Symbol:
Zcchc17
Name:
zinc finger CCHC-type containing 17
RGD ID:
1565267
Description:
Predicted to enable RNA binding activity and identical protein binding activity. Predicted to be involved in RNA stabilization. Predicted to be located in nucleolus. Predicted to be part of cytosolic large ribosomal subunit. Orthologous to human ZCCHC17 (zinc finger CCHC-type containing 17); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-sulfonyldiphenol; bisphenol A.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC500555; nucleolar protein of 40 kDa; RGD1565267; similar to PS1D protein; zinc finger CCHC domain-containing protein 17; zinc finger, CCHC domain containing 17
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ZCCHC17 (zinc finger CCHC-type containing 17) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Zcchc17 (zinc finger, CCHC domain containing 17) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Zcchc17 (zinc finger CCHC-type containing 17) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ZCCHC17 (zinc finger CCHC-type containing 17) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ZCCHC17 (zinc finger CCHC-type containing 17) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Zcchc17 (zinc finger CCHC-type containing 17) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ZCCHC17 (zinc finger CCHC-type containing 17) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ZCCHC17 (zinc finger CCHC-type containing 17) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Zcchc17 (zinc finger CCHC-type containing 17) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Zcchc17 (zinc finger, CCHC domain containing 17)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
ZCCHC17 (zinc finger CCHC-type containing 17)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
zcchc17 (zinc finger, CCHC domain containing 17)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
zcchc17
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 147,942,789 - 147,984,596 (-) NCBI GRCr8 mRatBN7.2 5 142,658,626 - 142,700,440 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 142,658,589 - 142,700,426 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 145,357,901 - 145,399,693 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 147,127,707 - 147,169,498 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 147,125,098 - 147,166,475 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 148,535,519 - 148,577,315 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 148,535,519 - 148,577,292 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 152,252,914 - 152,294,538 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 149,347,190 - 149,388,386 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 5 141,125,063 - 141,166,773 (-) NCBI Celera Cytogenetic Map 5 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Zcchc17 Rat 1,2-dimethylhydrazine increases expression ISO RGD:1557061 6480464 1,2-Dimethylhydrazine results in increased expression of ZCCHC17 mRNA CTD PMID:22206623 Zcchc17 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1557061 6480464 Tetrachlorodibenzodioxin affects the expression of ZCCHC17 mRNA CTD PMID:21570461 Zcchc17 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of ZCCHC17 mRNA CTD PMID:33387578 Zcchc17 Rat 2-methylcholine affects expression ISO RGD:1604815 6480464 beta-methylcholine affects the expression of ZCCHC17 mRNA CTD PMID:21179406 Zcchc17 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO RGD:1604815 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 Zcchc17 Rat 4,4'-sulfonyldiphenol multiple interactions ISO RGD:1604815 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ... CTD PMID:28628672 Zcchc17 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ... CTD PMID:36041667 Zcchc17 Rat arsenite(3-) multiple interactions ISO RGD:1604815 6480464 arsenite promotes the reaction [G3BP1 protein binds to ZCCHC17 mRNA] CTD PMID:32406909 Zcchc17 Rat arsenous acid decreases expression ISO RGD:1557061 6480464 Arsenic Trioxide results in decreased expression of ZCCHC17 mRNA CTD PMID:35676786 Zcchc17 Rat benzo[a]pyrene increases expression ISO RGD:1557061 6480464 Benzo(a)pyrene results in increased expression of ZCCHC17 mRNA CTD PMID:22228805 Zcchc17 Rat benzo[a]pyrene decreases methylation ISO RGD:1557061 6480464 Benzo(a)pyrene results in decreased methylation of ZCCHC17 exon; Benzo(a)pyrene results in decreased methylation of ZCCHC17 more ... CTD PMID:27901495 Zcchc17 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ZCCHC17 mRNA CTD PMID:25181051 Zcchc17 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ... CTD PMID:36041667 Zcchc17 Rat bisphenol A decreases expression ISO RGD:1557061 6480464 bisphenol A results in decreased expression of ZCCHC17 mRNA CTD PMID:33221593 Zcchc17 Rat bisphenol F multiple interactions ISO RGD:1604815 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 Zcchc17 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ... CTD PMID:36041667 Zcchc17 Rat CGP 52608 multiple interactions ISO RGD:1604815 6480464 CGP 52608 promotes the reaction [RORA protein binds to ZCCHC17 gene] CTD PMID:28238834 Zcchc17 Rat cyclosporin A decreases expression ISO RGD:1604815 6480464 Cyclosporine results in decreased expression of ZCCHC17 mRNA CTD PMID:25562108 Zcchc17 Rat dexamethasone multiple interactions ISO RGD:1604815 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 Zcchc17 Rat diarsenic trioxide decreases expression ISO RGD:1557061 6480464 Arsenic Trioxide results in decreased expression of ZCCHC17 mRNA CTD PMID:35676786 Zcchc17 Rat diazinon increases methylation ISO RGD:1604815 6480464 Diazinon results in increased methylation of ZCCHC17 gene CTD PMID:22964155 Zcchc17 Rat Dibutyl phosphate affects expression ISO RGD:1604815 6480464 di-n-butylphosphoric acid affects the expression of ZCCHC17 mRNA CTD PMID:37042841 Zcchc17 Rat dibutyl phthalate decreases expression ISO RGD:1557061 6480464 Dibutyl Phthalate results in decreased expression of ZCCHC17 mRNA CTD PMID:21266533 Zcchc17 Rat dicrotophos decreases expression ISO RGD:1604815 6480464 dicrotophos results in decreased expression of ZCCHC17 mRNA CTD PMID:28302478 Zcchc17 Rat dorsomorphin multiple interactions ISO RGD:1604815 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Zcchc17 Rat ethanol affects splicing ISO RGD:1557061 6480464 Ethanol affects the splicing of ZCCHC17 mRNA CTD PMID:30319688 Zcchc17 Rat fenthion increases expression ISO RGD:1557061 6480464 Fenthion results in increased expression of ZCCHC17 mRNA CTD PMID:34813904 Zcchc17 Rat fluoranthene multiple interactions ISO RGD:1557061 6480464 [1-methylanthracene co-treated with fluoranthene] results in decreased expression of ZCCHC17 mRNA CTD PMID:28329830 Zcchc17 Rat FR900359 increases phosphorylation ISO RGD:1604815 6480464 FR900359 results in increased phosphorylation of ZCCHC17 protein CTD PMID:37730182 Zcchc17 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of ZCCHC17 mRNA CTD PMID:33387578 Zcchc17 Rat glafenine increases expression EXP 6480464 Glafenine results in increased expression of ZCCHC17 mRNA CTD PMID:24136188 Zcchc17 Rat indometacin multiple interactions ISO RGD:1604815 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 Zcchc17 Rat lead(0) affects splicing ISO RGD:1604815 6480464 Lead affects the splicing of ZCCHC17 mRNA CTD PMID:28903495 Zcchc17 Rat leflunomide decreases expression ISO RGD:1604815 6480464 leflunomide results in decreased expression of ZCCHC17 mRNA CTD PMID:28988120 Zcchc17 Rat methidathion increases expression ISO RGD:1557061 6480464 methidathion results in increased expression of ZCCHC17 mRNA CTD PMID:34813904 Zcchc17 Rat okadaic acid increases expression ISO RGD:1604815 6480464 Okadaic Acid results in increased expression of ZCCHC17 mRNA CTD PMID:38832940 Zcchc17 Rat paracetamol affects expression ISO RGD:1557061 6480464 Acetaminophen affects the expression of ZCCHC17 mRNA CTD PMID:17562736 Zcchc17 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of ZCCHC17 mRNA CTD PMID:33387578 Zcchc17 Rat pirinixic acid multiple interactions ISO RGD:1604815 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ... CTD PMID:19710929 Zcchc17 Rat SB 431542 multiple interactions ISO RGD:1604815 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Zcchc17 Rat silicon dioxide decreases expression ISO RGD:1604815 6480464 Silicon Dioxide results in decreased expression of ZCCHC17 mRNA CTD PMID:34973136 Zcchc17 Rat sodium arsenite increases expression ISO RGD:1604815 6480464 sodium arsenite results in increased expression of ZCCHC17 mRNA CTD PMID:38568856 Zcchc17 Rat sunitinib decreases expression ISO RGD:1604815 6480464 Sunitinib results in decreased expression of ZCCHC17 mRNA CTD PMID:31533062 Zcchc17 Rat temozolomide increases expression ISO RGD:1604815 6480464 Temozolomide results in increased expression of ZCCHC17 mRNA CTD PMID:31758290 Zcchc17 Rat thalidomide increases expression ISO RGD:1557061 6480464 Thalidomide results in increased expression of ZCCHC17 mRNA CTD PMID:26217789 Zcchc17 Rat titanium dioxide decreases expression ISO RGD:1604815 6480464 titanium dioxide results in decreased expression of ZCCHC17 mRNA CTD PMID:34973136 Zcchc17 Rat trichostatin A increases expression ISO RGD:1604815 6480464 trichostatin A results in increased expression of ZCCHC17 mRNA CTD PMID:26272509 Zcchc17 Rat trichostatin A affects expression ISO RGD:1604815 6480464 trichostatin A affects the expression of ZCCHC17 mRNA CTD PMID:28542535 Zcchc17 Rat trichostatin A multiple interactions ISO RGD:1604815 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Zcchc17 Rat urethane increases expression ISO RGD:1604815 6480464 Urethane results in increased expression of ZCCHC17 mRNA CTD PMID:28818685 Zcchc17 Rat valproic acid increases expression ISO RGD:1604815 6480464 Valproic Acid results in increased expression of ZCCHC17 mRNA CTD PMID:29154799 Zcchc17 Rat valproic acid affects expression ISO RGD:1557061 6480464 Valproic Acid affects the expression of ZCCHC17 mRNA CTD PMID:17292431 Zcchc17 Rat valproic acid affects expression ISO RGD:1604815 6480464 Valproic Acid affects the expression of ZCCHC17 mRNA CTD PMID:25979313 Zcchc17 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of ZCCHC17 mRNA CTD PMID:19015723
1,2-dimethylhydrazine (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-methylcholine (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) arsenite(3-) (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol F (EXP,ISO) CGP 52608 (ISO) cyclosporin A (ISO) dexamethasone (ISO) diarsenic trioxide (ISO) diazinon (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) dicrotophos (ISO) dorsomorphin (ISO) ethanol (ISO) fenthion (ISO) fluoranthene (ISO) FR900359 (ISO) gentamycin (EXP) glafenine (EXP) indometacin (ISO) lead(0) (ISO) leflunomide (ISO) methidathion (ISO) okadaic acid (ISO) paracetamol (EXP,ISO) pirinixic acid (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sunitinib (ISO) temozolomide (ISO) thalidomide (ISO) titanium dioxide (ISO) trichostatin A (ISO) urethane (ISO) valproic acid (ISO) vinclozolin (EXP)
Zcchc17 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 147,942,789 - 147,984,596 (-) NCBI GRCr8 mRatBN7.2 5 142,658,626 - 142,700,440 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 142,658,589 - 142,700,426 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 145,357,901 - 145,399,693 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 147,127,707 - 147,169,498 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 147,125,098 - 147,166,475 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 148,535,519 - 148,577,315 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 148,535,519 - 148,577,292 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 152,252,914 - 152,294,538 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 149,347,190 - 149,388,386 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 5 141,125,063 - 141,166,773 (-) NCBI Celera Cytogenetic Map 5 q36 NCBI
ZCCHC17 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 31,297,032 - 31,364,936 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 31,296,982 - 31,364,953 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 31,769,879 - 31,837,783 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 31,542,429 - 31,610,367 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 1 30,026,341 - 30,094,350 (+) NCBI Celera Cytogenetic Map 1 p35.2 NCBI HuRef 1 29,876,542 - 29,944,556 (+) NCBI HuRef CHM1_1 1 31,885,748 - 31,953,687 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 31,149,209 - 31,217,206 (+) NCBI T2T-CHM13v2.0
Zcchc17 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 130,209,176 - 130,253,785 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 130,209,176 - 130,253,736 (-) Ensembl GRCm39 Ensembl GRCm38 4 130,315,383 - 130,359,992 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 130,315,383 - 130,359,943 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 129,993,329 - 130,037,190 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 129,818,205 - 129,840,890 (-) NCBI MGSCv36 mm8 Celera 4 128,649,036 - 128,692,835 (-) NCBI Celera Cytogenetic Map 4 D2.2 NCBI cM Map 4 63.43 NCBI
Zcchc17 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955452 9,793,264 - 9,850,396 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955452 9,793,264 - 9,850,396 (+) NCBI ChiLan1.0 ChiLan1.0
ZCCHC17 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 195,468,411 - 195,536,665 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 194,587,456 - 194,655,395 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 30,576,876 - 30,645,156 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 31,597,190 - 31,665,371 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 31,597,212 - 31,665,373 (+) Ensembl panpan1.1 panPan2
ZCCHC17 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 69,659,152 - 69,720,942 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 66,237,619 - 66,300,042 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 70,223,407 - 70,285,922 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 70,223,408 - 70,285,234 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 67,059,336 - 67,121,725 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 68,056,026 - 68,118,431 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 69,055,592 - 69,118,094 (-) NCBI UU_Cfam_GSD_1.0
Zcchc17 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 48,700,222 - 48,751,137 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936474 14,525,019 - 14,576,648 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936474 14,525,043 - 14,576,627 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ZCCHC17 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 87,879,830 - 87,942,014 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 87,879,727 - 87,942,857 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 81,586,425 - 81,631,241 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ZCCHC17 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 101,472,935 - 101,540,741 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 101,473,694 - 101,540,704 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666033 15,133,560 - 15,201,983 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Zcchc17
.
Predicted Target Of
Count of predictions: 451 Count of miRNA genes: 223 Interacting mature miRNAs: 259 Transcripts: ENSRNOT00000017156 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1331796 Thshl2 Thyroid stimulating hormone level QTL 2 2.3 blood thyroid-stimulating hormone amount (VT:0005119) serum thyroid stimulating hormone level (CMO:0001248) 5 97059760 147465714 Rat 10053720 Scort26 Serum corticosterone level QTL 26 2.06 0.0147 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 124965598 166875058 Rat 1549845 Scl44 Serum cholesterol level QTL 44 6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 40128307 148607290 Rat 8552960 Pigfal15 Plasma insulin-like growth factor 1 level QTL 15 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 111416838 156416838 Rat 631562 Apr2 Acute phase response QTL 2 3.7 blood murinoglobulin 1 amount (VT:0010597) plasma murinoglobulin 1 level (CMO:0001931) 5 135927956 166875058 Rat 61444 Strs2 Sensitivity to stroke QTL 2 4.7 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 5 135929696 166875058 Rat 61452 Ciaa5 CIA Autoantibody QTL 5 3.5 blood autoantibody amount (VT:0003725) calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281) 5 94858972 143070159 Rat 70156 Niddm30 Non-insulin dependent diabetes mellitus QTL 30 3.98 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 5 129132447 151006154 Rat 8552908 Pigfal4 Plasma insulin-like growth factor 1 level QTL 4 6.6 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 128506074 166875058 Rat 1331803 Rf32 Renal function QTL 32 2.798 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 5 129132428 143070159 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 7794791 Mcs33 Mammary carcinoma susceptibility QTL 33 1.93 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 5 131345754 166875058 Rat 7207486 Bss109 Bone structure and strength QTL 109 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 5 106906205 151906205 Rat 7207481 Bss106 Bone structure and strength QTL 106 7.9 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 106906205 151906205 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1598861 Cm64 Cardiac mass QTL 64 2.9 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 127798274 166875058 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 631505 Bp103 Blood pressure QTL 103 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 132717196 165560427 Rat 1549838 Bss4 Bone structure and strength QTL 4 9.2 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 5 106906205 151906205 Rat 1641920 Colcs1 Colorectal carcinoma susceptibility QTL 1 2.99 0.0055 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 5 121846814 166846814 Rat 8694169 Bw148 Body weight QTL 148 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 128506074 166875058 Rat 8657050 Bw146 Body weight QTL 146 19.84 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 108938288 153938288 Rat 1581510 Cm54 Cardiac mass QTL 54 3.4 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 5 120740824 143608494 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 2317056 Wbc3 White blood cell count QTL 3 2.51 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 5 105999803 150999803 Rat 634349 Bp139 Blood pressure QTL 139 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128924607 166875058 Rat 724525 Bp147 Blood pressure QTL 147 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 126424772 166875058 Rat 1598847 Cm62 Cardiac mass QTL 62 3.4 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 108845856 153845856 Rat 2293642 Bss37 Bone structure and strength QTL 37 4.64 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 120740824 151018848 Rat 1578673 Bmd13 Bone mineral density QTL 13 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 5 103689353 148689353 Rat 738018 Anxrr4 Anxiety related response QTL 4 5.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 5 130130159 166875058 Rat 7207488 Bss110 Bone structure and strength QTL 1 8.4 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 5 106906205 151906205 Rat 8694441 Bw169 Body weight QTL 169 17.61 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 5 111416838 156416838 Rat 7207491 Bss112 Bone structure and strength QTL 112 7 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 5 106906205 151906205 Rat 8694389 Bw160 Body weight QTL 160 6.17 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 5 111416838 156416838 Rat 61426 Scl2 Serum cholesterol level QTL 2 7.3 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 59793399 143070159 Rat 1354598 Srn6 Serum renin concentration QTL 6 3.8 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 5 69540295 151018848 Rat 8694198 Abfw3 Abdominal fat weight QTL 3 16.13 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 5 111416838 156416838 Rat 1298089 Scl14 Serum cholesterol level QTL 14 5.8 0.0004 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 108845856 153845856 Rat 1598819 Bp292 Blood pressure QTL 292 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 127798274 166875058 Rat 1358187 Emca1 Estrogen-induced mammary cancer QTL 1 4.4 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 5 99216724 148607142 Rat
RH134427
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 142,658,732 - 142,658,918 (+) MAPPER mRatBN7.2 Rnor_6.0 5 148,535,625 - 148,535,810 NCBI Rnor6.0 Rnor_5.0 5 152,253,021 - 152,253,206 UniSTS Rnor5.0 RGSC_v3.4 5 149,347,296 - 149,347,481 UniSTS RGSC3.4 Celera 5 141,125,169 - 141,125,354 UniSTS RH 3.4 Map 5 990.09 UniSTS Cytogenetic Map 5 q36 UniSTS
RH94406
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 142,658,522 - 142,658,702 (+) MAPPER mRatBN7.2 mRatBN7.2 5 15,110,318 - 15,110,494 (+) MAPPER mRatBN7.2 Rnor_6.0 5 14,994,377 - 14,994,552 NCBI Rnor6.0 Rnor_6.0 5 148,535,415 - 148,535,594 NCBI Rnor6.0 Rnor_5.0 5 19,778,456 - 19,778,631 UniSTS Rnor5.0 Rnor_5.0 5 152,252,811 - 152,252,990 UniSTS Rnor5.0 RGSC_v3.4 5 149,347,086 - 149,347,265 UniSTS RGSC3.4 RGSC_v3.4 5 15,336,448 - 15,336,623 UniSTS RGSC3.4 Celera 5 14,492,133 - 14,492,308 UniSTS Celera 5 141,124,959 - 141,125,138 UniSTS Cytogenetic Map 5 q36 UniSTS
RH138794
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 142,659,415 - 142,659,557 (+) MAPPER mRatBN7.2 Rnor_6.0 5 148,536,308 - 148,536,449 NCBI Rnor6.0 Rnor_5.0 5 152,253,704 - 152,253,845 UniSTS Rnor5.0 RGSC_v3.4 5 149,347,979 - 149,348,120 UniSTS RGSC3.4 Celera 5 141,125,852 - 141,125,993 UniSTS RH 3.4 Map 5 989.6 UniSTS Cytogenetic Map 5 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000017156 ⟹ ENSRNOP00000017156
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 142,658,627 - 142,700,426 (-) Ensembl Rnor_6.0 Ensembl 5 148,535,519 - 148,577,292 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000100987 ⟹ ENSRNOP00000085072
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 142,658,628 - 142,700,409 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000108745 ⟹ ENSRNOP00000078016
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 142,658,589 - 142,700,387 (-) Ensembl
RefSeq Acc Id:
NM_001109267 ⟹ NP_001102737
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 147,942,789 - 147,984,584 (-) NCBI mRatBN7.2 5 142,658,626 - 142,700,426 (-) NCBI Rnor_6.0 5 148,535,519 - 148,577,292 (-) NCBI Rnor_5.0 5 152,252,914 - 152,294,538 (-) NCBI RGSC_v3.4 5 149,347,190 - 149,388,386 (-) RGD Celera 5 141,125,063 - 141,166,773 (-) RGD
Sequence:
CGCCGTGCATTGTGGGTGAGAACGAGCGGAGCAGATTCAGTGTTCCTAGGGATGAAGCGGCTGTCCTGTTAGGAGCGGACGCGGAGACGTTTGAATTAGCTTTAGCGGAAGAGAAATGGAGGAGCCGT
hide sequence
RefSeq Acc Id:
NM_001395613 ⟹ NP_001382542
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 147,942,789 - 147,984,584 (-) NCBI mRatBN7.2 5 142,658,626 - 142,700,426 (-) NCBI
RefSeq Acc Id:
NM_001395614 ⟹ NP_001382543
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 147,942,789 - 147,984,584 (-) NCBI mRatBN7.2 5 142,658,626 - 142,700,426 (-) NCBI
RefSeq Acc Id:
NR_172648
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 147,942,789 - 147,984,584 (-) NCBI mRatBN7.2 5 142,658,626 - 142,700,426 (-) NCBI
RefSeq Acc Id:
XM_006238970 ⟹ XP_006239032
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 147,942,789 - 147,984,596 (-) NCBI mRatBN7.2 5 142,659,656 - 142,700,440 (-) NCBI Rnor_6.0 5 148,535,521 - 148,577,306 (-) NCBI Rnor_5.0 5 152,252,914 - 152,294,538 (-) NCBI
Sequence:
CGCCCCCTCAGGCGCGCCGTGCATTGTGGGTGAGAACGAGCGGAGCAGATTCAGTGTTCCTAGGGATGAAGCGGCTGTCCTGTTAGGAGCGGACGCGGAGTCTGGTCCATCGAACTCACATGTCGTCT
hide sequence
RefSeq Acc Id:
XM_039110612 ⟹ XP_038966540
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 147,942,789 - 147,984,566 (-) NCBI mRatBN7.2 5 142,659,373 - 142,700,422 (-) NCBI
RefSeq Acc Id:
XM_063288265 ⟹ XP_063144335
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 147,942,789 - 147,978,732 (-) NCBI
RefSeq Acc Id:
NP_001102737 ⟸ NM_001109267
- Peptide Label:
isoform 1
- UniProtKB:
D3ZCQ7 (UniProtKB/TrEMBL), A6ISP0 (UniProtKB/TrEMBL), A0A8I5ZJN0 (UniProtKB/TrEMBL)
- Sequence:
MNSGRPETMENLPALYTIFQGEVAMVTDYGAFIKIPGCRKQGLVHRTHMSSCRVDKPSEIVDVGDKVWVKLIGREMKNDRIKVSLSMKVVNQGTGKDLDPNNVIIEQEERRRRSFQDYTGQKITLEAV
hide sequence
RefSeq Acc Id:
XP_006239032 ⟸ XM_006238970
- Peptide Label:
isoform X2
- Sequence:
MSSCRVDKPSEIVDVGDKVWVKLIGREMKNDRIKVSLSMKVVNQGTGKDLDPNNVIIEQEERRRRSFQDYTGQKITLEAVLNTTCKKCGCKGHFAKDCFMQPGGTKYSLVPEEEEEKEEAKAEGLEKP
hide sequence
Ensembl Acc Id:
ENSRNOP00000017156 ⟸ ENSRNOT00000017156
RefSeq Acc Id:
XP_038966540 ⟸ XM_039110612
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I5ZJN0 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000078016 ⟸ ENSRNOT00000108745
Ensembl Acc Id:
ENSRNOP00000085072 ⟸ ENSRNOT00000100987
RefSeq Acc Id:
NP_001382543 ⟸ NM_001395614
- Peptide Label:
isoform 3
RefSeq Acc Id:
NP_001382542 ⟸ NM_001395613
- Peptide Label:
isoform 2
RefSeq Acc Id:
XP_063144335 ⟸ XM_063288265
- Peptide Label:
isoform X2
RGD ID: 13694084 Promoter ID: EPDNEW_R4608 Type: initiation region Name: Zcchc17_1 Description: zinc finger CCHC-type containing 17 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 148,577,254 - 148,577,314 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-02-17
Zcchc17
zinc finger CCHC-type containing 17
Zcchc17
zinc finger, CCHC domain containing 17
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-03-07
Zcchc17
zinc finger, CCHC domain containing 17
RGD1565267_predicted
similar to PS1D protein (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-07
RGD1565267_predicted
similar to PS1D protein (predicted)
LOC500555
similar to PS1D protein
Symbol and Name status set to approved
1299863 APPROVED
2006-02-09
LOC500555
similar to PS1D protein
Symbol and Name status set to provisional
70820 PROVISIONAL
