Symbol:
TOMM22
Name:
translocase of outer mitochondrial membrane 22
RGD ID:
1342792
HGNC Page
HGNC:18002
Description:
Enables mitochondrion targeting sequence binding activity. Involved in protein insertion into mitochondrial outer membrane. Located in membrane and mitochondrion. Part of mitochondrial outer membrane translocase complex.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
1C9-2; hTom22; mitochondrial import receptor subunit TOM22 homolog; mitochondrial import receptor Tom22; MST065; MSTP065; TOM22; translocase of outer membrane 22 kDa subunit homolog; translocase of outer mitochondrial membrane 22 homolog
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Tomm22 (translocase of outer mitochondrial membrane 22) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Tomm22 (translocase of outer mitochondrial membrane 22) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Chinchilla lanigera (long-tailed chinchilla):
Tomm22 (translocase of outer mitochondrial membrane 22) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
TOMM22 (translocase of outer mitochondrial membrane 22) NCBI
Ortholog
Canis lupus familiaris (dog):
TOMM22 (translocase of outer mitochondrial membrane 22) HGNC
Ensembl, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Tomm22 (translocase of outer mitochondrial membrane 22) NCBI
Ortholog
Sus scrofa (pig):
TOMM22 (translocase of outer mitochondrial membrane 22) HGNC
EggNOG, Ensembl, NCBI, OMA, OrthoDB, Panther, Treefam
Chlorocebus sabaeus (green monkey):
TOMM22 (translocase of outer mitochondrial membrane 22) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Tomm22 (translocase of outer mitochondrial membrane 22) NCBI
Ortholog
Other homologs 2
Sus scrofa (pig):
LOC100739656 (mitochondrial import receptor subunit TOM22 homolog) HGNC
OrthoDB, Panther
Canis lupus familiaris (dog):
LOC100855486 (mitochondrial import receptor subunit TOM22 homolog) HGNC
Ensembl
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Tomm22 (translocase of outer mitochondrial membrane 22)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Tomm22 (translocase of outer mitochondrial membrane 22)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
tomm22 (translocase of outer mitochondrial membrane 22 homolog (yeast))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Caenorhabditis elegans (roundworm):
tomm-22
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
mge
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
TOM22
Alliance
DIOPT (Ensembl Compara|PANTHER)
Xenopus tropicalis (tropical clawed frog):
tomm22
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Xenopus laevis (African clawed frog):
tomm22.L
Alliance
DIOPT (Xenbase)
Related Pseudogenes:
TOMM22P1
TOMM22P2
TOMM22P3
TOMM22P4
TOMM22P5
TOMM22P6
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 22 38,681,957 - 38,685,421 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 22 38,681,957 - 38,685,421 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 22 39,077,962 - 39,081,426 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 22 37,407,900 - 37,410,711 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 22 37,402,453 - 37,405,263 NCBI Celera 22 22,884,631 - 22,887,442 (+) NCBI Celera Cytogenetic Map 22 q13.1 NCBI HuRef 22 22,044,164 - 22,046,979 (+) NCBI HuRef CHM1_1 22 39,036,846 - 39,039,661 (+) NCBI CHM1_1 T2T-CHM13v2.0 22 39,152,160 - 39,155,628 (+) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
TOMM22 Human (1->4)-beta-D-glucan multiple interactions ISO Tomm22 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of TOMM22 mRNA CTD PMID:36331819 TOMM22 Human 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Tomm22 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 TOMM22 Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Tomm22 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of TOMM22 mRNA CTD PMID:21570461 TOMM22 Human 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Tomm22 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of TOMM22 mRNA CTD PMID:33387578 TOMM22 Human 2,6-dinitrotoluene affects expression ISO Tomm22 (Rattus norvegicus) 6480464 2 and 6-dinitrotoluene affects the expression of TOMM22 mRNA CTD PMID:21346803 TOMM22 Human 2-hydroxypropanoic acid decreases expression EXP 6480464 Lactic Acid results in decreased expression of TOMM22 mRNA CTD PMID:30851411 TOMM22 Human 3-chloropropane-1,2-diol increases expression ISO Tomm22 (Rattus norvegicus) 6480464 alpha-Chlorohydrin results in increased expression of TOMM22 protein CTD PMID:34915118 TOMM22 Human 4,4'-sulfonyldiphenol increases expression ISO Tomm22 (Mus musculus) 6480464 bisphenol S results in increased expression of TOMM22 mRNA CTD PMID:39298647 TOMM22 Human aconitine decreases expression ISO Tomm22 (Rattus norvegicus) 6480464 Aconitine results in decreased expression of TOMM22 protein CTD PMID:33236894 TOMM22 Human aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of TOMM22 mRNA CTD PMID:27153756 TOMM22 Human all-trans-retinoic acid decreases expression EXP 6480464 Tretinoin results in decreased expression of TOMM22 mRNA CTD PMID:33167477 TOMM22 Human arsane multiple interactions EXP 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of TOMM22 mRNA CTD PMID:39836092 TOMM22 Human arsenic atom multiple interactions EXP 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of TOMM22 mRNA CTD PMID:39836092 TOMM22 Human arsenite(3-) decreases expression ISO Tomm22 (Mus musculus) 6480464 arsenite results in decreased expression of TOMM22 mRNA CTD PMID:33053406 TOMM22 Human arsenite(3-) multiple interactions EXP 6480464 arsenite promotes the reaction [G3BP1 protein binds to TOMM22 mRNA] CTD PMID:32406909 TOMM22 Human atrazine decreases expression EXP 6480464 Atrazine results in decreased expression of TOMM22 mRNA CTD PMID:22378314 TOMM22 Human beauvericin multiple interactions EXP 6480464 [beauvericin co-treated with enniatins] results in decreased expression of TOMM22 protein CTD PMID:32407736 TOMM22 Human benzo[a]pyrene decreases expression ISO Tomm22 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of TOMM22 mRNA CTD PMID:27195522 TOMM22 Human benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of TOMM22 mRNA CTD PMID:20106945 TOMM22 Human bisphenol A increases expression ISO Tomm22 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of TOMM22 mRNA CTD PMID:25181051 TOMM22 Human bisphenol A affects methylation ISO Tomm22 (Mus musculus) 6480464 bisphenol A affects the methylation of TOMM22 promoter CTD PMID:27334623 TOMM22 Human chlorpyrifos increases expression ISO Tomm22 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of TOMM22 mRNA CTD PMID:37019170 TOMM22 Human clofibric acid multiple interactions ISO Tomm22 (Rattus norvegicus) 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of TOMM22 mRNA CTD PMID:17602206 TOMM22 Human cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of TOMM22 mRNA CTD PMID:19376846 TOMM22 Human coumarin increases phosphorylation EXP 6480464 coumarin results in increased phosphorylation of TOMM22 protein CTD PMID:35688186 TOMM22 Human DDE increases expression EXP 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of TOMM22 mRNA CTD PMID:38568856 TOMM22 Human deoxynivalenol decreases expression EXP 6480464 deoxynivalenol results in decreased expression of TOMM22 protein CTD PMID:33890134 TOMM22 Human dibutyl phthalate decreases expression ISO Tomm22 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of TOMM22 mRNA CTD PMID:17361019 and PMID:21266533 TOMM22 Human enniatin multiple interactions EXP 6480464 [beauvericin co-treated with enniatins] results in decreased expression of TOMM22 protein CTD PMID:32407736 TOMM22 Human ethyl methanesulfonate decreases expression EXP 6480464 Ethyl Methanesulfonate results in decreased expression of TOMM22 mRNA CTD PMID:23649840 TOMM22 Human flutamide increases expression ISO Tomm22 (Rattus norvegicus) 6480464 Flutamide results in increased expression of TOMM22 mRNA CTD PMID:24136188 TOMM22 Human FR900359 increases phosphorylation EXP 6480464 FR900359 results in increased phosphorylation of TOMM22 protein CTD PMID:37730182 TOMM22 Human furan increases methylation ISO Tomm22 (Rattus norvegicus) 6480464 furan results in increased methylation of TOMM22 gene CTD PMID:22079235 TOMM22 Human ivermectin decreases expression EXP 6480464 Ivermectin results in decreased expression of TOMM22 protein CTD PMID:32959892 TOMM22 Human manganese atom multiple interactions EXP 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of TOMM22 mRNA CTD PMID:39836092 TOMM22 Human manganese(0) multiple interactions EXP 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of TOMM22 mRNA CTD PMID:39836092 TOMM22 Human manganese(II) chloride multiple interactions EXP 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of TOMM22 mRNA CTD PMID:39836092 TOMM22 Human menadione affects expression EXP 6480464 Vitamin K 3 affects the expression of TOMM22 mRNA CTD PMID:20044591 TOMM22 Human methyl methanesulfonate decreases expression EXP 6480464 Methyl Methanesulfonate results in decreased expression of TOMM22 mRNA CTD PMID:23649840 TOMM22 Human N-nitrosodiethylamine multiple interactions ISO Tomm22 (Rattus norvegicus) 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of TOMM22 mRNA CTD PMID:17602206 TOMM22 Human paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of TOMM22 mRNA CTD PMID:22230336 and PMID:25704631 TOMM22 Human perfluorooctane-1-sulfonic acid multiple interactions ISO Tomm22 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of TOMM22 mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in increased expression of TOMM22 mRNA CTD PMID:36331819 TOMM22 Human quercetin decreases expression EXP 6480464 Quercetin results in decreased expression of TOMM22 mRNA CTD PMID:21632981 TOMM22 Human rac-lactic acid decreases expression EXP 6480464 Lactic Acid results in decreased expression of TOMM22 mRNA CTD PMID:30851411 TOMM22 Human resveratrol increases expression ISO Tomm22 (Mus musculus) 6480464 resveratrol results in increased expression of TOMM22 mRNA CTD PMID:22610192 TOMM22 Human SB 431542 multiple interactions EXP 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in decreased expression of TOMM22 protein CTD PMID:37664457 TOMM22 Human serpentine asbestos decreases expression EXP 6480464 Asbestos and Serpentine results in decreased expression of TOMM22 mRNA CTD PMID:21148743 TOMM22 Human sodium arsenite increases expression ISO Tomm22 (Mus musculus) 6480464 sodium arsenite results in increased expression of TOMM22 protein CTD PMID:29044176 TOMM22 Human sodium arsenite multiple interactions EXP 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of TOMM22 mRNA CTD PMID:39836092 TOMM22 Human sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of TOMM22 mRNA CTD PMID:34032870 TOMM22 Human sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of TOMM22 mRNA CTD PMID:38568856 TOMM22 Human Soman decreases expression ISO Tomm22 (Rattus norvegicus) 6480464 Soman results in decreased expression of TOMM22 mRNA CTD PMID:19281266 TOMM22 Human thiram decreases expression EXP 6480464 Thiram results in decreased expression of TOMM22 mRNA CTD PMID:38568856 TOMM22 Human trichloroethene decreases expression ISO Tomm22 (Rattus norvegicus) 6480464 Trichloroethylene results in decreased expression of TOMM22 mRNA CTD PMID:33387578 TOMM22 Human tungsten increases expression ISO Tomm22 (Mus musculus) 6480464 Tungsten results in increased expression of TOMM22 mRNA CTD PMID:30912803 TOMM22 Human tunicamycin decreases expression EXP 6480464 Tunicamycin results in decreased expression of TOMM22 mRNA CTD PMID:22378314 TOMM22 Human valproic acid decreases methylation EXP 6480464 Valproic Acid results in decreased methylation of TOMM22 gene CTD PMID:29154799
(1->4)-beta-D-glucan (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,6-dinitrotoluene (ISO) 2-hydroxypropanoic acid (EXP) 3-chloropropane-1,2-diol (ISO) 4,4'-sulfonyldiphenol (ISO) aconitine (ISO) aflatoxin B1 (EXP) all-trans-retinoic acid (EXP) arsane (EXP) arsenic atom (EXP) arsenite(3-) (EXP,ISO) atrazine (EXP) beauvericin (EXP) benzo[a]pyrene (EXP,ISO) bisphenol A (ISO) chlorpyrifos (ISO) clofibric acid (ISO) cobalt dichloride (EXP) coumarin (EXP) DDE (EXP) deoxynivalenol (EXP) dibutyl phthalate (ISO) enniatin (EXP) ethyl methanesulfonate (EXP) flutamide (ISO) FR900359 (EXP) furan (ISO) ivermectin (EXP) manganese atom (EXP) manganese(0) (EXP) manganese(II) chloride (EXP) menadione (EXP) methyl methanesulfonate (EXP) N-nitrosodiethylamine (ISO) paracetamol (EXP) perfluorooctane-1-sulfonic acid (ISO) quercetin (EXP) rac-lactic acid (EXP) resveratrol (ISO) SB 431542 (EXP) serpentine asbestos (EXP) sodium arsenite (EXP,ISO) Soman (ISO) thiram (EXP) trichloroethene (ISO) tungsten (ISO) tunicamycin (EXP) valproic acid (EXP)
1.
Biogenesis of mitochondrial outer membrane proteins, problems and diseases.
Ellenrieder L, etal., Biol Chem. 2015 Oct 1;396(11):1199-213. doi: 10.1515/hsz-2015-0170.
2.
GOAs Human GO annotations
GOA_HUMAN data from the GO Consortium
3.
Assembly of beta-barrel proteins in the mitochondrial outer membrane.
Hohr AI, etal., Biochim Biophys Acta. 2015 Jan;1853(1):74-88. doi: 10.1016/j.bbamcr.2014.10.006. Epub 2014 Oct 8.
4.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
6.
Unlocking the presequence import pathway.
Schulz C, etal., Trends Cell Biol. 2015 May;25(5):265-75. doi: 10.1016/j.tcb.2014.12.001. Epub 2014 Dec 23.
7.
Cooperation of protein machineries in mitochondrial protein sorting.
Wenz LS, etal., Biochim Biophys Acta. 2015 May;1853(5):1119-29. doi: 10.1016/j.bbamcr.2015.01.012. Epub 2015 Jan 26.
TOMM22 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 22 38,681,957 - 38,685,421 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 22 38,681,957 - 38,685,421 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 22 39,077,962 - 39,081,426 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 22 37,407,900 - 37,410,711 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 22 37,402,453 - 37,405,263 NCBI Celera 22 22,884,631 - 22,887,442 (+) NCBI Celera Cytogenetic Map 22 q13.1 NCBI HuRef 22 22,044,164 - 22,046,979 (+) NCBI HuRef CHM1_1 22 39,036,846 - 39,039,661 (+) NCBI CHM1_1 T2T-CHM13v2.0 22 39,152,160 - 39,155,628 (+) NCBI T2T-CHM13v2.0
Tomm22 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 15 79,555,069 - 79,557,063 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 15 79,555,062 - 79,557,601 (+) Ensembl GRCm39 Ensembl GRCm38 15 79,670,868 - 79,672,862 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 15 79,670,861 - 79,673,400 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 15 79,501,298 - 79,503,292 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 15 79,498,123 - 79,500,117 (+) NCBI MGSCv36 mm8 Celera 15 81,796,265 - 81,798,069 (+) NCBI Celera Cytogenetic Map 15 E1 NCBI cM Map 15 37.85 NCBI
Tomm22 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 113,103,863 - 113,109,056 (+) NCBI GRCr8 mRatBN7.2 7 111,223,508 - 111,228,671 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 111,216,571 - 111,246,799 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 112,974,658 - 112,976,408 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 115,198,199 - 115,199,949 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 115,167,574 - 115,169,324 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 120,901,934 - 120,903,684 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 120,901,934 - 120,903,684 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 120,888,909 - 120,894,057 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 117,913,211 - 117,914,961 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 117,947,453 - 117,948,603 (+) NCBI Celera 7 107,557,387 - 107,559,137 (+) NCBI Celera Cytogenetic Map 7 q34 NCBI
Tomm22 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955413 24,799,735 - 24,801,820 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955413 24,799,735 - 24,801,820 (+) NCBI ChiLan1.0 ChiLan1.0
TOMM22 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 23 48,537,569 - 48,540,122 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 22 51,228,944 - 51,231,496 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 22 19,596,941 - 19,599,499 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 22 37,414,704 - 37,417,229 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 22 37,414,704 - 37,417,229 (+) Ensembl panpan1.1 panPan2
TOMM22 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 10 26,116,635 - 26,118,692 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 10 26,072,167 - 26,074,221 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 10 26,907,763 - 26,909,817 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 10 26,907,769 - 26,909,795 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 10 26,629,429 - 26,631,481 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 10 26,940,542 - 26,942,596 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 10 27,117,431 - 27,119,486 (-) NCBI UU_Cfam_GSD_1.0
Tomm22 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 9,660,052 - 9,662,052 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936492 2,671,076 - 2,672,446 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936492 2,670,734 - 2,672,463 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
TOMM22 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 5 9,336,130 - 9,350,015 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 5 9,336,114 - 9,339,867 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 5 6,579,626 - 6,581,626 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TOMM22 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 19 21,344,846 - 21,347,709 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 19 21,344,865 - 21,347,264 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666045 104,411,154 - 104,414,022 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Tomm22
.
Predicted Target Of
Count of predictions: 723 Count of miRNA genes: 438 Interacting mature miRNAs: 474 Transcripts: ENST00000216034, ENST00000492561 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
406978375 GWAS627351_H hemoglobin measurement QTL GWAS627351 (human) 1e-14 hemoglobin measurement hemoglobin measurement (CMO:0000508) 22 38684633 38684634 Human
WI-20226
Human Assembly Chr Position (strand) Source JBrowse GRCh37 22 39,080,176 - 39,080,460 UniSTS GRCh37 Build 36 22 37,410,122 - 37,410,406 RGD NCBI36 Celera 22 22,886,853 - 22,887,137 RGD Cytogenetic Map 22 q12-q13 UniSTS HuRef 22 22,046,390 - 22,046,674 UniSTS GeneMap99-GB4 RH Map 22 131.23 UniSTS Whitehead-RH Map 22 129.9 UniSTS NCBI RH Map 22 154.0 UniSTS
RH17776
Human Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 22 q12-q13 UniSTS GeneMap99-GB4 RH Map 13 107.14 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1204
2439
2788
2253
4974
1726
2351
6
624
1951
465
2270
7306
6472
53
3734
1
852
1744
1617
175
1
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000216034 ⟹ ENSP00000216034
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 22 38,681,957 - 38,685,421 (+) Ensembl
Ensembl Acc Id:
ENST00000492561
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 22 38,682,172 - 38,684,160 (+) Ensembl
RefSeq Acc Id:
NM_020243 ⟹ NP_064628
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 22 38,681,957 - 38,685,421 (+) NCBI GRCh37 22 39,077,954 - 39,080,765 (+) RGD Build 36 22 37,407,900 - 37,410,711 (+) NCBI Archive Celera 22 22,884,631 - 22,887,442 (+) RGD HuRef 22 22,044,164 - 22,046,979 (+) RGD CHM1_1 22 39,036,846 - 39,039,661 (+) NCBI T2T-CHM13v2.0 22 39,152,160 - 39,155,628 (+) NCBI
Sequence:
GCTTCCGGTGTCCCCTACAGTCATGGCTGCCGCCGTCGCTGCTGCCGGTGCAGGGGAACCCCAGTCCCCGGACGAATTGCTCCCGAAAGGCGACGCGGAGAAGCCTGAGGAGGAGCTGGAGGAGGACG
hide sequence
RefSeq Acc Id:
NP_064628 ⟸ NM_020243
- UniProtKB:
Q9NS69 (UniProtKB/Swiss-Prot), Q549C5 (UniProtKB/TrEMBL), Q53GB0 (UniProtKB/TrEMBL)
- Sequence:
MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLGPNTGLS
hide sequence
Ensembl Acc Id:
ENSP00000216034 ⟸ ENST00000216034
RGD ID: 6800447 Promoter ID: HG_KWN:42831 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, CD4+TCell_12Hour, CD4+TCell_2Hour, HeLa_S3, Jurkat, K562, Lymphoblastoid, NB4 Transcripts: OTTHUMT00000320831, OTTHUMT00000320842, OTTHUMT00000320843, OTTHUMT00000321036, OTTHUMT00000321038 Position: Human Assembly Chr Position (strand) Source Build 36 22 37,407,681 - 37,408,181 (+) MPROMDB
RGD ID: 6850836 Promoter ID: EP73213 Type: initiation region Name: HS_TOMM22 Description: Translocase of outer mitochondrial membrane 22 homolog (yeast). SO ACC ID: SO:0000170 Source: EPD (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: NEDO full length human cDNA sequencing project.; Oligo-capping Position: Human Assembly Chr Position (strand) Source Build 36 22 37,407,926 - 37,407,986 EPD
RGD ID: 13604074 Promoter ID: EPDNEW_H28222 Type: initiation region Name: TOMM22_1 Description: translocase of outer mitochondrial membrane 22 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H28221 Experiment Methods: Single-end sequencing.; Paired-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 22 38,681,975 - 38,682,035 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-02-29
TOMM22
translocase of outer mitochondrial membrane 22
TOMM22
translocase of outer mitochondrial membrane 22 homolog (yeast)
Symbol and/or name change
5135510 APPROVED
