Ezr (ezrin) - Rat Genome Database

Name: Ezr
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Ezr (ezrin) Rattus norvegicus

Analyze

Symbol:

Ezr

Name:

ezrin

RGD ID:

621161

Description:

Enables protein domain specific binding activity. Involved in epithelial cell differentiation and filopodium assembly. Located in several cellular components, including basolateral plasma membrane; microspike; and microvillus. Orthologous to human EZR (ezrin); PARTICIPATES IN FasL mediated signaling pathway; parathyroid hormone signaling pathway; protein kinase A (PKA) signaling pathway; INTERACTS WITH (+)-pilocarpine; 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

cytovillin; MGC94076; p81; Vil2; villin 2; villin-2

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	EZR (ezrin)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Ezr (ezrin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ezr (ezrin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	EZR (ezrin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	EZR (ezrin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ezr (ezrin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	EZR (ezrin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	EZR (ezrin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ezr (ezrin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	ZNF496 (zinc finger protein 496)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Ezr (ezrin)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	EZR (ezrin)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ezra (ezrin a)	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	ezrb (ezrin b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Moe	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	erm-1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ezr	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	1	46,967,961 - 47,011,505 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	46,967,658 - 47,011,505 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	47,516,906 - 47,560,444 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	53,504,177 - 53,547,825 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	47,592,352 - 47,635,890 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	47,287,872 - 47,331,412 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	47,287,874 - 47,331,412 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	48,590,971 - 48,634,511 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	41,178,195 - 41,221,735 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	41,181,139 - 41,224,680 (-)	NCBI
Celera	1	42,655,531 - 42,699,079 (-)	NCBI		Celera
Cytogenetic Map	1	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

3-methylglutaconic aciduria with deafness, encephalopathy, and Leigh-like syndrome (ISO)

Animal Mammary Neoplasms (ISO)

carcinoma (ISO)

Experimental Liver Cirrhosis (ISO)

Experimental Mammary Neoplasms (ISO)

genetic disease (ISO)

Neoplasm Metastasis (ISO)

osteoarthritis (ISO)

primary ciliary dyskinesia 32 (ISO)

Prostatic Neoplasms (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-pilocarpine (EXP)

(S)-amphetamine (ISO)

(S)-nicotine (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

1,8-cineole (ISO)

1-chloro-2,4-dinitrobenzene (ISO)

1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO)

1-naphthyl isothiocyanate (EXP)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (ISO)

17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP,ISO)

2-naphthylamine (ISO)

3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine (EXP)

4,4'-diaminodiphenylmethane (EXP)

4-hydroxynon-2-enal (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

7,12-dimethyltetraphene (EXP)

acetamide (EXP)

acetylsalicylic acid (ISO)

acrolein (ISO)

aflatoxin B1 (EXP)

aldehydo-D-glucose (ISO)

all-trans-retinoic acid (ISO)

alpha-pinene (ISO)

ammonium chloride (EXP)

ampicillin (EXP)

aniline (EXP)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

atropine (ISO)

benzalkonium chloride (ISO)

benzatropine (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

beta-naphthoflavone (EXP)

bicalutamide (ISO)

bis(2-chloroethyl) sulfide (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bleomycin A2 (EXP)

cadmium atom (ISO)

caffeine (ISO)

cannabidiol (EXP,ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chloropicrin (ISO)

choline (ISO)

cisplatin (ISO)

clofibric acid (EXP)

clozapine (ISO)

cobalt dichloride (ISO)

cocaine (ISO)

copper atom (EXP)

copper(0) (EXP)

copper(II) sulfate (ISO)

coumestrol (ISO)

CU-O LINKAGE (ISO)

Cuprizon (EXP)

cyclohexanols (ISO)

cyclosporin A (ISO)

cytarabine (ISO)

D-glucose (ISO)

diarsenic trioxide (ISO)

dibutyl phthalate (EXP)

diethylstilbestrol (EXP,ISO)

diuron (EXP)

dorsomorphin (ISO)

doxorubicin (ISO)

elemental selenium (ISO)

Enterolactone (ISO)

entinostat (ISO)

enzyme inhibitor (ISO)

ethanol (ISO)

fipronil (EXP)

flavonoids (EXP)

folic acid (ISO)

fructose (EXP)

furan (EXP)

genistein (ISO)

gentamycin (EXP)

glucose (ISO)

haloperidol (ISO)

hyaluronic acid (EXP)

hydrogen peroxide (EXP,ISO)

inulin (ISO)

isobutanol (ISO)

isoflavones (EXP)

ivermectin (ISO)

L-methionine (ISO)

lead nitrate (ISO)

lead(0) (ISO)

leflunomide (ISO)

lipopolysaccharide (ISO)

lithium atom (EXP)

lithium hydride (EXP)

menadione (ISO)

methotrexate (ISO)

methylmercury chloride (ISO)

metronidazole (EXP)

microcystin-LR (EXP,ISO)

N-methyl-4-phenylpyridinium (ISO)

N-methyl-N-nitrosourea (EXP)

N-nitrosodiethylamine (EXP)

N-nitrosodimethylamine (EXP)

N-nitrosomorpholine (EXP)

naphthalene (ISO)

neomycin (EXP)

nicotine (ISO)

nitric oxide (EXP)

ochratoxin A (EXP,ISO)

ozone (ISO)

panobinostat (ISO)

paracetamol (EXP,ISO)

paraquat (EXP)

parathion (ISO)

PCB138 (EXP)

pentachlorophenol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (ISO)

phenylmercury acetate (ISO)

PhIP (EXP)

Propiverine (EXP)

rotenone (EXP)

SB 203580 (ISO)

SB 431542 (ISO)

selenium atom (ISO)

silicon dioxide (ISO)

sodium arsenite (EXP,ISO)

sodium dichromate (EXP)

sodium dodecyl sulfate (ISO)

sodium fluoride (ISO)

sodium hydroxide (ISO)

Soman (EXP)

starch (EXP)

T-2 toxin (EXP)

temozolomide (ISO)

tert-butyl hydroperoxide (ISO)

testosterone enanthate (ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

tributylstannane (ISO)

Tributyltin oxide (ISO)

trichostatin A (ISO)

triclosan (ISO)

Triton X-100 (ISO)

tropan-3alpha-yl 3-hydroxy-2-phenylpropanoate (ISO)

tungsten (ISO)

urethane (ISO)

valproic acid (ISO)

vancomycin (EXP)

vinclozolin (EXP)

vitamin E (ISO)

withaferin A (ISO)

Y-27632 (EXP)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

actin cytoskeleton organization (ISO)

actin filament bundle assembly (IEA,ISO,ISS)

astral microtubule organization (IEA,ISO)

cellular response to cAMP (IEA,ISO)

cortical microtubule organization (IEA,ISO)

epithelial cell differentiation (IEP)

establishment of centrosome localization (IEA,ISO)

establishment of endothelial barrier (IEA,ISO)

establishment of epithelial cell apical/basal polarity (ISO)

establishment or maintenance of apical/basal cell polarity (IEA,ISO)

filopodium assembly (IEA,IMP,ISO)

gland morphogenesis (ISO)

intestinal D-glucose absorption (IEA,ISO)

leukocyte cell-cell adhesion (IEA,ISO)

membrane to membrane docking (IEA,ISO)

microvillus assembly (IEA,ISO)

negative regulation of ERK1 and ERK2 cascade (IEA,ISO)

negative regulation of interleukin-2 production (IEA,ISO)

negative regulation of p38MAPK cascade (IEA,ISO)

negative regulation of T cell receptor signaling pathway (IEA,ISO)

negative regulation of transcription by RNA polymerase II (IEA,ISO)

positive regulation of early endosome to late endosome transport (IBA,IEA,ISO)

positive regulation of gene expression (IEA,ISO)

positive regulation of multicellular organism growth (IEA,ISO)

positive regulation of protein catabolic process (IEA,ISO)

positive regulation of protein localization to early endosome (IBA,IEA,ISO)

positive regulation of protein localization to plasma membrane (IEA,ISO)

postsynaptic actin cytoskeleton organization (IEA,ISO)

protein kinase A signaling (IEA,ISO)

protein localization to cell cortex (IEA,ISO)

protein localization to plasma membrane (IEA,ISO)

protein-containing complex localization (IEA,ISO)

receptor internalization (IEA,ISO)

regulation of actin cytoskeleton organization (ISO)

regulation of cell shape (IBA,IEA,ISO)

regulation of cell size (ISO)

regulation of microvillus length (IEA,ISO)

regulation of non-canonical NF-kappaB signal transduction (ISO)

regulation of organelle assembly (IBA,IEA,ISO)

sphingosine-1-phosphate receptor signaling pathway (IEA,ISO)

terminal web assembly (IEA,ISO)

Cellular Component

actin cytoskeleton (ISO,ISS)

actin filament (IEA,ISO,ISS)

adherens junction (IBA)

apical part of cell (IBA,ISO)

apical plasma membrane (IDA,IEA,ISO)

astrocyte projection (IDA)

basolateral plasma membrane (IDA)

brush border (IEA,ISO)

cell body (IDA)

cell cortex (IEA)

cell periphery (ISO)

cell projection (IEA,ISO)

cell tip (IDA)

ciliary basal body (IEA,ISO)

cytoplasm (IEA,ISO)

cytoskeleton (IEA)

cytosol (IEA,ISO,TAS)

endosome (IEA,ISO)

fibrillar center (IEA,ISO)

filopodium (IBA,IDA,IEA,ISO)

focal adhesion (IEA,ISO)

immunological synapse (IEA,ISO)

microspike (IDA)

microvillus (IBA,IEA,ISO)

microvillus membrane (IDA)

perinuclear region of cytoplasm (IEA,ISO)

plasma membrane (IBA,IEA,ISO,ISS)

plasma membrane raft (IEA,ISO)

protein-containing complex (IEA,ISO)

ruffle (IEA,ISO)

ruffle membrane (IEA)

Schwann cell microvillus (IDA)

T-tubule (IDA)

uropod (IEA,ISO)

Molecular Function

actin binding (IBA,IEA,ISO)

actin filament binding (IEA,ISO,ISS)

ATPase binding (IEA,ISO)

cell adhesion molecule binding (IBA,IEA,ISO,ISS)

disordered domain specific binding (IEA,ISO)

identical protein binding (IEA,ISO)

microtubule binding (IEA,ISO)

protein binding (IPI,ISO)

protein domain specific binding (IPI,ISO)

protein kinase A binding (ISO)

protein kinase A catalytic subunit binding (IEA,ISO)

protein kinase A regulatory subunit binding (IEA,ISO)

protein-containing complex binding (IPI)

S100 protein binding (IEA,ISO)

structural molecule activity (TAS)

Molecular Pathway Annotations Click to see Annotation Detail View

FasL mediated signaling pathway (ISO)

parathyroid hormone signaling pathway (ISO)

protein kinase A (PKA) signaling pathway (ISO)

syndecan signaling pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	The activation of ezrin-radixin-moesin proteins is regulated by netrin-1 through Src kinase and RhoA/Rho kinase activities and mediates netrin-1-induced axon outgrowth.	Antoine-Bertrand J, etal., Mol Biol Cell. 2011 Oct;22(19):3734-46. doi: 10.1091/mbc.E10-11-0917. Epub 2011 Aug 17.
2.	Transcriptional regulation of the ezrin gene during rat intestinal development and epithelial differentiation.	Barila D, etal., Biochim Biophys Acta 1995 Aug 22;1263(2):133-40.
3.	Polarity and developmental regulation of two PDZ proteins in the retinal pigment epithelium.	Bonilha VL and Rodriguez-Boulan E, Invest Ophthalmol Vis Sci. 2001 Dec;42(13):3274-82.
4.	Tetraspanin CD81 is required for the alpha v beta5-integrin-dependent particle-binding step of RPE phagocytosis.	Chang Y and Finnemann SC, J Cell Sci. 2007 Sep 1;120(Pt 17):3053-63. Epub 2007 Aug 7.
5.	ERM proteins mediate the effects of Na+/H+ exchanger (NHE1) activation in cardiac myocytes.	Darmellah A, etal., Cardiovasc Res. 2009 Feb 1;81(2):294-300. doi: 10.1093/cvr/cvn320. Epub 2008 Nov 21.
6.	Asymmetric ERM activation at the Schwann cell process tip is required in axon-associated motility.	Gatto CL, etal., J Cell Physiol. 2007 Jan;210(1):122-32.
7.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
8.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
9.	A functional FERM domain binding motif in neurofascin.	Gunn-Moore FJ, etal., Mol Cell Neurosci. 2006 Dec;33(4):441-6. Epub 2006 Oct 12.
10.	Structural plasticity of perisynaptic astrocyte processes involves ezrin and metabotropic glutamate receptors.	Lavialle M, etal., Proc Natl Acad Sci U S A. 2011 Aug 2;108(31):12915-9. doi: 10.1073/pnas.1100957108. Epub 2011 Jul 13.
11.	The parathyroid hormone receptorsome and the potential for therapeutic intervention.	Mahon MJ Curr Drug Targets. 2012 Jan;13(1):116-28.
12.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
13.	ERMs colocalize transiently with L1 during neocortical axon outgrowth.	Mintz CD, etal., J Comp Neurol 2003 Sep 29;464(4):438-48.
14.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
15.	The glomerular epithelial cell anti-adhesin podocalyxin associates with the actin cytoskeleton through interactions with ezrin.	Orlando RA, etal., J Am Soc Nephrol. 2001 Aug;12(8):1589-98.
16.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
17.	GOA pipeline	RGD automated data pipeline
18.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
19.	The low-density lipoprotein receptor is regulated by estrogen and forms a functional complex with the estrogen-regulated protein ezrin in pituitary GH3 somatolactotropes.	Smith PM, etal., Endocrinology. 2004 Jul;145(7):3075-83. Epub 2004 Mar 24.
20.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
21.	Loss of glomerular foot processes is associated with uncoupling of podocalyxin from the actin cytoskeleton.	Takeda T, etal., J Clin Invest 2001 Jul;108(2):289-301.
22.	Analysis of different complexes of type IIa sodium-dependent phosphate transporter in rat renal cortex using blue-native polyacrylamide gel electrophoresis.	Tanimura A, etal., J Med Invest. 2011 Feb;58(1-2):140-7.
23.	Localized effects of cAMP mediated by distinct routes of protein kinase A.	Tasken K and Aandahl EM, Physiol Rev. 2004 Jan;84(1):137-67.

Additional References at PubMed

PMID:7844168	PMID:9472040	PMID:9852149	PMID:9890997	PMID:10793131	PMID:11285285	PMID:11598191	PMID:11728336	PMID:12082081	PMID:14625387	PMID:14996907	PMID:15177033
PMID:15489334	PMID:15498789	PMID:15797715	PMID:16365167	PMID:16502470	PMID:17065554	PMID:17122142	PMID:17138661	PMID:17292355	PMID:17634366	PMID:17825285	PMID:17911601
PMID:18321067	PMID:18478542	PMID:19190083	PMID:19783662	PMID:19946888	PMID:20458337	PMID:20551175	PMID:20551903	PMID:21120533	PMID:21134835	PMID:21148287	PMID:21282464
PMID:21377456	PMID:21423176	PMID:21451047	PMID:21666723	PMID:21988832	PMID:22114352	PMID:22132106	PMID:22206666	PMID:22291017	PMID:22467863	PMID:22658674	PMID:22681889
PMID:22797597	PMID:22871113	PMID:23106337	PMID:23264465	PMID:23284756	PMID:23376485	PMID:23533145	PMID:23857773	PMID:24091598	PMID:24184478	PMID:24284068	PMID:24385580
PMID:24726496	PMID:24862762	PMID:25051438	PMID:25097019	PMID:25468996	PMID:25486435	PMID:25554515	PMID:25652626	PMID:25854562	PMID:25889165	PMID:28077322	PMID:29568061
PMID:30654004	PMID:31931020

Genomics

Comparative Map Data

Ezr
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	1	46,967,961 - 47,011,505 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	46,967,658 - 47,011,505 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	47,516,906 - 47,560,444 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	53,504,177 - 53,547,825 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	47,592,352 - 47,635,890 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	47,287,872 - 47,331,412 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	47,287,874 - 47,331,412 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	48,590,971 - 48,634,511 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	41,178,195 - 41,221,735 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	41,181,139 - 41,224,680 (-)	NCBI
Celera	1	42,655,531 - 42,699,079 (-)	NCBI		Celera
Cytogenetic Map	1	q11	NCBI

EZR
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	158,765,748 - 158,819,368 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	158,765,741 - 158,819,368 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	159,186,780 - 159,240,400 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	159,106,764 - 159,159,247 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	159,157,186 - 159,209,668	NCBI
Celera	6	159,834,789 - 159,888,323 (-)	NCBI		Celera
Cytogenetic Map	6	q25.3	NCBI
HuRef	6	156,657,307 - 156,711,123 (-)	NCBI		HuRef
CHM1_1	6	159,449,491 - 159,503,058 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	6	160,010,984 - 160,064,812 (-)	NCBI		T2T-CHM13v2.0

Ezr
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	7,005,530 - 7,050,179 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	7,005,440 - 7,050,183 (-)	Ensembl		GRCm39 Ensembl
GRCm38	17	6,738,131 - 6,782,780 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	6,738,041 - 6,782,784 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	17	6,942,480 - 6,987,129 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	17	6,587,789 - 6,632,438 (-)	NCBI		MGSCv36	mm8
Celera	15	14,687,905 - 14,732,667 (+)	NCBI		Celera
Cytogenetic Map	17	A1	NCBI
cM Map	17	4.38	NCBI

Ezr
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955439	3,703,013 - 3,740,345 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955439	3,701,722 - 3,740,345 (+)	NCBI	ChiLan1.0	ChiLan1.0

EZR
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	6	176,774,286 - 176,828,291 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	156,656,146 - 156,709,986 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	161,670,483 - 161,723,102 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	161,670,483 - 161,723,102 (-)	Ensembl	panpan1.1		panPan2

EZR
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	48,160,206 - 48,210,036 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	48,160,206 - 48,210,036 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	49,005,197 - 49,055,099 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	48,346,325 - 48,397,738 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	48,346,327 - 48,397,690 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	48,223,100 - 48,272,944 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	48,093,979 - 48,143,792 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	48,653,395 - 48,703,265 (-)	NCBI		UU_Cfam_GSD_1.0

Ezr
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	143,161,383 - 143,205,800 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936489	10,412,710 - 10,458,201 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936489	10,413,374 - 10,457,771 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

EZR
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	8,403,453 - 8,452,742 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	8,403,362 - 8,452,750 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	10,423,530 - 10,432,162 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

EZR
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	13	86,342,954 - 86,399,827 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	13	86,344,051 - 86,370,622 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666040	58,721,321 - 58,778,578 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ezr
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624929	826,531 - 873,572 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624929	827,275 - 873,743 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Ezr
198 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	66
Count of miRNA genes:	61
Interacting mature miRNAs:	65
Transcripts:	ENSRNOT00000046746
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
738020	Pia8	Pristane induced arthritis QTL 8	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	1	65833076	Rat
1554320	Bmd1	Bone mineral density QTL 1	12.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	509108	86060548	Rat
7421626	Bp360	Blood pressure QTL 360		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	4393289	49393289	Rat
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	5925874	115540829	Rat
631508	Sald1	Serum aldosterone level QTL 1	3.7		blood aldosterone amount (VT:0005346)	serum aldosterone level (CMO:0000487)	1	9856001	54856001	Rat
2302038	Pia31	Pristane induced arthritis QTL 31	5.5	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111)	1	10992065	55992065	Rat
1300167	Hrtrt2	Heart rate QTL 2	4.35		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	11481312	75088344	Rat
2313062	Bmd73	Bone mineral density QTL 73	3.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	11481312	82174945	Rat
2313065	Bss67	Bone structure and strength QTL 67	3.1	0.0001	tibia area (VT:1000281)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
2313069	Bss68	Bone structure and strength QTL 68	2.9	0.0001	tibia size trait (VT:0100001)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
2313075	Bss66	Bone structure and strength QTL 66	3.4	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	11481312	82174945	Rat
2313077	Bss69	Bone structure and strength QTL 69	3.5	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	11481312	82174945	Rat
2313092	Bmd72	Bone mineral density QTL 72	2.5	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	11481312	82174945	Rat
2313097	Bss70	Bone structure and strength QTL 70	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
1578756	Iddm22	Insulin dependent diabetes mellitus QTL 22	2.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	11835181	56835181	Rat
5684998	Bss101	Bone structure and strength QTL 101	3.6		tibia strength trait (VT:1000284)	tibia ultimate force (CMO:0001734)	1	15431621	49361612	Rat
5684999	Bss102	Bone structure and strength QTL 102	5.5	0.00000072	tibia strength trait (VT:1000284)	tibia stiffness (CMO:0001735)	1	15431621	49361612	Rat
631494	Bp95	Blood pressure QTL 95	40	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	16206210	49268520	Rat
634353	Rends2	Renal damage susceptibility QTL 2		0.05	kidney blood vessel morphology trait (VT:0000530)	organ lesion measurement (CMO:0000677)	1	19333571	56983283	Rat
724520	Bp145	Blood pressure QTL 145	2.1	0.0024	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	20784828	65784828	Rat
1357397	Bw41	Body weight QTL 41	4.19	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	1	22340647	49361612	Rat
1357401	Bw43	Body weight QTL 43	3.75		body mass (VT:0001259)	body weight (CMO:0000012)	1	22340647	49361612	Rat
1357400	Bw62	Body weight QTL62	4.05		inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	1	22340647	67340647	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	22340647	102268831	Rat
1331785	Rf27	Renal function QTL 27	4.643		urine sodium amount (VT:0006274)	urine sodium level (CMO:0000129)	1	28879780	78430678	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	30882023	123479925	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
1300172	Bp172	Blood pressure QTL 172	3.56		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	32737273	90665040	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
1354599	Bw29	Body weight QTL 29	3.46	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	1	33449848	78449848	Rat
1354643	Foco2	Food consumption QTL 2	7.17	0.0001	eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	1	33449848	78449848	Rat
8552900	Pigfal1	Plasma insulin-like growth factor 1 level QTL 1	7.4		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	34836858	79836858	Rat
8552948	Pigfal11	Plasma insulin-like growth factor 1 level QTL 11	4.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	34836858	79836858	Rat
9589820	Insglur3	Insulin/glucose ratio QTL 3	10.75	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	1	34836858	79836858	Rat
1331732	Srn4	Serum renin concentration QTL 4	4.467		renin activity (VT:0005581)	plasma renin activity level (CMO:0000116)	1	35239598	78430678	Rat
1331792	Rf29	Renal function QTL 29	4.589		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	1	35239598	78430678	Rat
2313051	Bss57	Bone structure and strength QTL 57	3.7	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	43284731	118944897	Rat
2313059	Bss55	Bone structure and strength QTL 55	3.2	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
2313072	Bss53	Bone structure and strength QTL 53	4.3	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	43284731	118944897	Rat
2313078	Bss54	Bone structure and strength QTL 54	3.5	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
2313094	Bss58	Bone structure and strength QTL 58	3.7	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	43284731	118944897	Rat
2313098	Bmd70	Bone mineral density QTL 70	3.6	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	43284731	118944897	Rat
2313099	Bss56	Bone structure and strength QTL 56	2.4	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	1	43284731	118944897	Rat
2302059	Pia36	Pristane induced arthritis QTL 36	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	43333002	88333002	Rat
1331778	Rf28	Renal function QTL 28	4.66		urine potassium amount (VT:0010539)	urine potassium excretion rate (CMO:0000761)	1	45803140	78430678	Rat

Markers in Region

RH127410

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	46,967,667 - 46,967,854 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	47,287,579 - 47,287,765	NCBI	Rnor6.0
Rnor_5.0	1	48,590,678 - 48,590,864	UniSTS	Rnor5.0
RGSC_v3.4	1	41,177,902 - 41,178,088	UniSTS	RGSC3.4
Celera	1	42,655,238 - 42,655,424	UniSTS
RH 3.4 Map	1	541.1	UniSTS
Cytogenetic Map	1	q11	UniSTS

RH125205

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	46,970,865 - 46,971,872 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	47,290,777 - 47,291,783	NCBI	Rnor6.0
Rnor_5.0	1	48,593,876 - 48,594,882	UniSTS	Rnor5.0
RGSC_v3.4	1	41,181,100 - 41,182,106	UniSTS	RGSC3.4
Celera	1	42,658,436 - 42,659,442	UniSTS
Cytogenetic Map	1	q11	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	40	24	19	24			74	35	34	11
Low			17	17		17	8	11			7		8
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_019357	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF450298	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY428869	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC081958	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474077	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000016	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X67788	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000046746 ⟹ ENSRNOP00000046593

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	46,967,963 - 47,011,505 (-)	Ensembl
Rnor_6.0 Ensembl	1	47,287,874 - 47,331,412 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000090033 ⟹ ENSRNOP00000074514

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	46,967,658 - 46,988,735 (-)	Ensembl
Rnor_6.0 Ensembl	1	47,288,576 - 47,307,488 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000105371 ⟹ ENSRNOP00000076572

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	46,967,658 - 46,988,155 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000112255 ⟹ ENSRNOP00000087725

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	46,967,658 - 47,011,114 (-)	Ensembl

RefSeq Acc Id:

NM_019357 ⟹ NP_062230

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	1	46,967,961 - 47,011,505 (-)	NCBI
Rnor_6.0	1	47,287,872 - 47,331,412 (-)	NCBI
Rnor_5.0	1	48,590,971 - 48,634,511 (-)	NCBI
RGSC_v3.4	1	41,178,195 - 41,221,735 (-)	RGD
Celera	1	42,655,531 - 42,699,079 (-)	RGD

Sequence:

show sequence

CTGATGGAGGGGACGACTGCCTGTGCGCGGACTTGGGAGTCCCCACGCCTGAGGGACAGTGGAG
CTGAGCCCCCAGTGCAGCTCGAGCCGCTGCGCGACCCTCCGTCCACCCCTCCTGCGGGGGAGCG
TGGATCCCTTCCCGAAGCCAAGCGGAGCGCGGGCTGCACAGACACGCGCCCCCCTCCCGGCCGA
TCCCAATTTGTGAAGAAAAAGAAAAAAGAAGTGTTAAAAGATCCCGCGGTTGCGGTTTCGGCTC
TGGGGCAACGGTTGCTTCACGAAGTGAAACCTGCGGAGCGCTCGGGCGCGCGCGCCCGGCCCCG
CCCCGTCTGGGCGTGACAGCCTGGGACTGCCGGGCCAGTTCTTAAGCTCCGGACTGCGGAGCGC
GCGTAGGGCTTCCCTCCGCCTGCCGGTCCCGACGTGTCTCCGCCGTCGCCGCACAGCCGACTTA
CCGAGGACCCACGCAGAGCCACCAGCCAGCCAAGATGCCCAAGCCAATCAACGTCCGCGTGACC
ACCATGGATGCAGAGCTGGAGTTTGCCATCCAGCCAAACACCACCGGGAAGCAGCTCTTTGATC
AGGTGGTAAAGACCATTGGCCTCCGGGAAGTGTGGTACTTCGGCCTCCAGTATGTAGACAATAA
AGGATTTCCTACCTGGCTGAAACTTGATAAAAAGGTCTCTGCACAGGAGGTTCGAAAGGAGAAC
CCTGTCCAGTTCAAATTCCGGGCCAAGTTCTACCCCGAGGATGTGGCTGATGAGCTCATCCAGG
ACATCACACAGAAGCTCTTCTTCCTGCAAGTCAAGGAAGGGATCCTCAGCGATGAGATCTACTG
CCCCCCAGAGACAGCCGTGCTCCTGGGGTCCTATGCCGTTCAGGCCAAGTTCGGAGATTATAAC
AAGGAAATGCACAAGTCTGGGTACCTCAGCTCCGAGAGACTTATCCCTCAGAGAGTCATGGACC
AGCACAAGCTCAGCAGGGACCAGTGGGAGGACCGGATCCAGGTGTGGCACGCAGAACACCGAGG
GATGCTCAAGGACAGTGCTATGCTCGAATACCTGAAGATTGCCCAGGACCTGGAAATGTATGGG
ATCAACTATTTCGAGATCAAAAACAAGAAAGGAACAGATCTTTGGCTTGGAGTGGATGCCCTTG
GACTTAACATTTATGAGAAAGATGACAAGTTGACCCCGAAGATCGGCTTCCCTTGGAGTGAAAT
CAGGAACATCTCTTTCAACGACAAGAAGTTTGTCATCAAGCCCATCGACAAGAAGGCTCCTGAC
TTCGTGTTCTACGCTCCCCGCCTGAGAATTAACAAGCGGATTCTGCAGCTCTGCATGGGGAACC
ACGAGCTGTACATGCGCCGCAGGAAGCCCGACACCATCGAGGTGCAGCAGATGAAGGCCCAGGC
TCGGGAGGAGAAGCACCAGAAGCAGCTGGAGCGACAACAGTTGGAAACCGAGAAGAAGAGGAGA
GAAACTGTAGAGAGAGAAAAGGAACAGATGCTCCGGGAGAAGGAAGAGCTGATGCTTCGGCTGC
AGGACTTTGAGCAGAAGACCAAGAGGGCAGAGAAAGAGCTCTCCGAGCAGATTGAGAAGGCCCT
CCAGCTGGAGGAAGAGAGGAGGCGAGCCCAGGAGGAGGCTGAACGTCTGGAGGCCGACCGCATG
GCCGCCCTGCGGGCCAAGGAAGAACTGGAGAGACAGGCACAGGATCAGATAAAGAGCCAGGAGC
AGCTGGCTGCAGAGCTGGCAGAGTATACTGCCAAGATTGCCCTGCTGGAGGAGGCACGGAGGCG
CAAGGAGGACGAGGTGGAGGAGTGGCAGCACCGGGCTAAAGAGGCCCAGGACGACCTGGTGAAG
ACCAAAGAGGAGCTGCACCTGGTGATGACGGCTCCCCCGCCCCCACCCCCGCCCGTGTACGAGC
CCGTGAATTACCACGTGCAGGAGGGGCTGCAGGATGAGGGAGCAGAGCCCATGGGCTACAGTGC
CGAGCTCTCCAGCGAGGGCATCCTGGACGACCGTAACGAGGAGAAGCGGATCACCGAGGCAGAG
AAGAACGAGCGCGTGCAGCGGCAGCTGCTGACTCTGAGCAATGAGTTGTCCCAGGCCCGGGATG
AGAATAAGAGGACCCACAATGACATCATCCACAATGAGAACATGCGGCAAGGCCGGGACAAGTA
TAAGACGCTGCGGCAGATCAGGCAGGGCAACACCAAGCAGCGCATCGACGAGTTTGAGGCCATG
TAGAGGCCAGGCCGGGACCAAGGGCGGAGGGCACCTCACAGCAGGCAGGTGTCACTCTTGGCTC
TTTAGTACTCTATAAGTCTAGAAACCCCCTTGCCGTGTTCCAGTCCCTTAAAGAGCAGGTACCG
GGCGATGTTCTGCCCCAAGACCCAGTGGAATCCTCCCTGGTTGCTTCCAATAGTATCACATAGT
GCCAAACAGGCCAGATTTTTATGACAGTTGCCGAATCACTTCCCGTTCGGAGCAGGGATTCGGA
GGGCTGGCCCGAATGACGCGATTCAGTGTCACTGGGGATAATAATAGCACTGTGGCTCACACAC
GGGTGCCATACTTTCTCTAGTTTTACAATGAGCTCAAATCGATTTTGTTCTTGATTTCTATGAA
GGATCCATCTCTGTGTGTTGAGGGGTGAAAATGATTTTGAAATTTGAGTCTTAAAGGACGCCCC
CACACAGTCTCCTTCCTCCAGACCGCTGGCAGAGTCTCCTGCGGTCCCTCAGAGTGTACGGTAC
AGGACTCTCCGATACAAAATTCTCATGCTTACCCTGTTAGCATTCATTGTTGGACTGATACACC
TAATGATCTTCTATAGAGAATAGTATTTATATATAAGCGATAATATGGGTTTGTAACATTAGTT
TTAAAAAGGGAAAGTTTTGTTCTGTATATTTTGTTACCTTTTACAGAATAAAAGAATTCAACAT
TAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_062230	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH81958	(Get FASTA)	NCBI Sequence Viewer
	AAL47844	(Get FASTA)	NCBI Sequence Viewer
	AAR91694	(Get FASTA)	NCBI Sequence Viewer
	CAA48004	(Get FASTA)	NCBI Sequence Viewer
	EDL83712	(Get FASTA)	NCBI Sequence Viewer
	P31977	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_062230 ⟸ NM_019357

- UniProtKB:

Q66H97 (UniProtKB/Swiss-Prot), Q5WQV4 (UniProtKB/Swiss-Prot), Q8VHK3 (UniProtKB/Swiss-Prot), P31977 (UniProtKB/Swiss-Prot), A6KP14 (UniProtKB/TrEMBL), A0A8I5Y4R7 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLQYVDNKGFPTWLKLDKK
VSAQEVRKENPVQFKFRAKFYPEDVADELIQDITQKLFFLQVKEGILSDEIYCPPETAVLLGSY
AVQAKFGDYNKEMHKSGYLSSERLIPQRVMDQHKLSRDQWEDRIQVWHAEHRGMLKDSAMLEYL
KIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISFNDKKFV
IKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLER
QQLETEKKRRETVEREKEQMLREKEELMLRLQDFEQKTKRAEKELSEQIEKALQLEEERRRAQE
EAERLEADRMAALRAKEELERQAQDQIKSQEQLAAELAEYTAKIALLEEARRRKEDEVEEWQHR
AKEAQDDLVKTKEELHLVMTAPPPPPPPVYEPVNYHVQEGLQDEGAEPMGYSAELSSEGILDDR
NEEKRITEAEKNERVQRQLLTLSNELSQARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNT
KQRIDEFEAM

hide sequence

RefSeq Acc Id:

ENSRNOP00000074514 ⟸ ENSRNOT00000090033

RefSeq Acc Id:

ENSRNOP00000046593 ⟸ ENSRNOT00000046746

RefSeq Acc Id:

ENSRNOP00000076572 ⟸ ENSRNOT00000105371

RefSeq Acc Id:

ENSRNOP00000087725 ⟸ ENSRNOT00000112255

Protein Domains

FERM

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P31977-F1-model_v2	AlphaFold	P31977	1-586	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621161	AgrOrtholog
BioCyc Gene	G2FUF-61612	BioCyc
Ensembl Genes	ENSRNOG00000018524	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000046593	ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOP00000074514.2	UniProtKB/TrEMBL
	ENSRNOP00000076572.1	UniProtKB/TrEMBL
	ENSRNOP00000087725.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000046746	ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOT00000090033.2	UniProtKB/TrEMBL
	ENSRNOT00000105371.1	UniProtKB/TrEMBL
	ENSRNOT00000112255.1	UniProtKB/TrEMBL
Gene3D-CATH	1.20.5.450	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	1.20.80.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	2.30.29.30	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	6.10.360.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7124292	IMAGE-MGC_LOAD
InterPro	Band_41_domain	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ERM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ERM_C_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ERM_FERM_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ERM_helical	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ez/rad/moesin-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	FERM/acyl-CoA-bd_prot_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	FERM_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	FERM_central	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	FERM_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	FERM_domain	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	FERM_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	FERM_PH-like_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Moesin_tail_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PH-like_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ubiquitin-like_domsf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:54319	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:94076	IMAGE-MGC_LOAD
NCBI Gene	54319	ENTREZGENE
PANTHER	EZRIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR23281	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	ERM_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ERM_helical	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	FERM_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	FERM_M	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	FERM_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Ezr	PhenoGen
PIRSF	ERM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PRINTS	BAND41	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ERMFAMILY	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	FERM_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	FERM_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	FERM_3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	B41	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	FERM_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	PH domain-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF47031	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF48678	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF54236	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0G2K890_RAT	UniProtKB/TrEMBL
	A0A8I5Y4R7	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6A8I6_RAT	UniProtKB/TrEMBL
	A6KP14	ENTREZGENE, UniProtKB/TrEMBL
	EZRI_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q5WQV4	ENTREZGENE
	Q66H97	ENTREZGENE
	Q8VHK3	ENTREZGENE
UniProt Secondary	Q5WQV4	UniProtKB/Swiss-Prot
	Q66H97	UniProtKB/Swiss-Prot
	Q8VHK3	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-05-02	Ezr	ezrin	Vil2	villin 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	Vil2	villin 2			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Vil2	villin 2			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_process	may play an important role during development and differentiation of the intestinal epithelium	729995

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - PID (archival)