Symbol:
EZR
Name:
ezrin
RGD ID:
1350208
HGNC Page
HGNC:12691
Description:
Enables several functions, including ATPase binding activity; cytoskeletal protein binding activity; and protein kinase A binding activity. Involved in several processes, including cytoskeleton organization; negative regulation of signal transduction; and regulation of macromolecule metabolic process. Located in several cellular components, including fibrillar center; focal adhesion; and immunological synapse. Part of protein-containing complex.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
CVIL; CVL; cytovillin 2; DKFZp762H157; epididymis secretory protein Li 105; FLJ26216; HEL-S-105; MGC1584; p81; VIL2; villin 2 (ezrin); villin-2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Ezr (ezrin) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Ezr (ezrin) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Chinchilla lanigera (long-tailed chinchilla):
Ezr (ezrin) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
EZR (ezrin) NCBI
Ortholog
Canis lupus familiaris (dog):
EZR (ezrin) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ezr (ezrin) NCBI
Ortholog
Sus scrofa (pig):
EZR (ezrin) HGNC
Ensembl, NCBI, OrthoDB, Panther, Treefam
Chlorocebus sabaeus (green monkey):
EZR (ezrin) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Ezr (ezrin) NCBI
Ortholog
Other homologs 2
Mus musculus (house mouse):
Msn (moesin) HGNC
OrthoMCL
Mus musculus (house mouse):
Rdx (radixin) HGNC
OrthoMCL
Rattus norvegicus (Norway rat):
Hspa2 (heat shock protein family A (Hsp70) member 2) HGNC
OMA
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Ezr (ezrin)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Ezr (ezrin)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ezra (ezrin a)
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB|ZFIN)
Danio rerio (zebrafish):
ezrb (ezrin b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Drosophila melanogaster (fruit fly):
Moe
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
erm-1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
ezr
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Xenopus laevis (African clawed frog):
ezr.L
Alliance
DIOPT (Xenbase)
Related Pseudogenes:
EZRP1
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 158,765,748 - 158,819,368 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 158,765,741 - 158,819,368 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 159,186,780 - 159,240,400 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 159,106,764 - 159,159,247 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 159,157,186 - 159,209,668 NCBI Celera 6 159,834,789 - 159,888,323 (-) NCBI Celera Cytogenetic Map 6 q25.3 NCBI HuRef 6 156,657,307 - 156,711,123 (-) NCBI HuRef CHM1_1 6 159,449,491 - 159,503,058 (-) NCBI CHM1_1 T2T-CHM13v2.0 6 160,010,984 - 160,064,812 (-) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
EZR Human (+)-pilocarpine increases expression ISO RGD:621161 6480464 Pilocarpine results in increased expression of EZR protein CTD PMID:17366478 EZR Human (S)-amphetamine multiple interactions ISO RGD:732447 6480464 SOD1 inhibits the reaction [Dextroamphetamine results in increased expression of EZR mRNA] CTD PMID:12205029 EZR Human (S)-amphetamine increases expression ISO RGD:732447 6480464 Dextroamphetamine results in increased expression of EZR mRNA CTD PMID:12205029 EZR Human (S)-nicotine increases expression EXP 6480464 Nicotine results in increased expression of EZR mRNA CTD PMID:18247414 EZR Human (S)-nicotine multiple interactions ISO RGD:732447 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1,2,3,6-tetrahydropyridine] results in decreased expression of EZR mRNA; Nicotine inhibits the reaction more ... CTD PMID:20230807 EZR Human 1,2-dichloroethane decreases expression ISO RGD:732447 6480464 ethylene dichloride results in decreased expression of EZR mRNA CTD PMID:28960355 EZR Human 1,2-dimethylhydrazine multiple interactions ISO RGD:732447 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of EZR mRNA CTD PMID:22206623 EZR Human 1,2-dimethylhydrazine decreases expression ISO RGD:732447 6480464 1,2-Dimethylhydrazine results in decreased expression of EZR mRNA CTD PMID:22206623 EZR Human 1,8-cineole multiple interactions ISO RGD:732447 6480464 Eucalyptol inhibits the reaction [Glucose results in decreased expression of EZR protein]; Eucalyptol inhibits the more ... CTD PMID:31483951 EZR Human 1-chloro-2,4-dinitrobenzene affects binding EXP 6480464 Dinitrochlorobenzene binds to EZR protein CTD PMID:32991956 EZR Human 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine multiple interactions ISO RGD:732447 6480464 [Caffeine co-treated with 1-Methyl-4-phenyl-1,2,3,6-tetrahydropyridine] results in increased expression of EZR mRNA; [Nicotine co-treated with 1-Methyl-4-phenyl-1,2,3,6-tetrahydropyridine] more ... CTD PMID:20230807 EZR Human 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine decreases expression ISO RGD:732447 6480464 1-Methyl-4-phenyl-1,2,3,6-tetrahydropyridine results in decreased expression of EZR mRNA CTD PMID:20230807 EZR Human 1-naphthyl isothiocyanate increases expression ISO RGD:621161 6480464 1-Naphthylisothiocyanate results in increased expression of EZR mRNA CTD PMID:25380136 EZR Human 17alpha-ethynylestradiol affects expression ISO RGD:732447 6480464 Ethinyl Estradiol affects the expression of EZR mRNA CTD PMID:17555576 EZR Human 17alpha-ethynylestradiol decreases expression ISO RGD:621161 6480464 Ethinyl Estradiol results in decreased expression of EZR mRNA CTD PMID:29097150 EZR Human 17alpha-ethynylestradiol increases expression ISO RGD:621161 6480464 Ethinyl Estradiol results in increased expression of EZR mRNA CTD PMID:17108234|PMID:17557909 EZR Human 17beta-estradiol increases expression ISO RGD:732447 6480464 Estradiol results in increased expression of EZR mRNA CTD PMID:15289156|PMID:39298647 EZR Human 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of EZR mRNA; Estradiol results in increased expression of EZR more ... CTD PMID:15737688|PMID:19167446 EZR Human 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one multiple interactions EXP 6480464 bicalutamide inhibits the reaction [Metribolone results in increased expression of EZR mRNA]; bicalutamide inhibits the more ... CTD PMID:16873375 EZR Human 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one increases phosphorylation EXP 6480464 Metribolone results in increased phosphorylation of EZR protein CTD PMID:16873375 EZR Human 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one increases expression EXP 6480464 Metribolone results in increased expression of EZR mRNA CTD PMID:16873375 EZR Human 17beta-hydroxy-5alpha-androstan-3-one increases expression EXP 6480464 Dihydrotestosterone results in increased expression of EZR mRNA CTD PMID:29581250 EZR Human 2,2',4,4'-Tetrabromodiphenyl ether multiple interactions ISO RGD:732447 6480464 [Flame Retardants results in increased abundance of 2,2',4,4'-tetrabromodiphenyl ether] which results in increased expression of more ... CTD PMID:38995820 EZR Human 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:621161 6480464 Tetrachlorodibenzodioxin results in increased expression of EZR mRNA CTD PMID:21215274 EZR Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:621161 6480464 Tetrachlorodibenzodioxin affects the expression of EZR mRNA CTD PMID:34747641 EZR Human 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:732447 6480464 Tetrachlorodibenzodioxin results in decreased expression of EZR mRNA CTD PMID:33956508 EZR Human 2,4-dibromophenyl 2,4,5-tribromophenyl ether decreases expression ISO RGD:621161 6480464 2,2',4,4',5-brominated diphenyl ether results in decreased expression of EZR protein CTD PMID:19954255 EZR Human 2,4-dibromophenyl 2,4,5-tribromophenyl ether decreases expression ISO RGD:732447 6480464 2,2',4,4',5-brominated diphenyl ether results in decreased expression of EZR protein CTD PMID:18550172 EZR Human 2-naphthylamine increases expression EXP 6480464 2-Naphthylamine results in increased expression of EZR mRNA CTD PMID:18247414 EZR Human 3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine decreases expression ISO RGD:621161 6480464 Puromycin Aminonucleoside results in decreased expression of EZR protein CTD PMID:19264907 EZR Human 4,4'-diaminodiphenylmethane increases expression ISO RGD:621161 6480464 4,4'-diaminodiphenylmethane results in increased expression of EZR mRNA CTD PMID:25380136 EZR Human 4-hydroxynon-2-enal decreases expression EXP 6480464 4-hydroxy-2-nonenal results in decreased expression of EZR mRNA CTD PMID:12419474 EZR Human 4-hydroxyphenyl retinamide increases expression ISO RGD:732447 6480464 Fenretinide results in increased expression of EZR mRNA CTD PMID:28973697 EZR Human 6-propyl-2-thiouracil affects expression ISO RGD:621161 6480464 Propylthiouracil affects the expression of EZR mRNA CTD PMID:24780913 EZR Human 6-propyl-2-thiouracil decreases expression ISO RGD:621161 6480464 Propylthiouracil results in decreased expression of EZR mRNA CTD PMID:36843608 EZR Human 7,12-dimethyltetraphene multiple interactions ISO RGD:621161 6480464 [9,10-Dimethyl-1,2-benzanthracene co-treated with Isoflavones] results in increased expression of EZR protein CTD PMID:22248470 EZR Human 7,12-dimethyltetraphene increases expression ISO RGD:621161 6480464 9,10-Dimethyl-1,2-benzanthracene results in increased expression of EZR mRNA; 9,10-Dimethyl-1,2-benzanthracene results in increased expression of EZR more ... CTD PMID:12376462|PMID:22248470 EZR Human acetamide increases expression ISO RGD:621161 6480464 acetamide results in increased expression of EZR mRNA CTD PMID:31881176 EZR Human acetylsalicylic acid decreases expression EXP 6480464 Aspirin results in decreased expression of EZR mRNA CTD PMID:14976132 EZR Human acrolein multiple interactions EXP 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ... CTD PMID:32699268 EZR Human aflatoxin B1 increases expression ISO RGD:621161 6480464 Aflatoxin B1 results in increased expression of EZR mRNA CTD PMID:23630614|PMID:25378103 EZR Human aldehydo-D-glucose decreases expression ISO RGD:732447 6480464 Glucose results in decreased expression of EZR protein CTD PMID:31483951 EZR Human aldehydo-D-glucose multiple interactions ISO RGD:732447 6480464 Eucalyptol inhibits the reaction [Glucose results in decreased expression of EZR protein] CTD PMID:31483951 EZR Human all-trans-retinoic acid increases expression ISO RGD:732447 6480464 Tretinoin results in increased expression of EZR mRNA CTD PMID:16236135|PMID:16604517 EZR Human all-trans-retinoic acid decreases expression EXP 6480464 Tretinoin results in decreased expression of EZR mRNA CTD PMID:23724009|PMID:33167477 EZR Human alpha-pinene multiple interactions EXP 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ... CTD PMID:32699268 EZR Human alpha-Zearalanol multiple interactions ISO RGD:621161 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of EZR mRNA CTD PMID:35163327 EZR Human ammonium chloride affects expression ISO RGD:621161 6480464 Ammonium Chloride affects the expression of EZR mRNA CTD PMID:16483693 EZR Human ammonium chloride decreases expression ISO RGD:621161 6480464 Ammonium Chloride results in decreased expression of EZR protein CTD PMID:16483693 EZR Human ampicillin multiple interactions ISO RGD:621161 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in more ... CTD PMID:30545405 EZR Human aniline increases nitrosation ISO RGD:621161 6480464 aniline results in increased nitrosation of EZR protein CTD PMID:21708182 EZR Human antirheumatic drug decreases expression EXP 6480464 Antirheumatic Agents results in decreased expression of EZR mRNA CTD PMID:24449571 EZR Human aristolochic acid A increases expression EXP 6480464 aristolochic acid I results in increased expression of EZR mRNA; aristolochic acid I results in more ... CTD PMID:33212167 EZR Human arsane affects methylation EXP 6480464 Arsenic affects the methylation of EZR gene CTD PMID:25304211 EZR Human arsenic atom affects methylation EXP 6480464 Arsenic affects the methylation of EZR gene CTD PMID:25304211 EZR Human arsenite(3-) decreases expression ISO RGD:732447 6480464 arsenite results in decreased expression of EZR protein CTD PMID:37955338 EZR Human arsenous acid increases expression EXP 6480464 Arsenic Trioxide results in increased expression of EZR mRNA; Arsenic Trioxide results in increased expression more ... CTD PMID:22521957|PMID:25419056 EZR Human atropine multiple interactions EXP 6480464 Atropine inhibits the reaction [Parathion results in increased expression of EZR protein] CTD PMID:17390078 EZR Human benzalkonium chloride increases expression EXP 6480464 Benzalkonium Compounds results in increased expression of EZR mRNA; Benzalkonium Compounds results in increased expression more ... CTD PMID:29893927 EZR Human benzatropine decreases expression EXP 6480464 Benztropine results in decreased expression of EZR protein CTD PMID:34122009 EZR Human benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of EZR mRNA CTD PMID:18247414 EZR Human benzo[a]pyrene affects methylation EXP 6480464 Benzo(a)pyrene affects the methylation of EZR promoter CTD PMID:27901495 EZR Human benzo[a]pyrene multiple interactions ISO RGD:732447 6480464 Benzo(a)pyrene promotes the reaction [AHR protein binds to EZR promoter] CTD PMID:19654925 EZR Human benzo[a]pyrene diol epoxide I decreases expression EXP 6480464 7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in decreased expression of EZR mRNA CTD PMID:19150397 EZR Human beta-naphthoflavone multiple interactions ISO RGD:621161 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of EZR mRNA CTD PMID:18164116 EZR Human bicalutamide multiple interactions EXP 6480464 bicalutamide inhibits the reaction [Metribolone results in increased expression of EZR mRNA]; bicalutamide inhibits the more ... CTD PMID:16873375 EZR Human bis(2-chloroethyl) sulfide decreases expression EXP 6480464 Mustard Gas results in decreased expression of EZR mRNA CTD PMID:33491125 EZR Human bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of EZR mRNA CTD PMID:31163220 EZR Human bisphenol A multiple interactions ISO RGD:621161 6480464 [Fructose co-treated with bisphenol A] results in increased expression of EZR protein CTD PMID:26930160 EZR Human bisphenol A increases expression ISO RGD:732447 6480464 bisphenol A results in increased expression of EZR mRNA CTD PMID:32156529 EZR Human bisphenol A affects methylation EXP 6480464 bisphenol A affects the methylation of EZR gene CTD PMID:31601247 EZR Human bisphenol A decreases expression ISO RGD:732447 6480464 bisphenol A results in decreased expression of EZR mRNA CTD PMID:33221593 EZR Human bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of EZR protein CTD PMID:37567409 EZR Human bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of EZR mRNA; bisphenol A results in decreased expression more ... CTD PMID:29275510|PMID:33024228|PMID:34186270|PMID:37664457 EZR Human bisphenol A decreases expression ISO RGD:621161 6480464 bisphenol A results in decreased expression of EZR mRNA CTD PMID:29097150|PMID:32145629 EZR Human bisphenol A increases methylation ISO RGD:621161 6480464 bisphenol A results in increased methylation of EZR gene CTD PMID:28505145 EZR Human bisphenol A affects methylation ISO RGD:732447 6480464 bisphenol A affects the methylation of EZR promoter CTD PMID:27334623 EZR Human bisphenol A affects expression ISO RGD:621161 6480464 bisphenol A affects the expression of EZR mRNA CTD PMID:25181051 EZR Human bisphenol AF increases expression EXP 6480464 bisphenol AF results in increased expression of EZR protein CTD PMID:34186270 EZR Human bleomycin A2 decreases expression ISO RGD:621161 6480464 Bleomycin results in decreased expression of EZR protein CTD PMID:25933445 EZR Human cadmium atom increases expression EXP 6480464 Cadmium results in increased expression of EZR mRNA CTD PMID:24376830 EZR Human caffeine multiple interactions ISO RGD:732447 6480464 [Caffeine co-treated with 1-Methyl-4-phenyl-1,2,3,6-tetrahydropyridine] results in increased expression of EZR mRNA; Caffeine inhibits the reaction more ... CTD PMID:20230807 EZR Human caffeine affects phosphorylation EXP 6480464 Caffeine affects the phosphorylation of EZR protein CTD PMID:35688186 EZR Human cannabidiol affects methylation ISO RGD:621161 6480464 Cannabidiol affects the methylation of EZR gene CTD PMID:30521419 EZR Human cannabidiol decreases expression EXP 6480464 Cannabidiol results in decreased expression of EZR protein CTD PMID:34122009 EZR Human carbon monoxide multiple interactions EXP 6480464 [[Vehicle Emissions results in increased abundance of Air Pollutants] which results in increased abundance of more ... CTD PMID:37141245 EZR Human carbon nanotube affects expression EXP 6480464 Nanotubes, Carbon affects the expression of EZR protein CTD PMID:22001959 EZR Human CGP 52608 multiple interactions EXP 6480464 CGP 52608 promotes the reaction [RORA protein binds to EZR gene] CTD PMID:28238834 EZR Human chloropicrin decreases expression EXP 6480464 chloropicrin results in decreased expression of EZR mRNA CTD PMID:26352163 EZR Human choline multiple interactions ISO RGD:732447 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ... CTD PMID:20938992 EZR Human chromium(6+) multiple interactions EXP 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in decreased expression more ... CTD PMID:38479592 EZR Human cisplatin increases expression ISO RGD:732447 6480464 Cisplatin results in increased expression of EZR mRNA CTD PMID:21151649 EZR Human cisplatin multiple interactions EXP 6480464 [Cisplatin results in decreased susceptibility to Cisplatin] which results in increased expression of EZR mRNA CTD PMID:30871063 EZR Human clofibric acid multiple interactions ISO RGD:621161 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of EZR mRNA CTD PMID:17602206 EZR Human clozapine decreases expression EXP 6480464 Clozapine results in decreased expression of EZR protein CTD PMID:34122009 EZR Human cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of EZR mRNA CTD PMID:17553155|PMID:19376846 EZR Human cocaine decreases expression EXP 6480464 Cocaine results in decreased expression of EZR mRNA CTD PMID:20948987 EZR Human copper atom decreases expression ISO RGD:621161 6480464 Copper results in decreased expression of EZR mRNA CTD PMID:30556269 EZR Human copper(0) decreases expression ISO RGD:621161 6480464 Copper results in decreased expression of EZR mRNA CTD PMID:30556269 EZR Human copper(II) sulfate increases expression EXP 6480464 Copper Sulfate results in increased expression of EZR mRNA CTD PMID:19549813 EZR Human coumestrol multiple interactions EXP 6480464 [Coumestrol co-treated with 2,3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of EZR mRNA CTD PMID:19167446 EZR Human CU-O LINKAGE decreases expression EXP 6480464 cupric oxide results in decreased expression of EZR protein CTD PMID:25470785 EZR Human Cuprizon increases expression ISO RGD:621161 6480464 Cuprizone results in increased expression of EZR mRNA CTD PMID:26577399 EZR Human cyclohexanols increases expression EXP 6480464 Cyclohexanols results in increased expression of EZR mRNA CTD PMID:29893927 EZR Human cyclosporin A increases expression EXP 6480464 Cyclosporine results in increased expression of EZR mRNA CTD PMID:25562108 EZR Human cytarabine decreases expression EXP 6480464 Cytarabine results in decreased expression of EZR mRNA CTD PMID:21198554 EZR Human D-glucose decreases expression ISO RGD:732447 6480464 Glucose results in decreased expression of EZR protein CTD PMID:31483951 EZR Human D-glucose multiple interactions ISO RGD:732447 6480464 Eucalyptol inhibits the reaction [Glucose results in decreased expression of EZR protein] CTD PMID:31483951 EZR Human diarsenic trioxide increases expression EXP 6480464 Arsenic Trioxide results in increased expression of EZR mRNA; Arsenic Trioxide results in increased expression more ... CTD PMID:22521957|PMID:25419056 EZR Human dibutyl phthalate affects expression ISO RGD:621161 6480464 Dibutyl Phthalate affects the expression of EZR mRNA CTD PMID:21745491 EZR Human diethylstilbestrol increases expression ISO RGD:732447 6480464 Diethylstilbestrol results in increased expression of EZR mRNA CTD PMID:15289156 EZR Human diethylstilbestrol decreases expression ISO RGD:621161 6480464 Diethylstilbestrol results in decreased expression of EZR mRNA CTD PMID:21658437|PMID:36653537 EZR Human diuron increases expression ISO RGD:621161 6480464 Diuron results in increased expression of EZR mRNA CTD PMID:21551480 EZR Human dorsomorphin multiple interactions EXP 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 EZR Human doxorubicin increases expression EXP 6480464 Doxorubicin results in increased expression of EZR mRNA CTD PMID:29803840 EZR Human elemental selenium decreases expression EXP 6480464 Selenium results in decreased expression of EZR mRNA CTD PMID:19244175 EZR Human elemental selenium multiple interactions EXP 6480464 [Selenium co-treated with Vitamin E] results in decreased expression of EZR mRNA CTD PMID:19244175 EZR Human Enterolactone multiple interactions EXP 6480464 [Coumestrol co-treated with 2,3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of EZR mRNA CTD PMID:19167446 EZR Human entinostat increases expression EXP 6480464 entinostat results in increased expression of EZR mRNA CTD PMID:26272509 EZR Human entinostat multiple interactions EXP 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 EZR Human enzyme inhibitor multiple interactions EXP 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation more ... CTD PMID:23301498 EZR Human ethanol increases expression EXP 6480464 Ethanol results in increased expression of EZR mRNA CTD PMID:29893927 EZR Human ethanol affects splicing ISO RGD:732447 6480464 Ethanol affects the splicing of EZR mRNA CTD PMID:30319688 EZR Human ethanol increases expression ISO RGD:732447 6480464 Ethanol results in increased expression of EZR mRNA CTD PMID:30319688 EZR Human ethanol affects expression ISO RGD:732447 6480464 Ethanol affects the expression of EZR mRNA CTD PMID:30319688 EZR Human fipronil decreases expression ISO RGD:621161 6480464 fipronil results in decreased expression of EZR mRNA CTD PMID:34044035 EZR Human flavonoids decreases expression ISO RGD:621161 6480464 Flavonoids results in decreased expression of EZR mRNA CTD PMID:18035473 EZR Human folic acid multiple interactions ISO RGD:732447 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of EZR mRNA; [Methionine deficiency co-treated more ... CTD PMID:20938992|PMID:22206623 EZR Human fructose multiple interactions ISO RGD:621161 6480464 [Fructose co-treated with bisphenol A] results in increased expression of EZR protein CTD PMID:26930160 EZR Human furan increases expression ISO RGD:621161 6480464 furan results in increased expression of EZR mRNA CTD PMID:25539665|PMID:26194646 EZR Human genistein increases expression ISO RGD:732447 6480464 Genistein results in increased expression of EZR mRNA CTD PMID:15289156 EZR Human gentamycin increases expression ISO RGD:621161 6480464 Gentamicins results in increased expression of EZR mRNA; Gentamicins results in increased expression of EZR more ... CTD PMID:22061828 EZR Human gentamycin multiple interactions ISO RGD:621161 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in more ... CTD PMID:30545405 EZR Human glucose multiple interactions ISO RGD:732447 6480464 Eucalyptol inhibits the reaction [Glucose results in decreased expression of EZR protein] CTD PMID:31483951 EZR Human glucose decreases expression ISO RGD:732447 6480464 Glucose results in decreased expression of EZR protein CTD PMID:31483951 EZR Human GSK-J4 decreases expression EXP 6480464 GSK-J4 results in decreased expression of EZR mRNA CTD PMID:29301935 EZR Human haloperidol decreases expression EXP 6480464 Haloperidol results in decreased expression of EZR protein CTD PMID:34122009 EZR Human hyaluronic acid multiple interactions ISO RGD:621161 6480464 Hyaluronic Acid analog inhibits the reaction [Hydrogen Peroxide results in decreased expression of EZR protein] CTD PMID:23178681 EZR Human hydrogen peroxide affects expression EXP 6480464 Hydrogen Peroxide affects the expression of EZR mRNA CTD PMID:20044591 EZR Human hydrogen peroxide multiple interactions ISO RGD:621161 6480464 Hyaluronic Acid analog inhibits the reaction [Hydrogen Peroxide results in decreased expression of EZR protein] CTD PMID:23178681 EZR Human hydrogen peroxide decreases expression ISO RGD:621161 6480464 Hydrogen Peroxide results in decreased expression of EZR protein CTD PMID:23178681 EZR Human inulin multiple interactions ISO RGD:732447 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of EZR mRNA CTD PMID:36331819 EZR Human isobutanol multiple interactions EXP 6480464 [[Gasoline co-treated with isobutyl alcohol] results in increased abundance of [Particulate Matter co-treated with Polycyclic more ... CTD PMID:29432896 EZR Human isoflavones multiple interactions ISO RGD:621161 6480464 [9,10-Dimethyl-1,2-benzanthracene co-treated with Isoflavones] results in increased expression of EZR protein; [ENNG co-treated with Isoflavones] more ... CTD PMID:22248470 EZR Human ivermectin decreases expression EXP 6480464 Ivermectin results in decreased expression of EZR protein CTD PMID:32959892 EZR Human L-methionine multiple interactions ISO RGD:732447 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ... CTD PMID:20938992 EZR Human lead nitrate multiple interactions ISO RGD:732447 6480464 lead nitrate affects the reaction [EZR affects the expression of MT1 mRNA]; lead nitrate affects more ... CTD PMID:11891201 EZR Human lead(0) decreases expression EXP 6480464 Lead results in decreased expression of EZR mRNA CTD PMID:19921347 EZR Human leflunomide decreases expression EXP 6480464 leflunomide results in decreased expression of EZR mRNA CTD PMID:28988120 EZR Human lipopolysaccharide increases expression ISO RGD:732447 6480464 Lipopolysaccharides results in increased expression of EZR mRNA CTD PMID:27339419 EZR Human lithium atom increases expression ISO RGD:621161 6480464 Lithium results in increased expression of EZR mRNA; Lithium results in increased expression of EZR more ... CTD PMID:15687245|PMID:18296634 EZR Human lithium hydride increases expression ISO RGD:621161 6480464 Lithium results in increased expression of EZR mRNA; Lithium results in increased expression of EZR more ... CTD PMID:15687245|PMID:18296634 EZR Human menadione affects expression EXP 6480464 Vitamin K 3 affects the expression of EZR mRNA CTD PMID:20044591 EZR Human methotrexate increases expression EXP 6480464 Methotrexate results in increased expression of EZR mRNA CTD PMID:21678067 EZR Human methylmercury chloride increases expression EXP 6480464 methylmercuric chloride results in increased expression of EZR mRNA CTD PMID:26272509 EZR Human metronidazole multiple interactions ISO RGD:621161 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in more ... CTD PMID:30545405 EZR Human microcystin-LR multiple interactions EXP 6480464 [IGBP1 protein results in increased susceptibility to cyanoginosin LR] which results in increased expression of more ... CTD PMID:24677693|PMID:29984889 EZR Human microcystin-LR increases expression ISO RGD:621161 6480464 cyanoginosin LR results in increased expression of EZR mRNA CTD PMID:23342045 EZR Human microcystin-LR increases phosphorylation EXP 6480464 cyanoginosin LR results in increased phosphorylation of EZR protein CTD PMID:24677693|PMID:27352821|PMID:27393157 EZR Human N-methyl-4-phenylpyridinium increases expression ISO RGD:732447 6480464 1-Methyl-4-phenylpyridinium results in increased expression of EZR protein CTD PMID:26558463 EZR Human N-methyl-N-nitrosourea increases expression ISO RGD:621161 6480464 Methylnitrosourea results in increased expression of EZR mRNA CTD PMID:17412507 EZR Human N-nitrosodiethylamine multiple interactions ISO RGD:621161 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of EZR mRNA; [Diethylnitrosamine co-treated with Clofibric more ... CTD PMID:17602206|PMID:18164116|PMID:28943392 EZR Human N-nitrosodiethylamine increases expression ISO RGD:621161 6480464 Diethylnitrosamine results in increased expression of EZR mRNA CTD PMID:19638242 EZR Human N-nitrosodimethylamine increases expression ISO RGD:621161 6480464 Dimethylnitrosamine results in increased expression of EZR mRNA CTD PMID:25380136 EZR Human N-nitrosomorpholine increases expression ISO RGD:621161 6480464 N-nitrosomorpholine results in increased expression of EZR mRNA CTD PMID:19716841 EZR Human naphthalene decreases expression ISO RGD:732447 6480464 naphthalene results in decreased expression of EZR protein CTD PMID:19438287 EZR Human naphthalene multiple interactions ISO RGD:732447 6480464 [naphthalene co-treated with CFTR gene mutant form] results in decreased expression of EZR protein CTD PMID:19438287 EZR Human neomycin multiple interactions ISO RGD:621161 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in more ... CTD PMID:30545405 EZR Human nicotine increases expression EXP 6480464 Nicotine results in increased expression of EZR mRNA CTD PMID:18247414 EZR Human nicotine multiple interactions ISO RGD:732447 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1,2,3,6-tetrahydropyridine] results in decreased expression of EZR mRNA; Nicotine inhibits the reaction more ... CTD PMID:20230807 EZR Human nitrates multiple interactions ISO RGD:732447 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of EZR more ... CTD PMID:35964746 EZR Human nitric oxide increases phosphorylation ISO RGD:621161 6480464 Nitric Oxide deficiency results in increased phosphorylation of EZR protein CTD PMID:14732730 EZR Human nitrogen dioxide multiple interactions EXP 6480464 [[Vehicle Emissions results in increased abundance of Air Pollutants] which results in increased abundance of more ... CTD PMID:37141245 EZR Human ochratoxin A increases expression EXP 6480464 ochratoxin A metabolite results in increased expression of EZR mRNA; ochratoxin A results in increased more ... CTD PMID:26314263 EZR Human ochratoxin A increases expression ISO RGD:621161 6480464 ochratoxin A results in increased expression of EZR protein CTD PMID:31369848 EZR Human ochratoxin A decreases expression EXP 6480464 ochratoxin A results in decreased expression of EZR mRNA CTD PMID:30763683 EZR Human ochratoxin A increases phosphorylation EXP 6480464 ochratoxin A results in increased phosphorylation of EZR protein CTD PMID:28286205 EZR Human okadaic acid increases expression EXP 6480464 Okadaic Acid results in increased expression of EZR mRNA; Okadaic Acid results in increased expression more ... CTD PMID:38832940 EZR Human ozone multiple interactions EXP 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ... CTD PMID:32699268 EZR Human panobinostat multiple interactions EXP 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 EZR Human panobinostat increases expression EXP 6480464 panobinostat results in increased expression of EZR mRNA CTD PMID:26272509 EZR Human paracetamol affects expression ISO RGD:732447 6480464 Acetaminophen affects the expression of EZR mRNA CTD PMID:17562736 EZR Human paracetamol decreases expression ISO RGD:621161 6480464 Acetaminophen results in decreased expression of EZR mRNA CTD PMID:33387578 EZR Human paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of EZR mRNA CTD PMID:25458485 EZR Human paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of EZR mRNA CTD PMID:22230336 EZR Human paraquat increases expression ISO RGD:621161 6480464 Paraquat results in increased expression of EZR mRNA CTD PMID:32680482 EZR Human parathion increases expression EXP 6480464 Parathion results in increased expression of EZR protein CTD PMID:17390078 EZR Human parathion multiple interactions EXP 6480464 Atropine inhibits the reaction [Parathion results in increased expression of EZR protein] CTD PMID:17390078 EZR Human PCB138 decreases expression ISO RGD:621161 6480464 2,2',3',4,4',5-hexachlorobiphenyl results in decreased expression of EZR protein CTD PMID:21673325 EZR Human pentachlorophenol increases expression ISO RGD:732447 6480464 Pentachlorophenol results in increased expression of EZR mRNA CTD PMID:23892564 EZR Human perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:732447 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of EZR mRNA CTD PMID:36331819 EZR Human perfluorooctanoic acid multiple interactions ISO RGD:621161 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of EZR mRNA CTD PMID:35163327 EZR Human phenobarbital affects expression EXP 6480464 Phenobarbital affects the expression of EZR mRNA CTD PMID:19159669 EZR Human phenylmercury acetate increases expression EXP 6480464 Phenylmercuric Acetate results in increased expression of EZR mRNA CTD PMID:26272509 EZR Human phenylmercury acetate multiple interactions EXP 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 EZR Human PhIP increases expression ISO RGD:621161 6480464 2-amino-1-methyl-6-phenylimidazo(4,5-b)pyridine results in increased expression of EZR mRNA CTD PMID:12376462 EZR Human Propiverine affects binding ISO RGD:621161 6480464 propiverine binds to EZR protein CTD PMID:29273565 EZR Human rotenone decreases expression ISO RGD:621161 6480464 Rotenone results in decreased expression of EZR mRNA CTD PMID:28374803 EZR Human SB 203580 multiple interactions EXP 6480464 SB 203580 inhibits the reaction [cyanoginosin LR results in increased phosphorylation of EZR protein] CTD PMID:24677693 EZR Human SB 431542 multiple interactions EXP 6480464 [LDN 193189 co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in decreased expression of EZR more ... CTD PMID:27188386|PMID:37664457 EZR Human selenium atom decreases expression EXP 6480464 Selenium results in decreased expression of EZR mRNA CTD PMID:19244175 EZR Human selenium atom multiple interactions EXP 6480464 [Selenium co-treated with Vitamin E] results in decreased expression of EZR mRNA CTD PMID:19244175 EZR Human silicon dioxide affects secretion EXP 6480464 Silicon Dioxide analog affects the secretion of EZR protein CTD PMID:25895662 EZR Human silicon dioxide increases expression EXP 6480464 Silicon Dioxide analog results in increased expression of EZR mRNA CTD PMID:25895662 EZR Human sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of EZR protein CTD PMID:21925251 EZR Human sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of EZR mRNA CTD PMID:38568856 EZR Human sodium arsenite decreases expression ISO RGD:621161 6480464 sodium arsenite results in decreased expression of EZR protein CTD PMID:29459688 EZR Human sodium arsenite increases expression ISO RGD:621161 6480464 sodium arsenite results in increased expression of EZR protein CTD PMID:19072884 EZR Human sodium dichromate increases expression ISO RGD:621161 6480464 sodium bichromate results in increased expression of EZR mRNA CTD PMID:25993096 EZR Human sodium dodecyl sulfate increases expression EXP 6480464 Sodium Dodecyl Sulfate results in increased expression of EZR mRNA; Sodium Dodecyl Sulfate results in more ... CTD PMID:29893927 EZR Human sodium fluoride increases expression ISO RGD:732447 6480464 Sodium Fluoride results in increased expression of EZR protein CTD PMID:27548804 EZR Human sodium hydroxide increases expression EXP 6480464 Sodium Hydroxide results in increased expression of EZR mRNA CTD PMID:29893927 EZR Human Soman increases expression ISO RGD:621161 6480464 Soman results in increased expression of EZR mRNA CTD PMID:19281266 EZR Human starch multiple interactions ISO RGD:621161 6480464 Starch analog inhibits the reaction [Rapeseed Oil metabolite results in decreased expression of EZR mRNA] CTD PMID:27363782 EZR Human T-2 toxin affects expression ISO RGD:621161 6480464 T-2 Toxin affects the expression of EZR protein CTD PMID:26141394 EZR Human temozolomide increases expression EXP 6480464 Temozolomide results in increased expression of EZR mRNA CTD PMID:31758290 EZR Human tert-butyl hydroperoxide decreases expression EXP 6480464 tert-Butylhydroperoxide results in decreased expression of EZR mRNA CTD PMID:12419474 EZR Human testosterone enanthate affects expression EXP 6480464 testosterone enanthate affects the expression of EZR mRNA CTD PMID:17440010 EZR Human tetrachloromethane affects expression ISO RGD:732447 6480464 Carbon Tetrachloride affects the expression of EZR mRNA CTD PMID:17484886 EZR Human tetrachloromethane increases expression ISO RGD:732447 6480464 Carbon Tetrachloride results in increased expression of EZR mRNA CTD PMID:27339419|PMID:31919559 EZR Human thioacetamide increases expression ISO RGD:621161 6480464 Thioacetamide results in increased expression of EZR mRNA CTD PMID:23411599|PMID:34492290 EZR Human thioacetamide multiple interactions ISO RGD:621161 6480464 [Diethylnitrosamine co-treated with Thioacetamide] results in increased expression of EZR mRNA CTD PMID:28943392 EZR Human thiram increases expression EXP 6480464 Thiram results in increased expression of EZR mRNA CTD PMID:38568856 EZR Human titanium dioxide decreases methylation ISO RGD:732447 6480464 titanium dioxide results in decreased methylation of EZR gene CTD PMID:35295148 EZR Human tributylstannane increases expression ISO RGD:732447 6480464 tributyltin results in increased expression of EZR mRNA CTD PMID:31939706 EZR Human Tributyltin oxide increases phosphorylation ISO RGD:732447 6480464 bis(tri-n-butyltin)oxide results in increased phosphorylation of EZR protein CTD PMID:22174045 EZR Human trichostatin A increases expression EXP 6480464 trichostatin A results in increased expression of EZR mRNA CTD PMID:24935251|PMID:26272509 EZR Human trichostatin A multiple interactions EXP 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 EZR Human triclosan increases expression EXP 6480464 Triclosan results in increased expression of EZR mRNA CTD PMID:30510588 EZR Human Triton X-100 increases expression EXP 6480464 Octoxynol results in increased expression of EZR mRNA CTD PMID:29893927 EZR Human tropan-3alpha-yl 3-hydroxy-2-phenylpropanoate multiple interactions EXP 6480464 Atropine inhibits the reaction [Parathion results in increased expression of EZR protein] CTD PMID:17390078 EZR Human tungsten decreases expression ISO RGD:732447 6480464 Tungsten results in decreased expression of EZR mRNA CTD PMID:30912803 EZR Human urethane increases expression EXP 6480464 Urethane results in increased expression of EZR mRNA CTD PMID:28818685 EZR Human valproic acid increases methylation EXP 6480464 Valproic Acid results in increased methylation of EZR gene CTD PMID:29154799 EZR Human valproic acid multiple interactions EXP 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 EZR Human valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of EZR mRNA CTD PMID:24383497|PMID:26272509|PMID:28001369 EZR Human valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of EZR mRNA CTD PMID:25979313 EZR Human vancomycin multiple interactions ISO RGD:621161 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in more ... CTD PMID:30545405 EZR Human vinclozolin affects expression ISO RGD:621161 6480464 vinclozolin affects the expression of EZR mRNA CTD PMID:19015723 EZR Human vinclozolin decreases methylation ISO RGD:621161 6480464 vinclozolin results in decreased methylation of EZR gene CTD PMID:31079544 EZR Human vitamin E decreases expression EXP 6480464 Vitamin E results in decreased expression of EZR mRNA CTD PMID:19244175 EZR Human vitamin E multiple interactions EXP 6480464 [Selenium co-treated with Vitamin E] results in decreased expression of EZR mRNA CTD PMID:19244175 EZR Human withaferin A multiple interactions EXP 6480464 [withanone co-treated with withaferin A] results in decreased expression of EZR protein CTD PMID:25236891 EZR Human Withanone multiple interactions EXP 6480464 [withanone co-treated with withaferin A] results in decreased expression of EZR protein CTD PMID:25236891 EZR Human Y-27632 increases phosphorylation ISO RGD:621161 6480464 Y 27632 deficiency results in increased phosphorylation of EZR protein CTD PMID:14732730 EZR Human zoledronic acid increases expression EXP 6480464 zoledronic acid results in increased expression of EZR mRNA CTD PMID:20977926
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
EZR Human actin binding enables IEA InterPro:IPR008954|InterPro:IPR011174 150520179 InterPro GO_REF:0000002 EZR Human actin binding enables IBA FB:FBgn0011661|PANTHER:PTN001150648|RGD:1359472|RGD:621260|UniProtKB:P15311|UniProtKB:P35241 150520179 GO_Central GO_REF:0000033 EZR Human actin binding enables IDA 150520179 PMID:17825285 UniProt PMID:17825285 EZR Human actin filament binding enables IDA 150520179 PMID:10793131 UniProt PMID:10793131 EZR Human ATPase binding enables IPI UniProtKB:Q92887 150520179 PMID:17825285 UniProt PMID:17825285 EZR Human cadherin binding enables HDA 150520179 PMID:25468996 BHF-UCL PMID:25468996 EZR Human cell adhesion molecule binding enables IPI UniProtKB:P16278 150520179 PMID:15498789 BHF-UCL PMID:15498789 EZR Human cell adhesion molecule binding enables IBA PANTHER:PTN001150648|RGD:3169|UniProtKB:P15311|UniProtKB:P26038 150520179 GO_Central GO_REF:0000033 EZR Human cell adhesion molecule binding enables IPI UniProtKB:P19320|UniProtKB:P32942 150520179 PMID:12082081 BHF-UCL PMID:12082081 EZR Human cytoskeletal protein binding enables IEA InterPro:IPR000798 150520179 InterPro GO_REF:0000002 EZR Human disordered domain specific binding enables IEA UniProtKB:P26040|ensembl:ENSMUSP00000063734 150520179 Ensembl GO_REF:0000107 EZR Human identical protein binding enables IPI UniProtKB:P15311 150520179 PMID:21988832, PMID:29568061, PMID:31837246 IntAct PMID:21988832|PMID:29568061|PMID:31837246 EZR Human microtubule binding enables IMP 150520179 PMID:23857773 UniProt PMID:23857773 EZR Human protein binding ISO RGD:2998 9068941 RGD PMID:15044370|REF_RGD_ID:1581827 EZR Human protein binding enables IPI UniProtKB:Q8IZU9 150520179 PMID:34799561 IntAct PMID:34799561 EZR Human protein binding enables IPI UniProtKB:Q8IZE3 150520179 PMID:12651155, PMID:32707033 IntAct PMID:12651155|PMID:32707033 EZR Human protein binding enables IPI UniProtKB:P07384 150520179 PMID:22805611 IntAct PMID:22805611 EZR Human protein binding enables IPI UniProtKB:P07332 150520179 PMID:18046454 IntAct PMID:18046454 EZR Human protein binding enables IPI UniProtKB:Q8IVT2 150520179 PMID:28514442, PMID:32296183 IntAct PMID:28514442|PMID:32296183 EZR Human protein binding enables IPI UniProtKB:O14745 150520179 PMID:15020681, PMID:20937695 IntAct PMID:15020681|PMID:20937695 EZR Human protein binding enables IPI UniProtKB:Q9H270 150520179 PMID:21148287 UniProt PMID:21148287 EZR Human protein binding enables IPI UniProtKB:O14745|UniProtKB:O14986 150520179 PMID:20442317 UniProt PMID:20442317 EZR Human protein binding enables IPI UniProtKB:O14745|UniProtKB:P35241 150520179 PMID:23414517, PMID:29568061 IntAct PMID:23414517|PMID:29568061 EZR Human protein binding enables IPI UniProtKB:Q00987 150520179 PMID:20195357 IntAct PMID:20195357 EZR Human protein binding enables IPI UniProtKB:O14745,UniProtKB:P41240,UniProtKB:Q9NWQ8 150520179 PMID:17911601 UniProt PMID:17911601 EZR Human protein binding enables IPI UniProtKB:P42858 150520179 PMID:17500595 IntAct PMID:17500595 EZR Human protein binding enables IPI UniProtKB:Q86YL7 150520179 PMID:17046996 UniProt PMID:17046996 EZR Human protein binding enables IPI UniProtKB:P25815,UniProtKB:P46940 150520179 PMID:25554515 UniProt PMID:25554515 EZR Human protein binding enables IPI UniProtKB:Q12959 150520179 PMID:20551903 UniProt PMID:20551903 EZR Human protein binding enables IPI UniProtKB:P06396|UniProtKB:P12814|UniProtKB:P46940|UniProtKB:Q9NZA1 150520179 PMID:10793131 UniProt PMID:10793131 EZR Human protein binding enables IPI UniProtKB:A6NDV4 150520179 PMID:15498789 UniProt PMID:15498789 EZR Human protein binding enables IPI UniProtKB:P26038|UniProtKB:Q5PQK5|UniProtKB:Q5WQV5 150520179 PMID:7844168 UniProt PMID:7844168 EZR Human protein binding enables IPI UniProtKB:P42858|UniProtKB:Q14457|UniProtKB:Q8N108-16|UniProtKB:Q8WTV1|UniProtKB:Q8WU43 150520179 PMID:32814053 IntAct PMID:32814053 EZR Human protein binding enables IPI UniProtKB:P55011 150520179 PMID:22570591, PMID:24555568 IntAct PMID:22570591|PMID:24555568 EZR Human protein binding enables IPI UniProtKB:Q63155 150520179 PMID:21849478 IntAct PMID:21849478 EZR Human protein binding enables IPI UniProtKB:Q8WX93 150520179 PMID:11598191 HGNC-UCL PMID:11598191 EZR Human protein binding enables IPI UniProtKB:O14745|UniProtKB:Q15599 150520179 PMID:17242191 UniProt PMID:17242191 EZR Human protein binding enables IPI UniProtKB:P26447|UniProtKB:P29034 150520179 PMID:31837246 IntAct PMID:31837246 EZR Human protein binding enables IPI UniProtKB:P23508 150520179 PMID:19555689 UniProt PMID:19555689 EZR Human protein binding ISO UniProtKB:P35952 9068941 RGD PMID:15044370|REF_RGD_ID:1581827 EZR Human protein binding enables IPI UniProtKB:Q92574|UniProtKB:Q9EP53 150520179 PMID:10806479 UniProt PMID:10806479 EZR Human protein binding ISO RGD:621878 9068941 RGD PMID:11461930|REF_RGD_ID:7207839 EZR Human protein binding enables IPI UniProtKB:P00533 150520179 PMID:24658140, PMID:31980649, PMID:35384245 IntAct PMID:24658140|PMID:31980649|PMID:35384245 EZR Human protein binding enables IPI UniProtKB:P35241 150520179 PMID:26496610, PMID:35271311 IntAct PMID:26496610|PMID:35271311 EZR Human protein binding enables IPI UniProtKB:P35241|UniProtKB:Q8IVT2 150520179 PMID:33961781 IntAct PMID:33961781 EZR Human protein binding ISO RGD:628869 9068941 RGD PMID:17684062|REF_RGD_ID:2302243 EZR Human protein domain specific binding ISO RGD:620911 9068941 RGD PMID:17045809|REF_RGD_ID:7207801 EZR Human protein domain specific binding enables IPI UniProtKB:P46940 150520179 PMID:25554515 UniProt PMID:25554515 EZR Human protein kinase A binding enables IPI UniProtKB:P10644|UniProtKB:P13861 150520179 PMID:25097019 UniProt PMID:25097019 EZR Human protein kinase A catalytic subunit binding enables IPI UniProtKB:P17612 150520179 PMID:17911601 UniProt PMID:17911601 EZR Human protein kinase A regulatory subunit binding enables IPI UniProtKB:P10644|UniProtKB:P13861 150520179 PMID:17911601 UniProt PMID:17911601 EZR Human protein-containing complex binding ISO RGD:3708|RGD:708538|RGD:70924 9068941 RGD PMID:21372499|REF_RGD_ID:7243126 EZR Human RNA binding enables HDA 150520179 PMID:22658674, PMID:22681889 UniProt PMID:22658674|PMID:22681889 EZR Human S100 protein binding enables IPI UniProtKB:P25815 150520179 PMID:25554515 UniProt PMID:25554515
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(+)-pilocarpine (ISO) (S)-amphetamine (ISO) (S)-nicotine (EXP,ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 1,8-cineole (ISO) 1-chloro-2,4-dinitrobenzene (EXP) 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO) 1-naphthyl isothiocyanate (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (EXP) 17beta-hydroxy-5alpha-androstan-3-one (EXP) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2-naphthylamine (EXP) 3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine (ISO) 4,4'-diaminodiphenylmethane (ISO) 4-hydroxynon-2-enal (EXP) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (ISO) 7,12-dimethyltetraphene (ISO) acetamide (ISO) acetylsalicylic acid (EXP) acrolein (EXP) aflatoxin B1 (ISO) aldehydo-D-glucose (ISO) all-trans-retinoic acid (EXP,ISO) alpha-pinene (EXP) alpha-Zearalanol (ISO) ammonium chloride (ISO) ampicillin (ISO) aniline (ISO) antirheumatic drug (EXP) aristolochic acid A (EXP) arsane (EXP) arsenic atom (EXP) arsenite(3-) (ISO) arsenous acid (EXP) atropine (EXP) benzalkonium chloride (EXP) benzatropine (EXP) benzo[a]pyrene (EXP,ISO) benzo[a]pyrene diol epoxide I (EXP) beta-naphthoflavone (ISO) bicalutamide (EXP) bis(2-chloroethyl) sulfide (EXP) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) bisphenol AF (EXP) bleomycin A2 (ISO) cadmium atom (EXP) caffeine (EXP,ISO) cannabidiol (EXP,ISO) carbon monoxide (EXP) carbon nanotube (EXP) CGP 52608 (EXP) chloropicrin (EXP) choline (ISO) chromium(6+) (EXP) cisplatin (EXP,ISO) clofibric acid (ISO) clozapine (EXP) cobalt dichloride (EXP) cocaine (EXP) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (EXP) coumestrol (EXP) CU-O LINKAGE (EXP) Cuprizon (ISO) cyclohexanols (EXP) cyclosporin A (EXP) cytarabine (EXP) D-glucose (ISO) diarsenic trioxide (EXP) dibutyl phthalate (ISO) diethylstilbestrol (ISO) diuron (ISO) dorsomorphin (EXP) doxorubicin (EXP) elemental selenium (EXP) Enterolactone (EXP) entinostat (EXP) enzyme inhibitor (EXP) ethanol (EXP,ISO) fipronil (ISO) flavonoids (ISO) folic acid (ISO) fructose (ISO) furan (ISO) genistein (ISO) gentamycin (ISO) glucose (ISO) GSK-J4 (EXP) haloperidol (EXP) hyaluronic acid (ISO) hydrogen peroxide (EXP,ISO) inulin (ISO) isobutanol (EXP) isoflavones (ISO) ivermectin (EXP) L-methionine (ISO) lead nitrate (ISO) lead(0) (EXP) leflunomide (EXP) lipopolysaccharide (ISO) lithium atom (ISO) lithium hydride (ISO) menadione (EXP) methotrexate (EXP) methylmercury chloride (EXP) metronidazole (ISO) microcystin-LR (EXP,ISO) N-methyl-4-phenylpyridinium (ISO) N-methyl-N-nitrosourea (ISO) N-nitrosodiethylamine (ISO) N-nitrosodimethylamine (ISO) N-nitrosomorpholine (ISO) naphthalene (ISO) neomycin (ISO) nicotine (EXP,ISO) nitrates (ISO) nitric oxide (ISO) nitrogen dioxide (EXP) ochratoxin A (EXP,ISO) okadaic acid (EXP) ozone (EXP) panobinostat (EXP) paracetamol (EXP,ISO) paraquat (ISO) parathion (EXP) PCB138 (ISO) pentachlorophenol (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenobarbital (EXP) phenylmercury acetate (EXP) PhIP (ISO) Propiverine (ISO) rotenone (ISO) SB 203580 (EXP) SB 431542 (EXP) selenium atom (EXP) silicon dioxide (EXP) sodium arsenite (EXP,ISO) sodium dichromate (ISO) sodium dodecyl sulfate (EXP) sodium fluoride (ISO) sodium hydroxide (EXP) Soman (ISO) starch (ISO) T-2 toxin (ISO) temozolomide (EXP) tert-butyl hydroperoxide (EXP) testosterone enanthate (EXP) tetrachloromethane (ISO) thioacetamide (ISO) thiram (EXP) titanium dioxide (ISO) tributylstannane (ISO) Tributyltin oxide (ISO) trichostatin A (EXP) triclosan (EXP) Triton X-100 (EXP) tropan-3alpha-yl 3-hydroxy-2-phenylpropanoate (EXP) tungsten (ISO) urethane (EXP) valproic acid (EXP) vancomycin (ISO) vinclozolin (ISO) vitamin E (EXP) withaferin A (EXP) Withanone (EXP) Y-27632 (ISO) zoledronic acid (EXP)
Cellular Component
actin cytoskeleton (IDA) actin filament (IDA) adherens junction (IBA) apical part of cell (IBA,IDA,IEA) apical plasma membrane (IDA,IEA,ISO) astrocyte projection (ISO) basolateral plasma membrane (ISS) brush border (IEA,ISS) cell body (ISO) cell cortex (IEA) cell periphery (IDA) cell projection (IDA,IEA) cell tip (ISO) ciliary basal body (IEA) cortical cytoskeleton (TAS) cytoplasm (IDA,IEA) cytoskeleton (IEA) cytosol (IDA,TAS) endosome (IDA) extracellular exosome (HDA) extracellular space (HDA) fibrillar center (IDA) filopodium (IBA,IDA,ISO) focal adhesion (HDA,IDA) immunological synapse (IDA) membrane (HDA,IEA) microspike (ISO) microvillus (IBA,IDA,IEA) microvillus membrane (IEA) perinuclear region of cytoplasm (IDA) plasma membrane (IBA,IDA,IEA) plasma membrane raft (IDA) protein-containing complex (IDA) ruffle (IDA) ruffle membrane (IEA) Schwann cell microvillus (ISO) T-tubule (ISO) uropod (IEA) vesicle (HDA)
EZR Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 158,765,748 - 158,819,368 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 158,765,741 - 158,819,368 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 159,186,780 - 159,240,400 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 159,106,764 - 159,159,247 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 159,157,186 - 159,209,668 NCBI Celera 6 159,834,789 - 159,888,323 (-) NCBI Celera Cytogenetic Map 6 q25.3 NCBI HuRef 6 156,657,307 - 156,711,123 (-) NCBI HuRef CHM1_1 6 159,449,491 - 159,503,058 (-) NCBI CHM1_1 T2T-CHM13v2.0 6 160,010,984 - 160,064,812 (-) NCBI T2T-CHM13v2.0
Ezr Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 7,005,530 - 7,050,179 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 7,005,440 - 7,050,183 (-) Ensembl GRCm39 Ensembl GRCm38 17 6,738,131 - 6,782,780 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 6,738,041 - 6,782,784 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 6,942,480 - 6,987,129 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 17 6,587,789 - 6,632,438 (-) NCBI MGSCv36 mm8 Celera 15 14,687,905 - 14,732,667 (+) NCBI Celera Cytogenetic Map 17 A1 NCBI cM Map 17 4.38 NCBI
Ezr Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 49,373,033 - 49,416,573 (-) NCBI GRCr8 mRatBN7.2 1 46,967,961 - 47,011,505 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 46,967,658 - 47,011,505 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 47,516,906 - 47,560,444 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 53,504,177 - 53,547,825 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 47,592,352 - 47,635,890 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 47,287,872 - 47,331,412 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 47,287,874 - 47,331,412 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 48,590,971 - 48,634,511 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 41,178,195 - 41,221,735 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 41,181,139 - 41,224,680 (-) NCBI Celera 1 42,655,531 - 42,699,079 (-) NCBI Celera Cytogenetic Map 1 q11 NCBI
Ezr Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955439 3,703,013 - 3,740,345 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955439 3,701,722 - 3,740,345 (+) NCBI ChiLan1.0 ChiLan1.0
EZR Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 178,869,668 - 178,923,683 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 176,774,286 - 176,828,291 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 156,656,146 - 156,709,986 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 161,670,483 - 161,723,102 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 161,670,483 - 161,723,102 (-) Ensembl panpan1.1 panPan2
EZR Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 48,160,206 - 48,210,036 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 48,160,206 - 48,210,036 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 49,005,197 - 49,055,099 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 48,346,325 - 48,397,738 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 48,346,327 - 48,397,690 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 48,223,100 - 48,272,944 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 48,093,979 - 48,143,792 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 48,653,395 - 48,703,265 (-) NCBI UU_Cfam_GSD_1.0
Ezr Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404946 143,161,383 - 143,205,800 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936489 10,412,710 - 10,458,201 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936489 10,413,374 - 10,457,771 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
EZR Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 8,403,453 - 8,452,742 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 8,403,362 - 8,452,750 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 10,423,530 - 10,432,162 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
EZR Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 13 86,342,954 - 86,399,827 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 13 86,344,051 - 86,370,622 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666040 58,721,321 - 58,778,578 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ezr
.
Confirmed Target Of
Predicted Target Of
Count of predictions: 1415 Count of miRNA genes: 669 Interacting mature miRNAs: 748 Transcripts: ENST00000337147, ENST00000367075, ENST00000392177, ENST00000476189 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
407092675 GWAS741651_H hair color QTL GWAS741651 (human) 9e-55 hair color 6 158770756 158770757 Human 597342174 GWAS1438248_H serum alanine aminotransferase measurement QTL GWAS1438248 (human) 1e-12 serum alanine aminotransferase measurement serum alanine aminotransferase activity level (CMO:0000575) 6 158809601 158809602 Human 1643404 BMD3_H Bone mineral density QTL 3 (human) 2.42 0.0005 Bone mineral density 6 157563614 170805979 Human 597097180 GWAS1193254_H testosterone measurement QTL GWAS1193254 (human) 2e-09 testosterone measurement serum testosterone level (CMO:0000568) 6 158803529 158803530 Human 597169700 GWAS1265774_H serum alanine aminotransferase measurement QTL GWAS1265774 (human) 8e-11 serum alanine aminotransferase measurement serum alanine aminotransferase activity level (CMO:0000575) 6 158802736 158802737 Human 1643367 BW323_H Body weight QTL 323 (human) 2.42 0.0005 Body fat amount 6 157563614 170805979 Human
D6S1614
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 159,195,681 - 159,195,765 UniSTS GRCh37 Build 36 6 159,115,669 - 159,115,753 RGD NCBI36 Celera 6 159,843,691 - 159,843,765 RGD Cytogenetic Map 6 q25.3 UniSTS HuRef 6 156,666,209 - 156,666,283 UniSTS Marshfield Genetic Map 6 159.98 RGD Marshfield Genetic Map 6 159.98 UniSTS Genethon Genetic Map 6 161.2 UniSTS
RH46601
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 159,186,795 - 159,186,951 UniSTS GRCh37 Build 36 6 159,106,783 - 159,106,939 RGD NCBI36 Celera 6 159,834,811 - 159,834,967 RGD Cytogenetic Map 6 q25.3 UniSTS HuRef 6 156,657,329 - 156,657,485 UniSTS GeneMap99-GB4 RH Map 6 621.6 UniSTS NCBI RH Map 6 1625.9 UniSTS
RH91385
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 159,206,406 - 159,206,542 UniSTS GRCh37 Build 36 6 159,126,394 - 159,126,530 RGD NCBI36 Celera 6 159,854,408 - 159,854,544 RGD Cytogenetic Map 6 q25.3 UniSTS HuRef 6 156,677,263 - 156,677,399 UniSTS GeneMap99-GB4 RH Map 6 619.71 UniSTS
RH27492
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 159,187,133 - 159,187,201 UniSTS GRCh37 Build 36 6 159,107,121 - 159,107,189 RGD NCBI36 Celera 6 159,835,145 - 159,835,213 RGD Cytogenetic Map 6 q25.3 UniSTS HuRef 6 156,657,663 - 156,657,731 UniSTS
SHGC-149418
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 159,208,750 - 159,209,047 UniSTS GRCh37 Build 36 6 159,128,738 - 159,129,035 RGD NCBI36 Celera 6 159,856,753 - 159,857,050 RGD Cytogenetic Map 6 q25.3 UniSTS HuRef 6 156,679,608 - 156,679,905 UniSTS TNG Radiation Hybrid Map 6 78956.0 UniSTS
D15S1323
Human Assembly Chr Position (strand) Source JBrowse Celera 6 159,835,662 - 159,835,897 RGD Cytogenetic Map 6 q25.3 UniSTS HuRef 6 156,658,180 - 156,658,415 UniSTS GeneMap99-G3 RH Map 3 5081.0 UniSTS
SHGC-30156
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 159,186,792 - 159,186,916 UniSTS GRCh37 Build 36 6 159,106,780 - 159,106,904 RGD NCBI36 Celera 6 159,834,808 - 159,834,932 RGD Cytogenetic Map 6 q25.3 UniSTS HuRef 6 156,657,326 - 156,657,450 UniSTS GeneMap99-GB4 RH Map 6 621.6 UniSTS Whitehead-RH Map 6 829.0 UniSTS NCBI RH Map 6 1633.8 UniSTS GeneMap99-G3 RH Map 6 6551.0 UniSTS
SHGC-146276
Human Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 6 q25.3 UniSTS HuRef 6 156,673,307 - 156,673,647 UniSTS TNG Radiation Hybrid Map 6 78942.0 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1204
2439
2788
2253
4974
1726
2351
6
624
1951
465
2270
7306
6472
53
3734
1
852
1744
1617
175
1
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000337147 ⟹ ENSP00000338934
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 158,765,741 - 158,818,227 (-) Ensembl
Ensembl Acc Id:
ENST00000367075 ⟹ ENSP00000356042
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 158,765,748 - 158,819,368 (-) Ensembl
Ensembl Acc Id:
ENST00000392177 ⟹ ENSP00000376016
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 158,765,742 - 158,789,474 (-) Ensembl
Ensembl Acc Id:
ENST00000476189
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 158,783,534 - 158,819,349 (-) Ensembl
RefSeq Acc Id:
NM_001111077 ⟹ NP_001104547
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 158,765,748 - 158,819,368 (-) NCBI GRCh37 6 159,186,773 - 159,240,456 (-) ENTREZGENE HuRef 6 156,657,307 - 156,711,123 (-) ENTREZGENE CHM1_1 6 159,449,491 - 159,503,058 (-) NCBI T2T-CHM13v2.0 6 160,010,984 - 160,064,812 (-) NCBI
Sequence:
ACTCGGCGGACGCAAGGGCGGCGGGGAGCACACGGAGCACTGCAGGCGCCGGGTTGGGACAGCGTCTTCGCTGCTGCTGGATAGTCGTGTTTTCGGGGATCGAGGATACTCACCAGAAACCGAAAATG
hide sequence
RefSeq Acc Id:
NM_003379 ⟹ NP_003370
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 158,765,748 - 158,818,235 (-) NCBI GRCh37 6 159,186,773 - 159,240,456 (-) ENTREZGENE Build 36 6 159,106,764 - 159,159,247 (-) NCBI Archive HuRef 6 156,657,307 - 156,711,123 (-) ENTREZGENE CHM1_1 6 159,449,491 - 159,501,942 (-) NCBI T2T-CHM13v2.0 6 160,010,984 - 160,063,679 (-) NCBI
Sequence:
GAGTGTCGGGCGCGGCAGGAGGACGAGGCAGGGCGGGCGGGCGCTCTAAGGGTTCTGCTCTGACTCCAGGTTGGGACAGCGTCTTCGCTGCTGCTGGATAGTCGTGTTTTCGGGGATCGAGGATACTC
hide sequence
RefSeq Acc Id:
XM_011536110 ⟹ XP_011534412
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 158,765,748 - 158,789,346 (-) NCBI
Sequence:
ATGCAGAGCTGGAGTTTGCAATCCAGCCAAATACAACTGGAAAACAGCTTTTTGATCAGAGTGATGGACCAGCACAAACTTACCAGGGACCAGTGGGAGGACCGGATCCAGGTGTGGCATGCGGAACA
hide sequence
RefSeq Acc Id:
XM_054356313 ⟹ XP_054212288
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 6 160,010,984 - 160,034,914 (-) NCBI
RefSeq Acc Id:
NP_001104547 ⟸ NM_001111077
- UniProtKB:
Q96CU8 (UniProtKB/Swiss-Prot), Q4VX75 (UniProtKB/Swiss-Prot), P23714 (UniProtKB/Swiss-Prot), E1P5A8 (UniProtKB/Swiss-Prot), Q9NSJ4 (UniProtKB/Swiss-Prot), P15311 (UniProtKB/Swiss-Prot), B2R6J2 (UniProtKB/TrEMBL), V9HW42 (UniProtKB/TrEMBL)
- Sequence:
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLKLDKKVSAQEVRKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPETAVLLGSY
hide sequence
RefSeq Acc Id:
NP_003370 ⟸ NM_003379
- UniProtKB:
Q96CU8 (UniProtKB/Swiss-Prot), Q4VX75 (UniProtKB/Swiss-Prot), P23714 (UniProtKB/Swiss-Prot), E1P5A8 (UniProtKB/Swiss-Prot), Q9NSJ4 (UniProtKB/Swiss-Prot), P15311 (UniProtKB/Swiss-Prot), B2R6J2 (UniProtKB/TrEMBL), V9HW42 (UniProtKB/TrEMBL)
- Sequence:
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLKLDKKVSAQEVRKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPETAVLLGSY
hide sequence
RefSeq Acc Id:
XP_011534412 ⟸ XM_011536110
- Peptide Label:
isoform X1
- UniProtKB:
B7Z437 (UniProtKB/TrEMBL)
- Sequence:
MQSWSLQSSQIQLENSFLIRVMDQHKLTRDQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKA
hide sequence
Ensembl Acc Id:
ENSP00000338934 ⟸ ENST00000337147
Ensembl Acc Id:
ENSP00000356042 ⟸ ENST00000367075
Ensembl Acc Id:
ENSP00000376016 ⟸ ENST00000392177
RefSeq Acc Id:
XP_054212288 ⟸ XM_054356313
- Peptide Label:
isoform X1
- UniProtKB:
B7Z437 (UniProtKB/TrEMBL)
RGD ID: 7209561 Promoter ID: EPDNEW_H10526 Type: initiation region Name: EZR_2 Description: ezrin SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H10527 Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 6 158,818,235 - 158,818,295 EPDNEW
RGD ID: 7209563 Promoter ID: EPDNEW_H10527 Type: initiation region Name: EZR_1 Description: ezrin SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H10526 Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 6 158,819,364 - 158,819,424 EPDNEW
RGD ID: 6804005 Promoter ID: HG_KWN:55624 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell_12Hour, Lymphoblastoid Transcripts: ENST00000367074, ENST00000392177 Position: Human Assembly Chr Position (strand) Source Build 36 6 159,130,149 - 159,130,649 (-) MPROMDB
RGD ID: 6804214 Promoter ID: HG_KWN:55627 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, CD4+TCell_12Hour, HeLa_S3, Jurkat, K562, Lymphoblastoid, NB4 Transcripts: NM_003379 Position: Human Assembly Chr Position (strand) Source Build 36 6 159,159,151 - 159,160,287 (-) MPROMDB
RGD ID: 6804215 Promoter ID: HG_KWN:55628 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, CD4+TCell_12Hour, HeLa_S3, K562, Lymphoblastoid, NB4 Transcripts: NM_001111077, OTTHUMT00000042880 Position: Human Assembly Chr Position (strand) Source Build 36 6 159,160,199 - 159,160,699 (-) MPROMDB
