Advanced Search (OLGA)

Gene: Stam2 (signal transducing adaptor molecule 2) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Stam2

Name:

signal transducing adaptor molecule 2

RGD ID:

1311497

Description:

Predicted to enable phosphatidylinositol binding activity and ubiquitin binding activity. Predicted to be involved in signal transduction. Predicted to be located in cytosol and nucleoplasm. Predicted to be active in endocytic vesicle. Orthologous to human STAM2 (signal transducing adaptor molecule 2); PARTICIPATES IN interleukin-2 signaling pathway; endocytosis pathway; Jak-Stat signaling pathway; INTERACTS WITH 17alpha-ethynylestradiol; 3-chloropropane-1,2-diol; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC311030; signal transducing adapter molecule 2; signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM-2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	57,597,557 - 57,643,915 (-)	NCBI		GRCr8
mRatBN7.2	3	37,186,145 - 37,234,810 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	37,186,145 - 37,234,812 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	40,561,810 - 40,608,247 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	49,146,594 - 49,193,031 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	46,931,520 - 46,977,955 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	38,230,676 - 38,277,433 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	38,230,618 - 38,277,440 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	43,329,060 - 43,378,948 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	34,213,013 - 34,259,375 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	34,109,386 - 34,155,747 (-)	NCBI
Celera	3	35,327,231 - 35,373,439 (-)	NCBI		Celera
Cytogenetic Map	3	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Stam2	Rat	(-)-epigallocatechin 3-gallate	multiple interactions	ISO	STAM2 (Homo sapiens)	6480464	[potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of STAM2 mRNA	CTD	PMID:22079256
Stam2	Rat	1,2-dimethylhydrazine	decreases expression	ISO	Stam2 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in decreased expression of STAM2 mRNA	CTD	PMID:22206623
Stam2	Rat	17alpha-ethynylestradiol	increases expression	EXP		6480464	Ethinyl Estradiol results in increased expression of STAM2 mRNA	CTD	PMID:29097150
Stam2	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	Stam2 (Mus musculus)	6480464	[Tetrachlorodibenzodioxin co-treated with AHR gene mutant form] results in decreased expression of STAM2 mRNA	CTD	PMID:19465110
Stam2	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Stam2 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of STAM2 mRNA	CTD	PMID:21570461
Stam2	Rat	2-hydroxypropanoic acid	decreases expression	ISO	STAM2 (Homo sapiens)	6480464	Lactic Acid results in decreased expression of STAM2 mRNA	CTD	PMID:30851411
Stam2	Rat	3,4-methylenedioxymethamphetamine	increases expression	ISO	Stam2 (Mus musculus)	6480464	N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of STAM2 mRNA	CTD	PMID:20188158
Stam2	Rat	3-chloropropane-1,2-diol	increases expression	EXP		6480464	alpha-Chlorohydrin results in increased expression of STAM2 protein	CTD	PMID:34915118
Stam2	Rat	4,4'-diaminodiphenylmethane	increases expression	ISO	Stam2 (Mus musculus)	6480464	4 and 4'-diaminodiphenylmethane results in increased expression of STAM2 mRNA	CTD	PMID:18648102
Stam2	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	Stam2 (Mus musculus)	6480464	bisphenol S results in increased expression of STAM2 mRNA	CTD	PMID:39298647
Stam2	Rat	aflatoxin B1	decreases expression	ISO	Stam2 (Mus musculus)	6480464	Aflatoxin B1 results in decreased expression of STAM2 mRNA	CTD	PMID:19770486
Stam2	Rat	aflatoxin B1	increases methylation	ISO	STAM2 (Homo sapiens)	6480464	Aflatoxin B1 results in increased methylation of STAM2 gene	CTD	PMID:27153756
Stam2	Rat	aristolochic acid A	decreases expression	ISO	STAM2 (Homo sapiens)	6480464	aristolochic acid I results in decreased expression of STAM2 mRNA	CTD	PMID:33212167
Stam2	Rat	arsane	multiple interactions	ISO	STAM2 (Homo sapiens)	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in increased expression of STAM2 mRNA	CTD	PMID:39836092
Stam2	Rat	arsenic atom	multiple interactions	ISO	STAM2 (Homo sapiens)	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in increased expression of STAM2 mRNA	CTD	PMID:39836092
Stam2	Rat	arsenous acid	increases expression	ISO	STAM2 (Homo sapiens)	6480464	Arsenic Trioxide results in increased expression of STAM2 mRNA	CTD	PMID:24356939
Stam2	Rat	benzo[a]pyrene	increases expression	ISO	Stam2 (Mus musculus)	6480464	Benzo(a)pyrene results in increased expression of STAM2 mRNA	CTD	PMID:22228805
Stam2	Rat	benzo[a]pyrene	increases expression	ISO	STAM2 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased expression of STAM2 mRNA	CTD	PMID:26238291
Stam2	Rat	benzo[a]pyrene diol epoxide I	increases expression	ISO	STAM2 (Homo sapiens)	6480464	7 more ...	CTD	PMID:26238291
Stam2	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of STAM2 mRNA	CTD	PMID:25181051
Stam2	Rat	bisphenol A	decreases expression	ISO	Stam2 (Mus musculus)	6480464	bisphenol A results in decreased expression of STAM2 mRNA	CTD	PMID:33221593
Stam2	Rat	bisphenol A	multiple interactions	ISO	STAM2 (Homo sapiens)	6480464	[[ginger extract results in increased abundance of Oils and Volatile] which co-treated with bisphenol A] affects the expression of STAM2 protein	CTD	PMID:33376534
Stam2	Rat	calcitriol	increases expression	ISO	STAM2 (Homo sapiens)	6480464	Calcitriol results in increased expression of STAM2 mRNA	CTD	PMID:16002434
Stam2	Rat	CGP 52608	multiple interactions	ISO	STAM2 (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to STAM2 gene]	CTD	PMID:28238834
Stam2	Rat	chlorpyrifos	increases methylation	EXP		6480464	Chlorpyrifos results in increased methylation of STAM2 gene	CTD	PMID:32905263
Stam2	Rat	chlorpyrifos	decreases expression	ISO	Stam2 (Mus musculus)	6480464	Chlorpyrifos results in decreased expression of STAM2 mRNA	CTD	PMID:37019170
Stam2	Rat	cobalt dichloride	increases expression	ISO	STAM2 (Homo sapiens)	6480464	cobaltous chloride results in increased expression of STAM2 mRNA	CTD	PMID:19376846
Stam2	Rat	copper atom	multiple interactions	ISO	STAM2 (Homo sapiens)	6480464	[NSC 689534 binds to Copper] which results in increased expression of STAM2 mRNA	CTD	PMID:20971185
Stam2	Rat	copper(0)	multiple interactions	ISO	STAM2 (Homo sapiens)	6480464	[NSC 689534 binds to Copper] which results in increased expression of STAM2 mRNA	CTD	PMID:20971185
Stam2	Rat	copper(II) sulfate	increases expression	ISO	STAM2 (Homo sapiens)	6480464	Copper Sulfate results in increased expression of STAM2 mRNA	CTD	PMID:19549813
Stam2	Rat	cyclosporin A	increases expression	ISO	STAM2 (Homo sapiens)	6480464	Cyclosporine results in increased expression of STAM2 mRNA	CTD	PMID:20106945 and PMID:27989131
Stam2	Rat	diarsenic trioxide	increases expression	ISO	STAM2 (Homo sapiens)	6480464	Arsenic Trioxide results in increased expression of STAM2 mRNA	CTD	PMID:24356939
Stam2	Rat	dorsomorphin	multiple interactions	ISO	STAM2 (Homo sapiens)	6480464	[NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ...	CTD	PMID:27188386
Stam2	Rat	doxorubicin	decreases expression	ISO	STAM2 (Homo sapiens)	6480464	Doxorubicin results in decreased expression of STAM2 mRNA	CTD	PMID:29803840
Stam2	Rat	folic acid	decreases expression	ISO	Stam2 (Mus musculus)	6480464	Folic Acid results in decreased expression of STAM2 mRNA	CTD	PMID:25629700
Stam2	Rat	gamma-hexachlorocyclohexane	increases expression	ISO	STAM2 (Homo sapiens)	6480464	Hexachlorocyclohexane results in increased expression of STAM2 mRNA	CTD	PMID:24356939
Stam2	Rat	hyaluronic acid	decreases expression	EXP		6480464	Hyaluronic Acid analog results in decreased expression of STAM2 protein	CTD	PMID:23178681
Stam2	Rat	hydrogen peroxide	multiple interactions	ISO	STAM2 (Homo sapiens)	6480464	[Hydrogen Peroxide co-treated with Theophylline] results in increased expression of STAM2 protein	CTD	PMID:18951874
Stam2	Rat	hydrogen peroxide	decreases expression	EXP		6480464	Hydrogen Peroxide results in decreased expression of STAM2 protein	CTD	PMID:23178681
Stam2	Rat	mercury dibromide	increases expression	ISO	STAM2 (Homo sapiens)	6480464	mercuric bromide results in increased expression of STAM2 mRNA	CTD	PMID:26272509
Stam2	Rat	mercury dibromide	multiple interactions	ISO	STAM2 (Homo sapiens)	6480464	[NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of STAM2 mRNA	CTD	PMID:27188386
Stam2	Rat	methyl methanesulfonate	increases expression	ISO	STAM2 (Homo sapiens)	6480464	Methyl Methanesulfonate results in increased expression of STAM2 mRNA	CTD	PMID:23649840
Stam2	Rat	methylmercury chloride	decreases expression	ISO	STAM2 (Homo sapiens)	6480464	methylmercuric chloride results in decreased expression of STAM2 mRNA	CTD	PMID:28001369
Stam2	Rat	methylmercury chloride	increases expression	ISO	STAM2 (Homo sapiens)	6480464	methylmercuric chloride results in increased expression of STAM2 mRNA	CTD	PMID:28001369
Stam2	Rat	nickel atom	decreases expression	ISO	STAM2 (Homo sapiens)	6480464	Nickel results in decreased expression of STAM2 mRNA	CTD	PMID:23195993
Stam2	Rat	ochratoxin A	decreases expression	ISO	STAM2 (Homo sapiens)	6480464	ochratoxin A metabolite results in decreased expression of STAM2 mRNA and ochratoxin A results in decreased expression of STAM2 mRNA	CTD	PMID:19287073 and PMID:24356939
Stam2	Rat	ozone	multiple interactions	ISO	STAM2 (Homo sapiens)	6480464	[Air Pollutants results in increased abundance of Ozone] which affects the expression of STAM2 mRNA	CTD	PMID:35430440
Stam2	Rat	panobinostat	multiple interactions	ISO	STAM2 (Homo sapiens)	6480464	[NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of STAM2 mRNA	CTD	PMID:27188386
Stam2	Rat	paracetamol	increases expression	ISO	STAM2 (Homo sapiens)	6480464	Acetaminophen results in increased expression of STAM2 mRNA	CTD	PMID:21420995
Stam2	Rat	paraquat	increases expression	ISO	Stam2 (Mus musculus)	6480464	Paraquat results in increased expression of STAM2 mRNA	CTD	PMID:21371552
Stam2	Rat	phenylmercury acetate	increases expression	ISO	STAM2 (Homo sapiens)	6480464	Phenylmercuric Acetate results in increased expression of STAM2 mRNA	CTD	PMID:26272509
Stam2	Rat	phenylmercury acetate	multiple interactions	ISO	STAM2 (Homo sapiens)	6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of STAM2 mRNA	CTD	PMID:27188386
Stam2	Rat	pirinixic acid	increases expression	ISO	Stam2 (Mus musculus)	6480464	pirinixic acid results in increased expression of STAM2 mRNA	CTD	PMID:18301758
Stam2	Rat	potassium chromate	decreases expression	ISO	STAM2 (Homo sapiens)	6480464	potassium chromate(VI) results in decreased expression of STAM2 mRNA	CTD	PMID:22079256
Stam2	Rat	potassium chromate	multiple interactions	ISO	STAM2 (Homo sapiens)	6480464	[potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of STAM2 mRNA	CTD	PMID:22079256
Stam2	Rat	rac-lactic acid	decreases expression	ISO	STAM2 (Homo sapiens)	6480464	Lactic Acid results in decreased expression of STAM2 mRNA	CTD	PMID:30851411
Stam2	Rat	resveratrol	multiple interactions	ISO	STAM2 (Homo sapiens)	6480464	[Plant Extracts co-treated with Resveratrol] results in increased expression of STAM2 mRNA	CTD	PMID:23557933
Stam2	Rat	SB 431542	multiple interactions	ISO	STAM2 (Homo sapiens)	6480464	[NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ...	CTD	PMID:27188386
Stam2	Rat	sodium arsenite	increases expression	ISO	STAM2 (Homo sapiens)	6480464	sodium arsenite results in increased expression of STAM2 mRNA	CTD	PMID:38568856
Stam2	Rat	sodium arsenite	multiple interactions	ISO	STAM2 (Homo sapiens)	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in increased expression of STAM2 mRNA	CTD	PMID:39836092
Stam2	Rat	sodium fluoride	increases expression	ISO	Stam2 (Mus musculus)	6480464	Sodium Fluoride results in increased expression of STAM2 protein	CTD	PMID:28918527
Stam2	Rat	sunitinib	increases expression	ISO	STAM2 (Homo sapiens)	6480464	Sunitinib results in increased expression of STAM2 mRNA	CTD	PMID:31533062
Stam2	Rat	testosterone	decreases expression	ISO	STAM2 (Homo sapiens)	6480464	Testosterone results in decreased expression of STAM2 mRNA	CTD	PMID:33359661
Stam2	Rat	theophylline	multiple interactions	ISO	STAM2 (Homo sapiens)	6480464	[Hydrogen Peroxide co-treated with Theophylline] results in increased expression of STAM2 protein	CTD	PMID:18951874
Stam2	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of STAM2 mRNA	CTD	PMID:23411599 and PMID:34492290
Stam2	Rat	thiram	increases expression	ISO	STAM2 (Homo sapiens)	6480464	Thiram results in increased expression of STAM2 mRNA	CTD	PMID:38568856
Stam2	Rat	titanium dioxide	decreases methylation	ISO	Stam2 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of STAM2 promoter	CTD	PMID:35295148
Stam2	Rat	urethane	increases expression	ISO	STAM2 (Homo sapiens)	6480464	Urethane results in increased expression of STAM2 mRNA	CTD	PMID:28818685
Stam2	Rat	valproic acid	increases expression	ISO	STAM2 (Homo sapiens)	6480464	Valproic Acid results in increased expression of STAM2 mRNA	CTD	PMID:24383497 more ...
Stam2	Rat	valproic acid	multiple interactions	ISO	STAM2 (Homo sapiens)	6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of STAM2 mRNA	CTD	PMID:27188386

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Stam2	Rat	protein transport	involved_in	IEA	UniProtKB-KW:KW-0653	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Stam2	Rat	signal transduction	involved_in	IBA	PANTHER:PTN002914466 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Stam2	Rat	cytoplasm	located_in	IEA	ARBA:ARBA00026971	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Stam2	Rat	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Stam2	Rat	cytoplasm	located_in	IEA	UniProtKB:O75886 and ensembl:ENSP00000263904	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Stam2	Rat	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Stam2	Rat	cytoplasm	located_in	ISO	STAM2 (Homo sapiens)	1624291		RGD	GO_REF:0000054
Stam2	Rat	cytosol	located_in	ISO	STAM2 (Homo sapiens) and UniProtKB:O75886-1	1624291		RGD	GO_REF:0000052
Stam2	Rat	cytosol	located_in	IEA	UniProtKB:O75886 and ensembl:ENSP00000263904	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Stam2	Rat	early endosome membrane	located_in	IEA	UniProtKB-SubCell:SL-0093	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Stam2	Rat	endocytic vesicle	is_active_in	IBA	PANTHER:PTN002914466 and UniProtKB:O93436	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Stam2	Rat	endosome	located_in	IEA	UniProtKB-KW:KW-0967	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Stam2	Rat	intracellular membrane-bounded organelle	located_in	ISO	STAM2 (Homo sapiens) and UniProtKB:O75886-1	1624291		RGD	GO_REF:0000052
Stam2	Rat	intracellular membrane-bounded organelle	located_in	IEA	UniProtKB:O75886 and ensembl:ENSP00000263904	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Stam2	Rat	intracellular membrane-bounded organelle	located_in	IEA	ARBA:ARBA00029085	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Stam2	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Stam2	Rat	nucleoplasm	located_in	ISO	STAM2 (Homo sapiens) and UniProtKB:O75886-1	1624291		RGD	GO_REF:0000052
Stam2	Rat	nucleoplasm	located_in	IEA	UniProtKB:O75886 and ensembl:ENSP00000263904	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Stam2	Rat	phosphatidylinositol binding	enables	IEA	InterPro:IPR002014	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Stam2	Rat	protein binding	enables	ISO	STAM2 (Homo sapiens)	1624291	UniProtKB:A5D8V6 more ...	RGD	PMID:15231748 more ...
Stam2	Rat	protein binding	enables	ISO	Stam2 (Mus musculus)	1624291	PR:Q80U87 more ...	RGD	PMID:10982817 and PMID:16159959
Stam2	Rat	ubiquitin binding	enables	IEA	InterPro:IPR002014	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Stam2	Rat	endocytosis pathway		IEA		6907045		KEGG	rno:04144
Stam2	Rat	Jak-Stat signaling pathway		IEA		6907045		KEGG	rno:04630

Imported Annotations - PID (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Stam2	Rat	interleukin-2 signaling pathway		ISO	STAM2 (Homo sapiens)	6484113		PID	PID:200098

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
5.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
6.	GOA pipeline	RGD automated data pipeline
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:11062024	PMID:12477932	PMID:15489334

Stam2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	57,597,557 - 57,643,915 (-)	NCBI		GRCr8
mRatBN7.2	3	37,186,145 - 37,234,810 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	37,186,145 - 37,234,812 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	40,561,810 - 40,608,247 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	49,146,594 - 49,193,031 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	46,931,520 - 46,977,955 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	38,230,676 - 38,277,433 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	38,230,618 - 38,277,440 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	43,329,060 - 43,378,948 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	34,213,013 - 34,259,375 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	34,109,386 - 34,155,747 (-)	NCBI
Celera	3	35,327,231 - 35,373,439 (-)	NCBI		Celera
Cytogenetic Map	3	q12	NCBI

STAM2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	152,116,801 - 152,175,763 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	152,116,801 - 152,175,763 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	152,973,315 - 153,032,277 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	152,683,352 - 152,740,752 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	2	152,800,614 - 152,858,014	NCBI
Celera	2	146,587,981 - 146,647,203 (-)	NCBI		Celera
Cytogenetic Map	2	q23.3	NCBI
HuRef	2	144,859,495 - 144,918,505 (-)	NCBI		HuRef
CHM1_1	2	152,979,182 - 153,038,398 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	2	152,568,772 - 152,627,796 (-)	NCBI		T2T-CHM13v2.0

Stam2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	52,582,213 - 52,632,212 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	52,581,676 - 52,632,293 (-)	Ensembl		GRCm39 Ensembl
GRCm38	2	52,692,206 - 52,742,149 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	52,691,664 - 52,742,281 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	52,547,725 - 52,601,183 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	52,514,215 - 52,564,158 (-)	NCBI		MGSCv36	mm8
Celera	2	54,422,788 - 54,476,181 (-)	NCBI		Celera
Cytogenetic Map	2	C1.1	NCBI
cM Map	2	30.41	NCBI

Stam2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955440	17,607,593 - 17,653,140 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955440	17,611,656 - 17,653,140 (-)	NCBI	ChiLan1.0	ChiLan1.0

STAM2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	13	54,800,956 - 54,860,293 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2B	54,815,936 - 54,875,241 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2B	39,416,452 - 39,475,861 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2B	156,656,386 - 156,715,402 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2B	156,656,386 - 156,715,402 (-)	Ensembl	panpan1.1		panPan2

STAM2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	19	53,213,904 - 53,256,711 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	19	53,216,274 - 53,256,756 (-)	NCBI	CanFam3.1		canFam3	CanFam3.1
CanFam3.1 Ensembl	19	53,216,274 - 53,256,756 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	26	28,400,408 - 28,445,085 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	19	54,723,824 - 54,768,716 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	19	54,723,828 - 54,768,179 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	19	53,440,262 - 53,484,908 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	19	53,510,688 - 53,555,731 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	19	54,974,715 - 55,019,344 (-)	NCBI		UU_Cfam_GSD_1.0

Stam2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	116,135,645 - 116,190,942 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936469	25,431,917 - 25,482,347 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936469	25,432,067 - 25,481,089 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

STAM2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	15	115,404 - 168,657 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	15	115,297 - 168,659 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	15	157,393,889 - 157,424,041 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

STAM2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	10	37,536,164 - 37,591,850 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	10	37,539,082 - 37,591,869 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666040	161,963,224 - 162,018,541 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Stam2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624866	4,909,479 - 4,962,691 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Stam2
267 total Variants

Assembly: Rnor_5.0

Chromosome	Start Pos	End Pos	Reference Nucleotide	Variant Nucleotide	Variant Type	Strain	Variant Page
3	43342176	43342177	G	A	snv	IS-Tlk/Kyo (KyushuU), IS/Kyo (KyushuU)	View more Information

Predicted Target Of

	Summary Value
Count of predictions:	68
Count of miRNA genes:	59
Interacting mature miRNAs:	63
Transcripts:	ENSRNOT00000037857
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2302055	Pia30	Pristane induced arthritis QTL 30	3.5	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111)	3	27936919	72936919	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
1354589	Bw31	Body weight QTL 31	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	3	33703347	78196190	Rat
1298073	Cm13	Cardiac mass QTL 13	2.5		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	25013911	38192233	Rat
2303593	Gluco46	Glucose level QTL 46	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	28468571	73468571	Rat
1354590	Despr11	Despair related QTL 11		0.000031	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	3	28468571	73468571	Rat
10401810	Kidm53	Kidney mass QTL 53			kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	8227194	47233430	Rat
2298542	Neuinf11	Neuroinflammation QTL 11	3.9		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	3	15005422	76927699	Rat
631832	Sach1	Saccharin preference QTL 1	2.7	0.02	consumption behavior trait (VT:0002069)	calculated saccharin drink intake volume (CMO:0001600)	3	27494621	44188411	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	29463235	118376539	Rat
2313079	Bss73	Bone structure and strength QTL 73	1.5		tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	3	27494621	50302886	Rat
631647	Bp122	Blood pressure QTL 122	6.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	30684642	75684642	Rat
2313076	Bss74	Bone structure and strength QTL 74	2	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	3	27494621	50302886	Rat
631568	Bp92	Blood pressure QTL 92	2.2	0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	1	39874793	Rat
1300169	Bp177	Blood pressure QTL 177	2.96		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	3	33703347	61017857	Rat
9590286	Uminl1	Urine mineral level QTL 1	3.5	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	3	28249687	73249687	Rat
2313093	Bmd77	Bone mineral density QTL 77	2.2	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	3	27494621	50302886	Rat
12879852	Cm93	Cardiac mass QTL 93		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	3	18311454	47233430	Rat
12879853	Am5	Aortic mass QTL 5		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	3	18311454	47233430	Rat
12879854	Kidm63	Kidney mass QTL 63		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	18311454	47233430	Rat
9590136	Scort3	Serum corticosterone level QTL 3	23.37	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	28249687	73249687	Rat
10450804	Scl70	Serum cholesterol level QTL 70	4.7	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	20714090	65714090	Rat
61419	Cia11	Collagen induced arthritis QTL 11	5.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	3	30356773	98535386	Rat
61356	Bp37	Blood pressure QTL 37	3		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	3	30684642	75684642	Rat
1358905	Hrtrt17	Heart rate QTL 17	5.9	0.000014	heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	10861912	89878372	Rat
12879849	Bw180	Body weight QTL 180		0.037	body mass (VT:0001259)	body weight (CMO:0000012)	3	18311454	47233430	Rat
70191	BpQTLcluster4	Blood pressure QTL cluster 4	3		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	3	10778704	50302886	Rat
12879850	Cm91	Cardiac mass QTL 91		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	3	18311454	47233430	Rat
2313101	Bmd76	Bone mineral density QTL 76	3.6	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	3	27494621	50302886	Rat
731172	Bp151	Blood pressure QTL 151		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	18311454	47233430	Rat
12879851	Cm92	Cardiac mass QTL 92		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	18311454	47233430	Rat
8694196	Abfw2	Abdominal fat weight QTL 2	16.58	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	3	28249687	73249687	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
8552950	Pigfal12	Plasma insulin-like growth factor 1 level QTL 12	7.3		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	3	28249687	73249687	Rat
631676	Cm8	Cardiac mass QTL 8	7.03	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	3	16954708	61954708	Rat
10450794	Scl69	Serum cholesterol level QTL 69	6.3	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	20714090	65714090	Rat
2290452	Scl56	Serum cholesterol level QTL 56	2.26		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	3	1	91609953	Rat
8694386	Bw159	Body weight QTL 159	4.52	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	3	28249687	73249687	Rat
12879868	Am6	Aortic mass QTL 6		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	3	31426403	70668733	Rat
1354604	Bw36	Body weight QTL 36	2.9		body mass (VT:0001259)	body weight (CMO:0000012)	3	33703347	104104347	Rat
2313049	Bss72	Bone structure and strength QTL 72	2.6	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	3	27494621	50302886	Rat
2312664	Scl62	Serum cholesterol level QTL 62		0.05	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	1	38710544	Rat
11565451	Bw177	Body weight QTL 177		0.002	body mass (VT:0001259)	body weight (CMO:0000012)	3	31426403	70668733	Rat
2301400	Cm68	Cardiac mass QTL 68		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	3	31426403	70668733	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
11565452	Kidm57	Kidney mass QTL 57		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	31426403	70668733	Rat
12879866	Cm94	Cardiac mass QTL 94		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	31426403	70668733	Rat
12879867	Cm95	Cardiac mass QTL 95		0.047	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	3	31426403	70668733	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001012085	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC083912	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473983	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000037857 ⟹ ENSRNOP00000033318

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	37,190,550 - 37,234,812 (-)	Ensembl
Rnor_6.0 Ensembl	3	38,230,618 - 38,277,440 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000096856 ⟹ ENSRNOP00000078966

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	37,186,145 - 37,231,683 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000105399 ⟹ ENSRNOP00000077773

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	37,186,145 - 37,212,770 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000115523 ⟹ ENSRNOP00000080484

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	37,186,145 - 37,234,783 (-)	Ensembl

RefSeq Acc Id:

NM_001012085 ⟹ NP_001012085

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	57,597,557 - 57,643,915 (-)	NCBI
mRatBN7.2	3	37,188,444 - 37,234,810 (-)	NCBI
Rnor_6.0	3	38,230,676 - 38,277,433 (-)	NCBI
Rnor_5.0	3	43,329,060 - 43,378,948 (-)	NCBI
RGSC_v3.4	3	34,213,013 - 34,259,375 (-)	RGD
Celera	3	35,327,231 - 35,373,439 (-)	RGD

Sequence:

show sequence

GAAGGCACGGCTCGGCCAAGCGGTCTAGGAAGCCGCGGCCGGTCGCCCAGCGGGGGCAGTCGGAACCCCGCCAGACCGTCGGGATTCAGCTCCCGTTGCCGGCGCAATGCCTCTGTTCACTGCCAACC
CATTCGAGCAAGATGTGGAAAAAGCCACAAACGAGTACAACACCACAGAAGACTGGAGTCTGATCATGGACATCTGTGACAGGGTTGGAAGCACTCCCAATGGAGCAAAGGATTGCCTAAAAGCTATA
ATGAAAAGGGTAAACCATAAGGTCCCTCATGTTGCTCTGCAGGCATTAACTCTTCTTGGAGCTTGTGTGGCAAACTGTGGAAAGATATTTCATTTAGAAGTATGTTCCCGTGATTTTGCAACAGAAGT
ACGTGCTGTGATAAAAAATAAGGCTCATCCTAAAGTATGTGAAAAACTGAAATCTCTAATGGTAGAATGGTCAGAAGAATTCCAGAAGGACCCCCAATTTAGTCTGATATCTGCAACTATTAAGGCTA
TGAAAGAAGAAGGAGTTACTTTTCCTTCAGCAGGTTCCCAGACTGTCTCGGCTGCTGCCAAAAACGGGGCATCACTGAACAAAAACAAAGAAGACGAGGACATAGCTAAAGCTATTGAGTTATCGTTG
CAAGAGCAGAAGCAGCAGTACCCGGAGACGAAGGCTCTGTGTCCACCCGCAGAGAGCCAGTTGAGTAATAAGGTTGCACGGAGAGTTAGAGCTCTATACGACTTTGAGGCCGTTGAGGACAACGAGCT
CACCTTTAAACACGGCGAGATTATTACTGTTTTGGATGACAGTGATGCCAACTGGTGGGAAGGAGAAAATCACAGAGGAGCAGGACTCTTCCCCTCCAGCTTCGTAACGACTGATTTAAGCACCGAGG
TTGAGGCGGCAACAGTGGACAAATCGAATGTAATTGATGACGATGTGGAGGAAATTAAGAAGTCGGAACCTGAGCCTGTTTATATAGATGAGGGTAAAATGGACCGAGCCCTGCAGATTCTCCAGAGC
ATAGACCCAAAAGATCCAAAACCCGACTCCCAGGACCTCTTAGACTTGGAAGATATTTGCCAACAGATGGGTCCAATGATAGATGAAAAACTTGAAGAAATTGATAGGAGGCACTCAGAGCTGTCGGA
GCTGAACGTAAAGGTGCTGGAGGCCCTGGAGCTGTACAACAAATTGGTCAATGAAGCGCCCATGTACTCAGTCTATTCGAAGCTCCACCCGGCTCCTTACTCAGCCACAGCAGCTGGGGTTCCAGTGC
AGACATACCCAGTCCAGTCGCATGGTGGGAACTACCTGGGTCATGGCATTCACCAAGTACCTGTTGCCCAGAGCTATAACCTAGGACCTGATCCTATGGGCTCATCGAGGTCTCTGCCTCCAAATATG
AACTCAGTAACAGCACACACCATCCAACCTCCATATTTAAGCACTGGACAGGACGCTGTCTCCAACCCTTCTTACATGACCCAGAGCTCTCATCTTCAGGCAGCTGCTGGGACAGCTGCTTACACACC
AGCCATGGGGGTGTCTGCAGACCTGTCCTCTTTCCAGAGCACAGCATCCGGTTTGCCTCAGCTGGCTGGCTTTCCAGTGGCAGTTCCTGTACCTCCAGCCCCACAGCCACAAGCAAGTTACCACCAGC
AGCCACTCCTTTAGAGACACACCAGGACCTGCTGAACGGCTTCGTGGGTGTGCCACTTAACCCAGGGGATTCTAATCTGAAATAGTAAAAGTTTCCCCTCTCAGTCAAAAAGAACCATAAGTAAATAA
AGCACAAAACCCCACCTTACCCTGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence


Protein RefSeqs	NP_001012085	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH83912	(Get FASTA)	NCBI Sequence Viewer
	EDM00431	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000080484
	ENSRNOP00000080484.1
GenBank Protein	Q5XHY7	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001012085 ⟸ NM_001012085

- UniProtKB:

Q5XHY7 (UniProtKB/Swiss-Prot), A6JF29 (UniProtKB/TrEMBL), A0A8I5ZKD5 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MPLFTANPFEQDVEKATNEYNTTEDWSLIMDICDRVGSTPNGAKDCLKAIMKRVNHKVPHVALQALTLLGACVANCGKIFHLEVCSRDFATEVRAVIKNKAHPKVCEKLKSLMVEWSEEFQKDPQFSL
ISATIKAMKEEGVTFPSAGSQTVSAAAKNGASLNKNKEDEDIAKAIELSLQEQKQQYPETKALCPPAESQLSNKVARRVRALYDFEAVEDNELTFKHGEIITVLDDSDANWWEGENHRGAGLFPSSFV
TTDLSTEVEAATVDKSNVIDDDVEEIKKSEPEPVYIDEGKMDRALQILQSIDPKDPKPDSQDLLDLEDICQQMGPMIDEKLEEIDRRHSELSELNVKVLEALELYNKLVNEAPMYSVYSKLHPAPYSA
TAAGVPVQTYPVQSHGGNYLGHGIHQVPVAQSYNLGPDPMGSSRSLPPNMNSVTAHTIQPPYLSTGQDAVSNPSYMTQSSHLQAAAGTAAYTPAMGVSADLSSFQSTASGLPQLAGFPVAVPVPPAPQ
PQASYHQQPLL

hide sequence

Ensembl Acc Id:

ENSRNOP00000033318 ⟸ ENSRNOT00000037857

Ensembl Acc Id:

ENSRNOP00000077773 ⟸ ENSRNOT00000105399

Ensembl Acc Id:

ENSRNOP00000078966 ⟸ ENSRNOT00000096856

Ensembl Acc Id:

ENSRNOP00000080484 ⟸ ENSRNOT00000115523

Protein Domains

ITAM SH3 UIM VHS

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5XHY7-F1-model_v2	AlphaFold	Q5XHY7	1-523	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13692077

Promoter ID:

EPDNEW_R2602

Type:

initiation region

Name:

Stam2_1

Description:

signal transducing adaptor molecule 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	38,277,405 - 38,277,465	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-49724	BioCyc
Ensembl Genes	ENSRNOG00000027447	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000115523	ENTREZGENE
	ENSRNOT00000115523.1	UniProtKB/Swiss-Prot
Gene3D-CATH	1.20.5.1940	UniProtKB/Swiss-Prot
	1.25.40.90	UniProtKB/Swiss-Prot
	SH3 Domains	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7134287	IMAGE-MGC_LOAD
InterPro	ENTH_VHS	UniProtKB/Swiss-Prot
	SH3-like_dom_sf	UniProtKB/Swiss-Prot
	SH3_domain	UniProtKB/Swiss-Prot
	STAM	UniProtKB/Swiss-Prot
	STAM2_SH3	UniProtKB/Swiss-Prot
	UIM_dom	UniProtKB/Swiss-Prot
	VHS_dom	UniProtKB/Swiss-Prot
	VHS_STAM2	UniProtKB/Swiss-Prot
KEGG Report	rno:311030	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:95283	IMAGE-MGC_LOAD
NCBI Gene	311030	ENTREZGENE
PANTHER	HEMATOPOIETIC LINEAGE CELL-SPECIFIC PROTEIN-RELATED	UniProtKB/Swiss-Prot
	JAK PATHWAY SIGNAL TRANSDUCTION ADAPTOR MOLECULE	UniProtKB/Swiss-Prot
Pfam	SH3_1	UniProtKB/Swiss-Prot
	UIM	UniProtKB/Swiss-Prot
	VHS	UniProtKB/Swiss-Prot
PhenoGen	Stam2	PhenoGen
PRINTS	P67PHOX	UniProtKB/Swiss-Prot
	SH3DOMAIN	UniProtKB/Swiss-Prot
PROSITE	SH3	UniProtKB/Swiss-Prot
	UIM	UniProtKB/Swiss-Prot
	VHS	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000027447	RatGTEx
SMART	SH3	UniProtKB/Swiss-Prot
	UIM	UniProtKB/Swiss-Prot
	VHS	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF48464	UniProtKB/Swiss-Prot
	SSF50044	UniProtKB/Swiss-Prot
UniProt	A0A8I5ZKD5	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I5ZM09_RAT	UniProtKB/TrEMBL
	A0A8L2QH95_RAT	UniProtKB/TrEMBL
	A6JF29	ENTREZGENE, UniProtKB/TrEMBL
	Q5XHY7	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-11-25	Stam2	signal transducing adaptor molecule 2	Stam2	signal transducing adaptor molecule (SH3 domain and ITAM motif) 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Stam2	signal transducing adaptor molecule (SH3 domain and ITAM motif) 2	Stam2_predicted	signal transducing adaptor molecule (SH3 domain and ITAM motif) 2 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Stam2_predicted	signal transducing adaptor molecule (SH3 domain and ITAM motif) 2 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)