (IEA,ISO,ISS) DNA-binding transcription factor activity, RNA polymerase II-specific (IBA,IEA,ISO) nuclear receptor activity (IEA,ISO,ISS) protein binding (IPI,ISO) protein dimerization activity (IEA) protein heterodimerization activity (IEA,ISO,ISS) protein homodimerization activity (IEA,ISO,ISS) protein-containing complex binding (IDA) RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA,IEA,ISO) RNA polymerase II-specific DNA-binding transcription factor binding (IEA,ISO) sequence-specific DNA binding (IDA,IEA,ISO) sequence-specific double-stranded DNA binding (IEA,ISO,ISS)
1.
Targeting renal cell carcinoma with a HIF-2 antagonist.
Chen W, etal., Nature. 2016 Nov 3;539(7627):112-117. doi: 10.1038/nature19796. Epub 2016 Sep 5.
2.
First evidence of aryl hydrocarbon receptor as a druggable target in hypertension induced by chronic intermittent hypoxia.
Coelho NR, etal., Pharmacol Res. 2020 Sep;159:104869. doi: 10.1016/j.phrs.2020.104869. Epub 2020 May 19.
3.
Aryl hydrocarbon receptor nuclear translocator (ARNT) gene as a positional and functional candidate for type 2 diabetes and prediabetic intermediate traits: Mutation detection, case-control studies, and gene expression analysis.
Das SK, etal., BMC Med Genet. 2008 Mar 17;9:16.
4.
Cloning and selective expression in brain and kidney of ARNT2 homologous to the Ah receptor nuclear translocator (ARNT).
Drutel G, etal., Biochem Biophys Res Commun 1996 Aug 14;225(2):333-9.
5.
Two splice variants of the hypoxia-inducible factor HIF-1alpha as potential dimerization partners of ARNT2 in neurons.
Drutel G, etal., Eur J Neurosci. 2000 Oct;12(10):3701-8.
6.
Maximal aryl hydrocarbon receptor activity depends on an interaction with the retinoblastoma protein.
Elferink CJ, etal., Mol Pharmacol. 2001 Apr;59(4):664-73.
7.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
8.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
9.
Loss of ARNT/HIF1beta mediates altered gene expression and pancreatic-islet dysfunction in human type 2 diabetes.
Gunton JE, etal., Cell. 2005 Aug 12;122(3):337-49.
10.
Maternal Exposure to Bisphenol A Combined with High-Fat Diet-Induced Programmed Hypertension in Adult Male Rat Offspring: Effects of Resveratrol.
Hsu CN, etal., Int J Mol Sci. 2019 Sep 6;20(18):4382. doi: 10.3390/ijms20184382.
11.
Maternal Tryptophan Supplementation Protects Adult Rat Offspring against Hypertension Programmed by Maternal Chronic Kidney Disease: Implication of Tryptophan-Metabolizing Microbiome and Aryl Hydrocarbon Receptor.
Hsu CN, etal., Int J Mol Sci. 2020 Jun 26;21(12):4552. doi: 10.3390/ijms21124552.
12.
Multiple mechanisms are involved in Ah receptor-mediated cell cycle arrest.
Huang G and Elferink CJ, Mol Pharmacol. 2005 Jan;67(1):88-96. doi: 10.1124/mol.104.002410. Epub 2004 Oct 18.
13.
Role of Glucocorticoid Receptor and Pregnane X Receptor in Dexamethasone Induction of Rat Hepatic Aryl Hydrocarbon Receptor Nuclear Translocator and NADPH-Cytochrome P450 Oxidoreductase.
Hunter SR, etal., Drug Metab Dispos. 2017 Feb;45(2):118-129. doi: 10.1124/dmd.116.073833. Epub 2016 Nov 16.
14.
HIF1alpha and HIF2alpha: sibling rivalry in hypoxic tumour growth and progression.
Keith B, etal., Nat Rev Cancer. 2011 Dec 15;12(1):9-22. doi: 10.1038/nrc3183.
15.
Identification of novel splice variants of ARNT and ARNT2 in the rat.
Korkalainen M, etal., Biochem Biophys Res Commun 2003 Apr 18;303(4):1095-100.
16.
The role of ARNT2 in tumor angiogenesis and the neural response to hypoxia.
Maltepe E, etal., Biochem Biophys Res Commun. 2000 Jun 24;273(1):231-8.
17.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
18.
Estrogen increases messenger RNA and immunoreactivity of aryl-hydrocarbon receptor nuclear translocator 2 in the rat mediobasal hypothalamus.
Mitsushima D, etal., Biochem Biophys Res Commun 2003 Jul 25;307(2):248-53.
19.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
20.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
21.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
22.
Identification of the Ah receptor nuclear translocator protein (Arnt) as a component of the DNA binding form of the Ah receptor.
Reyes H, etal., Science. 1992 May 22;256(5060):1193-5. doi: 10.1126/science.256.5060.1193.
23.
GOA pipeline
RGD automated data pipeline
24.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
25.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
26.
Daily cycle of bHLH-PAS proteins, Ah receptor and Arnt, in multiple tissues of female Sprague-Dawley rats.
Richardson VM, etal., Biochem Biophys Res Commun. 1998 Nov 9;252(1):225-31. doi: 10.1006/bbrc.1998.9634.
27.
The t(1;12)(q21;p13) translocation of human acute myeloblastic leukemia results in a TEL-ARNT fusion.
Salomon-Nguyen F, etal., Proc Natl Acad Sci U S A 2000 Jun 6;97(12):6757-62.
28.
Expression of aryl hydrocarbon receptor and aryl hydrocarbon receptor nuclear translocator messenger ribonucleic acids and proteins in rat and human testis.
Schultz R, etal., Endocrinology 2003 Mar;144(3):767-76.
29.
Diet-relevant phytochemical intake affects the cardiac AhR and nrf2 transcriptome and reduces heart failure in hypertensive rats.
Seymour EM, etal., J Nutr Biochem. 2013 Sep;24(9):1580-6. doi: 10.1016/j.jnutbio.2013.01.008. Epub 2013 Mar 22.
Arnt Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 185,686,703 - 185,745,546 (+) NCBI GRCr8 mRatBN7.2 2 182,997,731 - 183,056,584 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 182,997,736 - 183,056,580 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 190,662,514 - 190,721,330 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 188,458,053 - 188,516,629 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 183,295,003 - 183,353,822 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 196,594,178 - 196,651,486 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 196,594,303 - 196,651,179 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 216,092,481 - 216,150,842 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 190,333,978 - 190,391,015 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 190,296,731 - 190,353,769 (+) NCBI Celera 2 175,530,933 - 175,587,940 (+) NCBI Celera Cytogenetic Map 2 q34 NCBI
ARNT Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 150,809,713 - 150,876,599 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 150,809,713 - 150,876,708 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 150,782,189 - 150,849,075 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 149,048,810 - 149,115,810 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 147,595,258 - 147,662,259 NCBI Celera 1 123,898,224 - 123,964,878 (-) NCBI Celera Cytogenetic Map 1 q21.3 NCBI HuRef 1 122,159,809 - 122,226,754 (-) NCBI HuRef CHM1_1 1 152,177,524 - 152,244,584 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 149,933,391 - 150,000,287 (-) NCBI T2T-CHM13v2.0
Arnt Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 95,341,674 - 95,404,551 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 95,341,699 - 95,404,551 (+) Ensembl GRCm39 Ensembl GRCm38 3 95,434,367 - 95,497,240 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 95,434,388 - 95,497,240 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 95,238,312 - 95,301,162 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 95,519,832 - 95,581,692 (+) NCBI MGSCv36 mm8 Celera 3 96,865,861 - 96,928,345 (+) NCBI Celera Cytogenetic Map 3 F2.1 NCBI cM Map 3 40.74 NCBI
Arnt Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955588 159,462 - 233,047 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955588 159,462 - 233,047 (-) NCBI ChiLan1.0 ChiLan1.0
ARNT Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 98,956,517 - 99,022,721 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 98,710,135 - 98,776,351 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 126,160,017 - 126,226,222 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 129,809,434 - 129,875,629 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 129,809,431 - 129,875,629 (-) Ensembl panpan1.1 panPan2
ARNT Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 Ensembl 17 59,941,353 - 60,010,867 (-) NCBI CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 17 59,941,353 - 60,010,867 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 17 59,385,568 - 59,456,622 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 17 60,956,018 - 61,028,041 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 17 60,956,029 - 61,028,010 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 17 59,785,290 - 59,856,876 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 17 59,869,465 - 59,941,376 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 17 60,597,849 - 60,669,366 (-) NCBI UU_Cfam_GSD_1.0
Arnt Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 22,002,839 - 22,062,779 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936580 1,036,973 - 1,082,984 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936580 1,038,420 - 1,093,319 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ARNT Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 98,333,459 - 98,389,457 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 98,333,431 - 98,390,012 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 107,586,868 - 107,638,152 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ARNT Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Vero_WHO_p1.0 NW_023666038 12,405,916 - 12,471,198 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Arnt
.
Predicted Target Of
Count of predictions: 42 Count of miRNA genes: 21 Interacting mature miRNAs: 21 Transcripts: ENSRNOT00000044738, ENSRNOT00000064442 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1578648 Bss11 Bone structure and strength QTL 11 4.7 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 2 114837527 211674221 Rat 1358356 Srcrt1 Stress Responsive Cort QTL1 3.66 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 2 161699179 222436696 Rat 1331734 Bp204 Blood pressure QTL 204 3.61192 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 168358098 223265385 Rat 1298074 Bp164 Blood pressure QTL 164 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 1354648 Bp239 Blood pressure QTL 239 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118463 226797303 Rat 1354649 Kidm17 Kidney mass QTL 17 2.9 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 2 81754530 227146641 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 1298076 Bp166 Blood pressure QTL 166 0.0009 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 136445150 202447032 Rat 152025245 Scl81 Serum cholesterol level QTL 81 3.49 blood cholesterol amount (VT:0000180) 2 122609194 206936711 Rat 70162 Bp63 Blood pressure QTL 63 5.64 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 2 169745596 214745596 Rat 1554319 Bmd2 Bone mineral density QTL 2 13.4 0.0001 lumbar vertebra area (VT:0010570) lumbar vertebra cross-sectional area (CMO:0001689) 2 114837675 212549332 Rat 12879836 Kidm61 Kidney mass QTL 61 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 152413072 185122374 Rat 1581569 Uae32 Urinary albumin excretion QTL 32 0.0001 urine protein amount (VT:0005160) urine albumin excretion rate (CMO:0000757) 2 78665619 219826953 Rat 10043136 Iddm54 Insulin dependent diabetes mellitus QTL 54 3.4 0.0001 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 2 143657411 190602963 Rat 12879837 Am2 Aortic mass QTL 2 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 2 152413072 185122374 Rat 12879838 Cm86 Cardiac mass QTL 86 0.002 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 2 152413072 185122374 Rat 1302793 Bw16 Body weight QTL 16 5 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 2 157142209 202446871 Rat 61467 Bp14 Blood pressure QTL 14 2.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 43154682 202446871 Rat 12879839 Cm85 Cardiac mass QTL 85 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 2 152413072 185122374 Rat 61469 Bp16 Blood pressure QTL 16 5.64 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 2 169745596 214745596 Rat 70175 BpQTLCluster3 Blood pressure QTL cluster 3 4.128 arterial blood pressure trait (VT:2000000) absolute change in systolic blood pressure (CMO:0000607) 2 135552573 202446871 Rat 1549833 Bp257 Blood pressure QTL 257 0.003 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 168354880 185122374 Rat 1358900 Bw48 Body weight QTL 48 4.88 body mass (VT:0001259) body weight (CMO:0000012) 2 157142078 211086598 Rat 1359030 Bp277 Blood pressure QTL 277 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 114837527 185876470 Rat 1331760 Bp206 Blood pressure QTL 206 3.62454 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 56043031 202447032 Rat 12879840 Bw179 Body weight QTL 179 0.005 body mass (VT:0001259) body weight (CMO:0000012) 2 152413072 185122374 Rat 1581502 Esta3 Estrogen-induced thymic atrophy QTL 3 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 2 136916935 189599348 Rat 9589044 Scfw1 Subcutaneous fat weight QTL 1 5.8 0.001 subcutaneous adipose mass (VT:1000472) abdominal subcutaneous fat pad weight (CMO:0002069) 2 182171407 227171407 Rat 8694435 Bw166 Body weight QTL 166 14.08 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 2 182171407 227171407 Rat 1359032 Hrtrt18 Heart rate QTL 18 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 2 157142078 192625452 Rat 2301966 Bp322 Blood pressure QTL 322 3.58 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 150540301 202447032 Rat 1298080 Bp163 Blood pressure QTL 163 0.02 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118275 202447032 Rat 8662832 Vetf7 Vascular elastic tissue fragility QTL 7 3.5 aorta elastin amount (VT:0003905) aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002) 2 81689826 221035911 Rat 1298085 Bp165 Blood pressure QTL 165 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 8694194 Abfw1 Abdominal fat weight QTL 1 11.7 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 2 182171407 227171407 Rat 1359022 Ppulsi1 Prepulse inhibition QTL 1 3.63 prepulse inhibition trait (VT:0003088) acoustic startle response measurement (CMO:0001519) 2 136916935 213594495 Rat 1641891 Alcrsp17 Alcohol response QTL 17 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 249053267 Rat 724534 Uae6 Urinary albumin excretion QTL 6 10 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 2 78665619 249053267 Rat 61374 Edpm2 Estrogen-dependent pituitary mass QTL 2 4.42 0.86 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 2 76539322 202447032 Rat 2300189 Bmd48 Bone mineral density QTL 48 5.8 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 2 179335906 224335906 Rat 8662843 Vetf9 Vascular elastic tissue fragility QTL 9 2.05 thoracic aorta molecular composition trait (VT:0010568) aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003) 2 157142078 226277316 Rat 631501 Bp101 Blood pressure QTL 101 2.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 150341684 202446871 Rat 2307174 Activ3 Activity QTL 3 4.83 0.000058 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 2 168594495 213594495 Rat 1331794 Bp202 Blood pressure QTL 202 3.66819 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 141194931 223265385 Rat 71113 Cari2 Carrageenan-induced inflammation QTL 2 2.7 0.009 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 2 141596551 202447032 Rat 1331805 Cm29 Cardiac mass QTL 29 3.50746 heart mass (VT:0007028) heart wet weight (CMO:0000069) 2 141194931 223265385 Rat 634308 Sach6 Saccharin preference QTL 6 4.9 taste sensitivity trait (VT:0001986) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 2 112456140 212696837 Rat 1598805 Memor8 Memory QTL 8 3 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 2 150341585 189039377 Rat 1358917 Cm42 Cardiac mass QTL 42 2.82 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 724568 Uae13 Urinary albumin excretion QTL 13 4.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 2 143157029 210020885 Rat 1358913 Cm41 Cardiac mass QTL 41 2.73 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 1300165 Rf9 Renal function QTL 9 3.28 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 2 133914684 202447032 Rat 61401 Niddm2 Non-insulin dependent diabetes mellitus QTL 2 4.54 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 144599348 189599348 Rat 631507 Bp105 Blood pressure QTL 105 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 112456140 212696837 Rat 1641925 Alcrsp2 Alcohol response QTL 2 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 221167075 Rat 1354609 Niddm62 Non-insulin dependent diabetes mellitus QTL 62 4.72 0.000006 insulin secretion trait (VT:0003564) plasma insulin level (CMO:0000342) 2 150540301 202447032 Rat 1598833 Bp295 Blood pressure QTL 295 3.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 147798556 192798556 Rat 61417 Cia10 Collagen induced arthritis QTL 10 3.4 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 2 179946951 224946951 Rat 1354622 Kidm16 Kidney mass QTL 16 3 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 2 81754530 222436696 Rat 631266 Bp132 Blood pressure QTL 132 0.0005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 46123260 202447032 Rat 631522 Bp74 Blood pressure QTL 74 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 172710921 184114403 Rat 8694383 Bw158 Body weight QTL 158 7.69 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 2 182171407 227171407 Rat 7488927 Bp365 Blood pressure QTL 365 0.008 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 162765032 207765032 Rat 1598838 Bp290 Blood pressure QTL 290 1.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 166539266 211539266 Rat 7488925 Bp364 Blood pressure QTL 364 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 160564068 205564068 Rat 2306901 Bp337 Blood pressure QTL 337 0.01 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 164073756 227146641 Rat 1354605 Rf48 Renal function QTL 48 2.9 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 2 74786664 206665859 Rat 6903312 Bw112 Body weight QTL 112 3.2 0.0013 body mass (VT:0001259) body weight (CMO:0000012) 2 143657569 184114274 Rat 1354601 Slep1 Serum leptin concentration QTL 1 5.39 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 2 43171017 184114403 Rat 2293084 Iddm26 Insulin dependent diabetes mellitus QTL 26 2.9 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 174930955 213594495 Rat
D2Rat125
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 2 185,710,866 - 185,711,033 (+) Marker Load Pipeline mRatBN7.2 2 183,021,898 - 183,022,065 (+) MAPPER mRatBN7.2 Rnor_6.0 2 196,618,335 - 196,618,501 NCBI Rnor6.0 Rnor_5.0 2 216,116,649 - 216,116,815 UniSTS Rnor5.0 RGSC_v3.4 2 190,358,165 - 190,358,332 RGD RGSC3.4 RGSC_v3.4 2 190,358,166 - 190,358,332 UniSTS RGSC3.4 RGSC_v3.1 2 190,320,919 - 190,321,086 RGD Celera 2 175,555,099 - 175,555,265 UniSTS SHRSP x BN Map 2 70.0098 UniSTS SHRSP x BN Map 2 70.0098 RGD Cytogenetic Map 2 q34 UniSTS
D2Rat150
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 2 185,694,938 - 185,695,127 (+) Marker Load Pipeline mRatBN7.2 2 183,005,969 - 183,006,158 (+) MAPPER mRatBN7.2 Rnor_6.0 2 196,602,418 - 196,602,606 NCBI Rnor6.0 Rnor_5.0 2 216,100,756 - 216,100,944 UniSTS Rnor5.0 RGSC_v3.4 2 190,342,092 - 190,342,281 RGD RGSC3.4 RGSC_v3.4 2 190,342,093 - 190,342,281 UniSTS RGSC3.4 RGSC_v3.1 2 190,304,847 - 190,305,035 RGD Celera 2 175,539,050 - 175,539,238 UniSTS RH 3.4 Map 2 1215.41 UniSTS RH 3.4 Map 2 1215.41 RGD RH 2.0 Map 2 896.3 RGD FHH x ACI Map 2 78.7699 RGD Cytogenetic Map 2 q34 UniSTS
D2Rat231
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 2 185,737,456 - 185,737,596 (+) Marker Load Pipeline mRatBN7.2 2 183,048,491 - 183,048,631 (+) MAPPER mRatBN7.2 Rnor_6.0 2 196,644,924 - 196,645,063 NCBI Rnor6.0 Rnor_5.0 2 216,143,623 - 216,143,762 UniSTS Rnor5.0 RGSC_v3.4 2 190,384,759 - 190,384,899 RGD RGSC3.4 RGSC_v3.4 2 190,384,760 - 190,384,899 UniSTS RGSC3.4 RGSC_v3.1 2 190,347,496 - 190,347,842 RGD Celera 2 175,581,688 - 175,581,827 UniSTS SHRSP x BN Map 2 70.0098 UniSTS SHRSP x BN Map 2 70.0098 RGD Cytogenetic Map 2 q34 UniSTS
D2Uia13
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 2 185,716,998 - 185,717,139 (+) Marker Load Pipeline mRatBN7.2 2 183,028,031 - 183,028,172 (+) MAPPER mRatBN7.2 Rnor_6.0 2 196,624,467 - 196,624,607 NCBI Rnor6.0 Rnor_5.0 2 216,122,781 - 216,122,921 UniSTS Rnor5.0 RGSC_v3.4 2 190,364,298 - 190,364,438 UniSTS RGSC3.4 RGSC_v3.1 2 190,327,051 - 190,327,192 RGD Celera 2 175,561,231 - 175,561,371 UniSTS Cytogenetic Map 2 q34 UniSTS
D2Wox41
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 2 185,737,978 - 185,738,694 (+) Marker Load Pipeline mRatBN7.2 2 183,049,013 - 183,049,729 (+) MAPPER mRatBN7.2 Rnor_6.0 2 196,645,446 - 196,646,164 NCBI Rnor6.0 Rnor_5.0 2 216,144,145 - 216,144,863 UniSTS Rnor5.0 RGSC_v3.4 2 190,385,282 - 190,386,000 UniSTS RGSC3.4 Celera 2 175,582,210 - 175,582,925 UniSTS Cytogenetic Map 2 q34 UniSTS
AI454670
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 182,996,831 - 182,997,028 (+) MAPPER mRatBN7.2 Rnor_6.0 2 196,593,283 - 196,593,479 NCBI Rnor6.0 Rnor_5.0 2 216,091,621 - 216,091,817 UniSTS Rnor5.0 RGSC_v3.4 2 190,332,958 - 190,333,154 UniSTS RGSC3.4 Celera 2 175,529,913 - 175,530,109 UniSTS RH 3.4 Map 2 1213.9 UniSTS Cytogenetic Map 2 q34 UniSTS
Arnt
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 183,054,811 - 183,054,909 (+) MAPPER mRatBN7.2 mRatBN7.2 2 183,054,875 - 183,054,909 (+) MAPPER mRatBN7.2 mRatBN7.2 2 183,054,811 - 183,055,328 (+) MAPPER mRatBN7.2 Rnor_6.0 2 196,651,246 - 196,651,794 NCBI Rnor6.0 Rnor_6.0 2 196,651,246 - 196,651,343 NCBI Rnor6.0 Rnor_5.0 2 216,149,945 - 216,150,493 UniSTS Rnor5.0 Rnor_5.0 2 216,149,945 - 216,150,042 UniSTS Rnor5.0 RGSC_v3.4 2 190,391,082 - 190,391,179 UniSTS RGSC3.4 Celera 2 175,588,007 - 175,588,104 UniSTS Cytogenetic Map 2 q34 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000044738 ⟹ ENSRNOP00000048259
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 183,011,332 - 183,056,580 (+) Ensembl Rnor_6.0 Ensembl 2 196,594,303 - 196,651,179 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000064442 ⟹ ENSRNOP00000060764
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 182,997,852 - 183,054,745 (+) Ensembl Rnor_6.0 Ensembl 2 196,594,303 - 196,651,179 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000091681 ⟹ ENSRNOP00000074418
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 182,997,736 - 183,056,580 (+) Ensembl Rnor_6.0 Ensembl 2 196,608,496 - 196,651,160 (+) Ensembl
RefSeq Acc Id:
NM_001389231 ⟹ NP_001376160
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 185,686,703 - 185,745,546 (+) NCBI mRatBN7.2 2 182,997,731 - 183,056,584 (+) NCBI
RefSeq Acc Id:
NM_012780 ⟹ NP_036912
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 185,686,703 - 185,745,546 (+) NCBI mRatBN7.2 2 182,997,731 - 183,056,584 (+) NCBI Rnor_6.0 2 196,594,303 - 196,651,179 (+) NCBI Rnor_5.0 2 216,092,481 - 216,150,842 (+) NCBI RGSC_v3.4 2 190,333,978 - 190,391,015 (+) RGD Celera 2 175,530,933 - 175,587,940 (+) RGD
Sequence:
TCTCGACCATGGCGGCGACTACAGCTAACCCAGAAATGACATCAGATGTGCCATCACTGGGTCCCACCATTGCTTCTGGAAATCCCGGACCTGGGATTCAAGGTGGAGGAGCTGTTGTCCAGAGGGCT
hide sequence
RefSeq Acc Id:
XM_063281325 ⟹ XP_063137395
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 185,686,952 - 185,745,546 (+) NCBI
RefSeq Acc Id:
NP_036912 ⟸ NM_012780
- Peptide Label:
isoform 1
- UniProtKB:
F1LMF9 (UniProtKB/TrEMBL)
- Sequence:
MAATTANPEMTSDVPSLGPTIASGNPGPGIQGGGAVVQRAIKRRSGLDFDDEGEVNSKFLRCDDEQMCNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCSALARKPDK
hide sequence
Ensembl Acc Id:
ENSRNOP00000048259 ⟸ ENSRNOT00000044738
Ensembl Acc Id:
ENSRNOP00000074418 ⟸ ENSRNOT00000091681
Ensembl Acc Id:
ENSRNOP00000060764 ⟸ ENSRNOT00000064442
RefSeq Acc Id:
NP_001376160 ⟸ NM_001389231
- Peptide Label:
isoform 2
- UniProtKB:
A0A0G2K804 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063137395 ⟸ XM_063281325
- Peptide Label:
isoform X1
- UniProtKB:
F1LMF9 (UniProtKB/TrEMBL)
RGD ID: 13691560 Promoter ID: EPDNEW_R2073 Type: multiple initiation site Name: Arnt_1 Description: aryl hydrocarbon receptor nuclear translocator SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 2 196,594,292 - 196,594,352 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2003-04-09
Arnt
aryl hydrocarbon receptor nuclear translocator
Arnt1
Aryl hydrocarbon receptor nuclear translocator 1
Symbol and Name updated
629477 APPROVED
2002-06-10
Arnt1
Aryl hydrocarbon receptor nuclear translocator 1
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_drugs
mediates dioxin toxicity
634668
gene_expression
expressed in testis
634668
gene_function
may act as a transcription factor
634669
gene_process
mediates dioxin toxicity
634668
