Symbol:
Tmem65
Name:
transmembrane protein 65
RGD ID:
1563224
Description:
Predicted to be involved in cardiac conduction; cardiac ventricle development; and regulation of cardiac conduction. Predicted to be located in several cellular components, including intercalated disc; mitochondrial inner membrane; and nucleolus. Predicted to be active in mitochondrion. Orthologous to human TMEM65 (transmembrane protein 65); INTERACTS WITH 2,3,7,8-Tetrachlorodibenzofuran; 3,3',5,5'-tetrabromobisphenol A; 4,4'-diaminodiphenylmethane.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
hypothetical protein LOC500874; LOC500874; RGD1563224; similar to 4930438D12Rik protein; uncharacterized protein LOC500874
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 92,163,632 - 92,268,430 (-) NCBI GRCr8 mRatBN7.2 7 90,336,997 - 90,378,930 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 90,274,142 - 90,379,474 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 92,226,577 - 92,267,565 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 94,427,858 - 94,468,726 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 94,252,518 - 94,293,603 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 98,668,589 - 98,709,613 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 98,605,722 - 98,709,649 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 99,270,336 - 99,310,327 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 95,545,429 - 95,587,199 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 7 87,102,931 - 87,143,627 (-) NCBI Celera Cytogenetic Map 7 q33 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Tmem65 Rat (1->4)-beta-D-glucan multiple interactions ISO RGD:1618291 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of TMEM65 mRNA CTD PMID:36331819 Tmem65 Rat 1,2-dimethylhydrazine decreases expression ISO RGD:1618291 6480464 1,2-Dimethylhydrazine results in decreased expression of TMEM65 mRNA CTD PMID:22206623 Tmem65 Rat 2,3',4,4',5-Pentachlorobiphenyl affects expression ISO RGD:1618291 6480464 2,3',4,4',5-pentachlorobiphenyl affects the expression of TMEM65 mRNA CTD PMID:31388691 Tmem65 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1618291 6480464 Tetrachlorodibenzodioxin results in increased expression of TMEM65 mRNA CTD PMID:19465110 Tmem65 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1618291 6480464 Tetrachlorodibenzodioxin affects the expression of TMEM65 mRNA CTD PMID:21570461 Tmem65 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2,3,7,8-tetrachlorodibenzofuran results in decreased expression of TMEM65 mRNA CTD PMID:32109520 Tmem65 Rat 3,3',5,5'-tetrabromobisphenol A increases expression EXP 6480464 tetrabromobisphenol A results in increased expression of TMEM65 mRNA CTD PMID:27914987 Tmem65 Rat 4,4'-diaminodiphenylmethane increases expression EXP 6480464 4,4'-diaminodiphenylmethane results in increased expression of TMEM65 mRNA CTD PMID:25380136 Tmem65 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of TMEM65 mRNA CTD PMID:24780913 Tmem65 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of TMEM65 mRNA CTD PMID:30047161 Tmem65 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of TMEM65 mRNA CTD PMID:31881176 Tmem65 Rat aconitine decreases expression EXP 6480464 Aconitine results in decreased expression of TMEM65 protein CTD PMID:33236894 Tmem65 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of TMEM65 mRNA CTD PMID:28959563 Tmem65 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of TMEM65 mRNA CTD PMID:30047161 Tmem65 Rat antirheumatic drug increases expression ISO RGD:1603356 6480464 Antirheumatic Agents results in increased expression of TMEM65 mRNA CTD PMID:24449571 Tmem65 Rat aristolochic acid A decreases expression ISO RGD:1603356 6480464 aristolochic acid I results in decreased expression of TMEM65 mRNA CTD PMID:33212167 Tmem65 Rat arsenite(3-) multiple interactions ISO RGD:1603356 6480464 arsenite inhibits the reaction [G3BP1 protein binds to TMEM65 mRNA] CTD PMID:32406909 Tmem65 Rat azoxystrobin decreases expression ISO RGD:1603356 6480464 azoxystrobin results in decreased expression of TMEM65 mRNA CTD PMID:33512557 Tmem65 Rat benzo[a]pyrene increases expression ISO RGD:1618291 6480464 Benzo(a)pyrene results in increased expression of TMEM65 mRNA CTD PMID:22228805 Tmem65 Rat benzo[a]pyrene diol epoxide I decreases expression ISO RGD:1603356 6480464 7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in decreased expression of TMEM65 mRNA CTD PMID:19150397 Tmem65 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of TMEM65 mRNA CTD PMID:25181051 Tmem65 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of TMEM65 mRNA CTD PMID:33296240 Tmem65 Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of TMEM65 mRNA CTD PMID:33453195 Tmem65 Rat carbamazepine affects expression ISO RGD:1603356 6480464 Carbamazepine affects the expression of TMEM65 mRNA CTD PMID:25979313 Tmem65 Rat choline multiple interactions ISO RGD:1618291 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ... CTD PMID:20938992 Tmem65 Rat cobalt dichloride decreases expression ISO RGD:1603356 6480464 cobaltous chloride results in decreased expression of TMEM65 mRNA CTD PMID:19320972 Tmem65 Rat coumestrol multiple interactions ISO RGD:1603356 6480464 [Coumestrol co-treated with 2,3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of TMEM65 mRNA CTD PMID:19167446 Tmem65 Rat cyclosporin A increases expression ISO RGD:1603356 6480464 Cyclosporine results in increased expression of TMEM65 mRNA CTD PMID:25562108 Tmem65 Rat deguelin decreases expression ISO RGD:1603356 6480464 deguelin results in decreased expression of TMEM65 mRNA CTD PMID:33512557 Tmem65 Rat dibutyl phthalate increases expression ISO RGD:1618291 6480464 Dibutyl Phthalate results in increased expression of TMEM65 mRNA CTD PMID:21266533 Tmem65 Rat doxorubicin affects expression ISO RGD:1603356 6480464 Doxorubicin affects the expression of TMEM65 protein CTD PMID:29385562 Tmem65 Rat Enterolactone multiple interactions ISO RGD:1603356 6480464 [Coumestrol co-treated with 2,3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of TMEM65 mRNA CTD PMID:19167446 Tmem65 Rat ethyl methanesulfonate increases expression ISO RGD:1603356 6480464 Ethyl Methanesulfonate results in increased expression of TMEM65 mRNA CTD PMID:23649840 Tmem65 Rat folic acid multiple interactions ISO RGD:1618291 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ... CTD PMID:20938992 Tmem65 Rat formaldehyde increases expression ISO RGD:1603356 6480464 Formaldehyde results in increased expression of TMEM65 mRNA CTD PMID:23649840 Tmem65 Rat furan increases methylation EXP 6480464 furan results in increased methylation of TMEM65 gene CTD PMID:22079235 Tmem65 Rat glycidyl methacrylate decreases expression ISO RGD:1603356 6480464 glycidyl methacrylate results in decreased expression of TMEM65 protein CTD PMID:36641056 Tmem65 Rat hydrogen peroxide decreases expression ISO RGD:1603356 6480464 Hydrogen Peroxide results in decreased expression of TMEM65 mRNA CTD PMID:18951874 Tmem65 Rat L-methionine multiple interactions ISO RGD:1618291 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ... CTD PMID:20938992 Tmem65 Rat malathion increases expression ISO RGD:1603356 6480464 Malathion results in increased expression of TMEM65 mRNA CTD PMID:37047231 Tmem65 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of TMEM65 mRNA CTD PMID:30047161 Tmem65 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of TMEM65 gene CTD PMID:35440735 Tmem65 Rat methyl methanesulfonate increases expression ISO RGD:1603356 6480464 Methyl Methanesulfonate results in increased expression of TMEM65 mRNA CTD PMID:23649840 Tmem65 Rat N-nitrosodimethylamine increases expression EXP 6480464 Dimethylnitrosamine results in increased expression of TMEM65 mRNA CTD PMID:25380136 Tmem65 Rat paracetamol increases expression ISO RGD:1603356 6480464 Acetaminophen results in increased expression of TMEM65 mRNA CTD PMID:22230336 Tmem65 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of TMEM65 mRNA CTD PMID:33387578 Tmem65 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:1618291 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of TMEM65 mRNA; [perfluorooctane sulfonic more ... CTD PMID:36331819 Tmem65 Rat pirinixic acid increases expression ISO RGD:1618291 6480464 pirinixic acid results in increased expression of TMEM65 mRNA CTD PMID:18301758 Tmem65 Rat pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of TMEM65 mRNA CTD PMID:30047161 Tmem65 Rat pyrimidifen decreases expression ISO RGD:1603356 6480464 pyrimidifen results in decreased expression of TMEM65 mRNA CTD PMID:33512557 Tmem65 Rat quercetin decreases expression ISO RGD:1603356 6480464 Quercetin results in decreased expression of TMEM65 mRNA CTD PMID:21632981 Tmem65 Rat rotenone decreases expression ISO RGD:1603356 6480464 Rotenone results in decreased expression of TMEM65 mRNA CTD PMID:33512557 Tmem65 Rat silver atom decreases expression ISO RGD:1618291 6480464 Silver results in decreased expression of TMEM65 mRNA CTD PMID:27131904 Tmem65 Rat silver(0) decreases expression ISO RGD:1618291 6480464 Silver results in decreased expression of TMEM65 mRNA CTD PMID:27131904 Tmem65 Rat sodium arsenite increases expression ISO RGD:1603356 6480464 sodium arsenite results in increased expression of TMEM65 mRNA CTD PMID:28595984 Tmem65 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of TMEM65 mRNA CTD PMID:30047161 Tmem65 Rat tetrachloromethane increases expression ISO RGD:1618291 6480464 Carbon Tetrachloride results in increased expression of TMEM65 mRNA CTD PMID:31919559 Tmem65 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of TMEM65 mRNA CTD PMID:34492290 Tmem65 Rat thiram increases expression ISO RGD:1603356 6480464 Thiram results in increased expression of TMEM65 mRNA CTD PMID:38568856 Tmem65 Rat titanium dioxide decreases methylation ISO RGD:1618291 6480464 titanium dioxide results in decreased methylation of TMEM65 gene CTD PMID:35295148 Tmem65 Rat valproic acid decreases methylation ISO RGD:1603356 6480464 Valproic Acid results in decreased methylation of TMEM65 gene CTD PMID:29154799 Tmem65 Rat valproic acid affects expression ISO RGD:1603356 6480464 Valproic Acid affects the expression of TMEM65 mRNA CTD PMID:25979313 Tmem65 Rat valproic acid increases expression ISO RGD:1603356 6480464 Valproic Acid results in increased expression of TMEM65 mRNA CTD PMID:23179753|PMID:27188386|PMID:29154799
(1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 3,3',5,5'-tetrabromobisphenol A (EXP) 4,4'-diaminodiphenylmethane (EXP) 6-propyl-2-thiouracil (EXP) acetamide (EXP) aconitine (EXP) acrylamide (EXP) amitrole (EXP) antirheumatic drug (ISO) aristolochic acid A (ISO) arsenite(3-) (ISO) azoxystrobin (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bisphenol A (EXP) cadmium dichloride (EXP) carbamazepine (ISO) choline (ISO) cobalt dichloride (ISO) coumestrol (ISO) cyclosporin A (ISO) deguelin (ISO) dibutyl phthalate (ISO) doxorubicin (ISO) Enterolactone (ISO) ethyl methanesulfonate (ISO) folic acid (ISO) formaldehyde (ISO) furan (EXP) glycidyl methacrylate (ISO) hydrogen peroxide (ISO) L-methionine (ISO) malathion (ISO) methimazole (EXP) methoxychlor (EXP) methyl methanesulfonate (ISO) N-nitrosodimethylamine (EXP) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) pirinixic acid (ISO) pregnenolone 16alpha-carbonitrile (EXP) pyrimidifen (ISO) quercetin (ISO) rotenone (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) sulfadimethoxine (EXP) tetrachloromethane (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) valproic acid (ISO)
Tmem65 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 92,163,632 - 92,268,430 (-) NCBI GRCr8 mRatBN7.2 7 90,336,997 - 90,378,930 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 90,274,142 - 90,379,474 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 92,226,577 - 92,267,565 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 94,427,858 - 94,468,726 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 94,252,518 - 94,293,603 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 98,668,589 - 98,709,613 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 98,605,722 - 98,709,649 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 99,270,336 - 99,310,327 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 95,545,429 - 95,587,199 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 7 87,102,931 - 87,143,627 (-) NCBI Celera Cytogenetic Map 7 q33 NCBI
TMEM65 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 8 124,306,189 - 124,372,701 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 8 124,306,189 - 124,372,701 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 8 125,318,430 - 125,384,942 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 8 125,392,340 - 125,454,121 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 8 121,511,293 - 121,573,166 (-) NCBI Celera Cytogenetic Map 8 q24.13 NCBI HuRef 8 120,650,408 - 120,670,285 (-) NCBI HuRef CHM1_1 8 125,363,524 - 125,425,289 (-) NCBI CHM1_1 T2T-CHM13v2.0 8 125,438,941 - 125,505,444 (-) NCBI T2T-CHM13v2.0
Tmem65 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 15 58,654,118 - 58,695,510 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 15 58,654,118 - 58,695,487 (-) Ensembl GRCm39 Ensembl GRCm38 15 58,782,269 - 58,823,663 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 15 58,782,269 - 58,823,638 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 15 58,613,824 - 58,654,982 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 15 58,612,352 - 58,653,510 (-) NCBI MGSCv36 mm8 Celera 15 60,311,677 - 60,352,685 (-) NCBI Celera Cytogenetic Map 15 D1 NCBI cM Map 15 25.09 NCBI
Tmem65 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955540 3,007,879 - 3,064,919 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955540 3,006,776 - 3,064,938 (-) NCBI ChiLan1.0 ChiLan1.0
TMEM65 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 7 141,730,177 - 141,796,664 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 8 117,241,536 - 117,307,806 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 8 120,993,261 - 121,059,743 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 8 123,747,053 - 123,791,955 (-) NCBI panpan1.1 PanPan1.1 panPan2
TMEM65 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 13 22,426,487 - 22,494,520 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 13 22,426,793 - 22,494,520 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 13 22,392,169 - 22,459,957 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 13 22,749,249 - 22,836,557 (-) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 13 22,475,985 - 22,556,509 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 13 22,579,557 - 22,666,788 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 13 22,822,017 - 22,909,339 (-) NCBI UU_Cfam_GSD_1.0
Tmem65 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405303 15,821,641 - 15,855,329 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936470 23,261,738 - 23,277,560 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936470 23,247,722 - 23,284,894 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
TMEM65 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 15,263,745 - 15,352,225 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 15,263,400 - 15,317,350 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 15,896,004 - 15,938,113 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TMEM65
Tmem65
.
Predicted Target Of
Count of predictions: 226 Count of miRNA genes: 146 Interacting mature miRNAs: 183 Transcripts: ENSRNOT00000064122 Prediction methods: Miranda, Targetscan Result types: miRGate_prediction
1300179 Kidm5 Kidney mass QTL 5 3.51 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 43747012 135012528 Rat 2293667 Bss42 Bone structure and strength QTL 42 7.25 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 7 47651439 92651439 Rat 1331728 Bp214 Blood pressure QTL 214 2.825 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 80221299 124373579 Rat 2317035 Aia16 Adjuvant induced arthritis QTL 16 2.71 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 7 59238038 104238038 Rat 2298475 Eau6 Experimental allergic uveoretinitis QTL 6 0.0029 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 7 84257275 129257275 Rat 71114 Niddm14 Non-insulin dependent diabetes mellitus QTL 14 4.5 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 7 84257275 129257275 Rat 2293678 Bss24 Bone structure and strength QTL 24 6.71 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 7 47651439 92651439 Rat 1358361 Sradr5 Stress Responsive Adrenal Weight QTL 5 5.55 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 7 43747012 108555253 Rat 1357338 Stl17 Serum triglyceride level QTL 17 3.23 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 7 69736356 112729554 Rat 634331 Pia17 Pristane induced arthritis QTL 17 4.7 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 7 73829340 130221005 Rat 10450828 Scl79 Serum cholesterol level QTL 79 3.5 0.001 blood HDL cholesterol amount (VT:0000184) blood low density lipoprotein cholesterol level (CMO:0000053) 7 89867376 101773158 Rat 1358914 Bp266 Blood pressure QTL 266 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat 2293685 Bmd21 Bone mineral density QTL 21 4.2 0.0003 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 7 47651439 92651439 Rat 631504 Cm27 Cardiac mass QTL 27 3.45 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 7 44421311 118198041 Rat 634322 Bw12 Body weight QTL 12 0 body mass (VT:0001259) body weight (CMO:0000012) 7 83153392 128153392 Rat 70173 Niddm19 Non-insulin dependent diabetes mellitus QTL 19 4.33 0.00005 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 7 64002457 135012528 Rat 2317052 Aia17 Adjuvant induced arthritis QTL 17 2.13 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 7 81737938 126737938 Rat 631529 Tls2 T-lymphoma susceptibility QTL 2 0 0.001 thymus integrity trait (VT:0010555) percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911) 7 80221299 109401111 Rat 2293696 Bmd32 Bone mineral density QTL 32 5.1 0.0001 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 7 47651439 92651439 Rat 1300151 Bp181 Blood pressure QTL 181 3.36 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 7 53612714 103945643 Rat 1559283 Emca4 Estrogen-induced mammary cancer QTL 4 3.7 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 7 62004452 101773158 Rat 1643004 Pain2 Pain QTL 2 1 mechanical nociception trait (VT:0002734) self mutilation severity score (CMO:0002145) 7 9462246 98011544 Rat 738030 Anxrr8 Anxiety related response QTL 8 4.1 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 46590070 91590070 Rat 1300149 Cm6 Cardiac mass QTL 6 4.09 heart mass (VT:0007028) heart left ventricle weight to body weight ratio (CMO:0000530) 7 43747099 102228765 Rat 7411607 Foco15 Food consumption QTL 15 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 75918751 120918751 Rat 1558655 Swd4 Spike wave discharge measurement QTL 4 3.68 0.0002 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge severity grade (CMO:0001988) 7 86983365 131983365 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 2293707 Bss32 Bone structure and strength QTL 32 7.64 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 7 47651439 92651439 Rat 1331768 Kidm10 Kidney mass QTL 10 4.62096 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 80221299 125221299 Rat 61357 Bp38 Blood pressure QTL 38 1.6 0.052 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 41333674 119109060 Rat 1641908 Teswt1 Testicular weight QTL 1 3.28 testis mass (VT:1000644) both testes wet weight (CMO:0000175) 7 80221299 94811326 Rat 2293644 Bmd29 Bone mineral density QTL 29 5.4 0.0001 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 7 47651439 92651439 Rat 2316947 Rf58 Renal function QTL 58 7.8 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 7 68938720 113886318 Rat 2300178 Bmd54 Bone mineral density QTL 54 5.3 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 7 47651439 92651439 Rat 724537 Niddm52 Non-insulin dependent diabetes mellitus QTL 52 0.02 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 7 80221299 93595843 Rat 1298528 Bp169 Blood pressure QTL 169 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 61074194 106074194 Rat 1331746 Kidm9 Kidney mass QTL 9 3.934 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 7 80221299 112308525 Rat 1576303 Ept7 Estrogen-induced pituitary tumorigenesis QTL 7 3.7 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 7 62004452 101773158 Rat 7411654 Foco25 Food consumption QTL 25 9.3 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 75918751 120918751 Rat 2316955 Stl24 Serum triglyceride level QTL 24 7.1 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 7 68938720 113886318 Rat 2316952 Pur22 Proteinuria QTL 22 5.2 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 7 68938720 113886318 Rat 631540 Bw9 Body weight QTL 9 4.5 body mass (VT:0001259) body weight (CMO:0000012) 7 69736226 117455174 Rat 1358891 Bp265 Blood pressure QTL 265 2.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat
RH137464
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 90,337,872 - 90,338,072 (+) MAPPER mRatBN7.2 Rnor_6.0 7 98,668,833 - 98,669,032 NCBI Rnor6.0 Rnor_5.0 7 99,270,580 - 99,270,779 UniSTS Rnor5.0 RGSC_v3.4 7 95,545,673 - 95,545,872 UniSTS RGSC3.4 Celera 7 87,103,175 - 87,103,374 UniSTS Cytogenetic Map 7 q33 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000064122 ⟹ ENSRNOP00000063472
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 7 98,670,455 - 98,709,344 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000077440 ⟹ ENSRNOP00000074649
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 90,274,142 - 90,378,733 (-) Ensembl Rnor_6.0 Ensembl 7 98,605,722 - 98,709,649 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000107015 ⟹ ENSRNOP00000093575
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 90,337,433 - 90,379,474 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000113387 ⟹ ENSRNOP00000097891
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 90,337,433 - 90,379,474 (-) Ensembl
RefSeq Acc Id:
NM_001100995 ⟹ NP_001094465
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 92,227,113 - 92,268,178 (-) NCBI mRatBN7.2 7 90,337,629 - 90,378,697 (-) NCBI Rnor_6.0 7 98,668,589 - 98,709,613 (-) NCBI Rnor_5.0 7 99,270,336 - 99,310,327 (-) NCBI RGSC_v3.4 7 95,545,429 - 95,587,199 (-) RGD Celera 7 87,102,931 - 87,143,627 (-) RGD
Sequence:
CGCCCGCCGGTACCGCCCGCCCGCTCTGAGCTCCCGGCCCGGCCGCGGCACAGAAAGTTTTCCTGGGCTCACGGCCTGCGGGAAGCGGAGCGGGCACGGCTGAGAGGCGGTCGCTGCGCGGGCCCGCA
hide sequence
RefSeq Acc Id:
XM_039079755 ⟹ XP_038935683
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 92,226,483 - 92,268,430 (-) NCBI mRatBN7.2 7 90,336,997 - 90,378,910 (-) NCBI
RefSeq Acc Id:
XM_063264121 ⟹ XP_063120191
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 92,163,632 - 92,268,408 (-) NCBI
RefSeq Acc Id:
XM_063264122 ⟹ XP_063120192
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 92,226,483 - 92,241,324 (-) NCBI
RefSeq Acc Id:
XM_063264123 ⟹ XP_063120193
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 92,163,632 - 92,268,401 (-) NCBI
RefSeq Acc Id:
XR_005486706
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 92,234,349 - 92,268,409 (-) NCBI mRatBN7.2 7 90,344,875 - 90,378,930 (-) NCBI
RefSeq Acc Id:
XR_005486707
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 92,234,349 - 92,268,402 (-) NCBI mRatBN7.2 7 90,344,877 - 90,378,928 (-) NCBI
RefSeq Acc Id:
NP_001094465 ⟸ NM_001100995
- UniProtKB:
A1L1L9 (UniProtKB/TrEMBL), A6HRK7 (UniProtKB/TrEMBL)
- Sequence:
MSRLLPLLGSRTARSLRPGPVAAHRPPSWCSCGRGLLALGVPSGPRLLGTHPKKEPMEALNTAQGARDFIYSLHSTERSCLLKELHRFESIAIAQACRFPKPEMVLAKRAKEVSAAETPDSFEKLEAL
hide sequence
Ensembl Acc Id:
ENSRNOP00000074649 ⟸ ENSRNOT00000077440
Ensembl Acc Id:
ENSRNOP00000063472 ⟸ ENSRNOT00000064122
RefSeq Acc Id:
XP_038935683 ⟸ XM_039079755
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6AVM0 (UniProtKB/TrEMBL), A6HRK7 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000097891 ⟸ ENSRNOT00000113387
Ensembl Acc Id:
ENSRNOP00000093575 ⟸ ENSRNOT00000107015
RefSeq Acc Id:
XP_063120191 ⟸ XM_063264121
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_063120193 ⟸ XM_063264123
- Peptide Label:
isoform X4
- UniProtKB:
B1WBL4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063120192 ⟸ XM_063264122
- Peptide Label:
isoform X3
RGD ID: 13695357 Promoter ID: EPDNEW_R5875 Type: initiation region Name: Tmem65_1 Description: transmembrane protein 65 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 98,709,661 - 98,709,721 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2012-10-12
Tmem65
transmembrane protein 65
RGD1563224
similar to 4930438D12Rik protein
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
RGD1563224
similar to 4930438D12Rik protein
RGD1563224_predicted
similar to 4930438D12Rik protein (predicted)
'predicted' is removed
2292626 APPROVED
2006-03-07
RGD1563224_predicted
similar to 4930438D12Rik protein (predicted)
LOC500874
similar to 4930438D12Rik protein
Symbol and Name status set to approved
1299863 APPROVED
2006-02-09
LOC500874
similar to 4930438D12Rik protein
Symbol and Name status set to provisional
70820 PROVISIONAL
