Symbol:
Tchp
Name:
trichoplein, keratin filament binding
RGD ID:
1310813
Description:
Predicted to be involved in apoptotic process; negative regulation of cell growth; and negative regulation of cilium assembly. Predicted to be located in several cellular components, including apical cortex; microtubule organizing center; and nuclear membrane. Predicted to be part of ciliary transition fiber. Predicted to be active in keratin filament. Orthologous to human TCHP (trichoplein keratin filament binding); INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC304547; RGD1310813; similar to hypothetical protein MGC10854; trichoplein keratin filament-binding protein
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
TCHP (trichoplein keratin filament binding) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Tchp (trichoplein, keratin filament binding) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Tchp (trichoplein keratin filament binding) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
TCHP (trichoplein keratin filament binding) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
TCHP (trichoplein keratin filament binding) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Tchp (trichoplein keratin filament binding) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
TCHP (trichoplein keratin filament binding) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
TCHP (trichoplein keratin filament binding) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Tchp (trichoplein keratin filament binding) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
MEDAG (mesenteric estrogen dependent adipogenesis) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Tchp (trichoplein, keratin filament binding)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
TCHP (trichoplein keratin filament binding)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
tchp (trichoplein, keratin filament binding)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG17230
Alliance
DIOPT (Hieranoid|OMA|PANTHER)
Xenopus tropicalis (tropical clawed frog):
tchp
Alliance
DIOPT (OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 47,538,520 - 47,553,895 (-) NCBI GRCr8 mRatBN7.2 12 41,877,888 - 41,893,264 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 41,877,889 - 41,892,427 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 43,045,433 - 43,059,937 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 43,659,011 - 43,673,515 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 42,719,503 - 42,734,009 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 47,638,278 - 47,653,602 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 47,638,274 - 47,653,638 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 49,431,571 - 49,446,355 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 43,165,998 - 43,180,692 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 43,030,449 - 43,050,917 (-) NCBI Celera 12 43,493,579 - 43,506,170 (-) NCBI Celera Cytogenetic Map 12 q16 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Tchp Rat 1,1-dichloroethene increases expression ISO Tchp (Mus musculus) 6480464 vinylidene chloride results in increased expression of TCHP mRNA CTD PMID:26682919 Tchp Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of TCHP mRNA CTD PMID:29097150 Tchp Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Tchp (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Tchp Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Tchp (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Tchp Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of TCHP mRNA CTD PMID:33387578 Tchp Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of TCHP mRNA CTD PMID:21346803 Tchp Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of TCHP mRNA CTD PMID:21346803 Tchp Rat 2-hydroxypropanoic acid decreases expression ISO TCHP (Homo sapiens) 6480464 Lactic Acid results in decreased expression of TCHP mRNA CTD PMID:30851411 Tchp Rat acrolein multiple interactions ISO TCHP (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of TCHP mRNA more ... CTD PMID:32699268 and PMID:32845096 Tchp Rat acrylamide decreases expression ISO TCHP (Homo sapiens) 6480464 Acrylamide results in decreased expression of TCHP mRNA CTD PMID:32763439 Tchp Rat aflatoxin B1 increases expression ISO Tchp (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of TCHP mRNA CTD PMID:19770486 Tchp Rat all-trans-retinoic acid decreases expression ISO TCHP (Homo sapiens) 6480464 Tretinoin results in decreased expression of TCHP mRNA CTD PMID:33167477 Tchp Rat alpha-pinene multiple interactions ISO TCHP (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of TCHP mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of TCHP mRNA CTD PMID:32699268 Tchp Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of TCHP mRNA CTD PMID:30779732 Tchp Rat aristolochic acid A decreases expression ISO TCHP (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of TCHP mRNA CTD PMID:33212167 Tchp Rat arsenite(3-) multiple interactions ISO TCHP (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to TCHP mRNA] CTD PMID:32406909 Tchp Rat atrazine decreases expression ISO TCHP (Homo sapiens) 6480464 Atrazine results in decreased expression of TCHP mRNA CTD PMID:22378314 Tchp Rat benzo[a]pyrene multiple interactions ISO Tchp (Mus musculus) 6480464 AHR protein affects the reaction [Benzo(a)pyrene affects the expression of TCHP mRNA] CTD PMID:22228805 Tchp Rat benzo[a]pyrene decreases methylation ISO TCHP (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of TCHP promoter CTD PMID:27901495 Tchp Rat bis(2-ethylhexyl) phthalate increases expression ISO Tchp (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of TCHP mRNA CTD PMID:34319233 Tchp Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of TCHP mRNA CTD PMID:25181051 Tchp Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of TCHP mRNA CTD PMID:30816183 more ... Tchp Rat bisphenol F decreases expression ISO Tchp (Mus musculus) 6480464 bisphenol F results in decreased expression of TCHP mRNA CTD PMID:38685157 Tchp Rat cadmium atom multiple interactions ISO TCHP (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of TCHP mRNA CTD PMID:35301059 Tchp Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of TCHP mRNA CTD PMID:33453195 Tchp Rat cadmium dichloride multiple interactions ISO TCHP (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of TCHP mRNA CTD PMID:35301059 Tchp Rat caffeine decreases phosphorylation ISO TCHP (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of TCHP protein CTD PMID:35688186 Tchp Rat copper(II) sulfate decreases expression ISO TCHP (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of TCHP mRNA CTD PMID:19549813 Tchp Rat dextran sulfate increases expression ISO Tchp (Mus musculus) 6480464 Dextran Sulfate results in increased expression of TCHP mRNA CTD PMID:35093514 Tchp Rat leflunomide decreases expression ISO TCHP (Homo sapiens) 6480464 leflunomide results in decreased expression of TCHP mRNA CTD PMID:28988120 Tchp Rat methotrexate decreases expression ISO TCHP (Homo sapiens) 6480464 Methotrexate results in decreased expression of TCHP mRNA CTD PMID:24449571 Tchp Rat ozone multiple interactions ISO TCHP (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of TCHP mRNA more ... CTD PMID:32699268 and PMID:32845096 Tchp Rat PCB138 multiple interactions ISO Tchp (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Tchp Rat perfluorohexanesulfonic acid decreases expression ISO TCHP (Homo sapiens) 6480464 perfluorohexanesulfonic acid results in decreased expression of TCHP mRNA CTD PMID:25812627 Tchp Rat perfluorononanoic acid decreases expression ISO TCHP (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in decreased expression of TCHP mRNA CTD PMID:25812627 Tchp Rat perfluorooctane-1-sulfonic acid decreases expression ISO TCHP (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in decreased expression of TCHP mRNA CTD PMID:25812627 Tchp Rat perfluorooctanoic acid decreases expression ISO TCHP (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of TCHP mRNA CTD PMID:25812627 Tchp Rat pirinixic acid multiple interactions ISO Tchp (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of TCHP mRNA CTD PMID:19710929 Tchp Rat rac-lactic acid decreases expression ISO TCHP (Homo sapiens) 6480464 Lactic Acid results in decreased expression of TCHP mRNA CTD PMID:30851411 Tchp Rat titanium dioxide increases expression ISO Tchp (Mus musculus) 6480464 titanium dioxide results in increased expression of TCHP mRNA CTD PMID:23131501 Tchp Rat titanium dioxide decreases methylation ISO Tchp (Mus musculus) 6480464 titanium dioxide results in decreased methylation of TCHP gene CTD PMID:35295148 Tchp Rat triphenyl phosphate affects expression ISO TCHP (Homo sapiens) 6480464 triphenyl phosphate affects the expression of TCHP mRNA CTD PMID:37042841 Tchp Rat valproic acid affects expression ISO TCHP (Homo sapiens) 6480464 Valproic Acid affects the expression of TCHP mRNA CTD PMID:25979313
1,1-dichloroethene (ISO) 17alpha-ethynylestradiol (EXP) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 2-hydroxypropanoic acid (ISO) acrolein (ISO) acrylamide (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) amphetamine (EXP) aristolochic acid A (ISO) arsenite(3-) (ISO) atrazine (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP) bisphenol F (ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) caffeine (ISO) copper(II) sulfate (ISO) dextran sulfate (ISO) leflunomide (ISO) methotrexate (ISO) ozone (ISO) PCB138 (ISO) perfluorohexanesulfonic acid (ISO) perfluorononanoic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) pirinixic acid (ISO) rac-lactic acid (ISO) titanium dioxide (ISO) triphenyl phosphate (ISO) valproic acid (ISO)
Tchp Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 47,538,520 - 47,553,895 (-) NCBI GRCr8 mRatBN7.2 12 41,877,888 - 41,893,264 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 41,877,889 - 41,892,427 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 43,045,433 - 43,059,937 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 43,659,011 - 43,673,515 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 42,719,503 - 42,734,009 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 47,638,278 - 47,653,602 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 47,638,274 - 47,653,638 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 49,431,571 - 49,446,355 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 43,165,998 - 43,180,692 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 43,030,449 - 43,050,917 (-) NCBI Celera 12 43,493,579 - 43,506,170 (-) NCBI Celera Cytogenetic Map 12 q16 NCBI
TCHP Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 109,880,667 - 109,918,069 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 109,900,264 - 109,983,841 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 110,338,079 - 110,355,874 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 108,822,706 - 108,840,251 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 12 109,962,427 - 109,980,222 (+) NCBI Celera Cytogenetic Map 12 q24.11 NCBI HuRef 12 107,354,164 - 107,371,959 (+) NCBI HuRef CHM1_1 12 110,305,866 - 110,323,661 (+) NCBI CHM1_1 T2T-CHM13v2.0 12 109,856,359 - 109,893,762 (+) NCBI T2T-CHM13v2.0
Tchp Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 114,845,813 - 114,860,388 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 114,845,821 - 114,860,388 (+) Ensembl GRCm39 Ensembl GRCm38 5 114,707,779 - 114,722,327 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 114,707,760 - 114,722,327 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 115,157,788 - 115,172,336 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 114,968,873 - 114,983,326 (+) NCBI MGSCv36 mm8 Celera 5 111,805,995 - 111,820,543 (+) NCBI Celera Cytogenetic Map 5 F NCBI cM Map 5 55.99 NCBI
Tchp Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955455 8,681,058 - 8,696,996 (-) NCBI ChiLan1.0 ChiLan1.0
TCHP Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 117,966,563 - 117,984,986 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 117,963,304 - 117,981,388 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 107,476,176 - 107,494,035 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 110,871,115 - 110,889,104 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 110,873,883 - 110,889,104 (+) Ensembl panpan1.1 panPan2
TCHP Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 26 17,223,574 - 17,242,788 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 26 17,229,123 - 17,241,270 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 26 18,558,972 - 18,578,387 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 26 17,568,254 - 17,587,693 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 26 17,572,494 - 17,587,679 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 26 18,768,981 - 18,788,164 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 26 17,558,082 - 17,577,293 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 26 17,575,340 - 17,594,540 (-) NCBI UU_Cfam_GSD_1.0
Tchp
TCHP Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 41,061,763 - 41,075,951 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 41,062,137 - 41,077,644 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 14 43,577,716 - 43,593,237 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TCHP Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 11 105,140,397 - 105,158,512 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 11 105,140,423 - 105,158,978 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 139,961,900 - 139,980,059 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Tchp
.
Predicted Target Of
Count of predictions: 226 Count of miRNA genes: 154 Interacting mature miRNAs: 176 Transcripts: ENSRNOT00000001577 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
631560 Apr1 Acute phase response QTL 1 6.1 orosomucoid 1 amount (VT:0010541) plasma orosomucoid 1 level (CMO:0001467) 12 19144362 46669029 Rat 8552964 Pigfal17 Plasma insulin-like growth factor 1 level QTL 17 3.5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 8693635 Alc28 Alcohol consumption QTL 28 2.7 0.439 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 12 23081340 44726024 Rat 7411641 Foco19 Food consumption QTL 19 27.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 7411643 Foco20 Food consumption QTL 20 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 20328819 46669029 Rat 61324 Eae5 Experimental allergic encephalomyelitis QTL 5 14 nervous system integrity trait (VT:0010566) percentage of study population developing relapsing-remitting experimental autoimmune encephalomyelitis during a period of time (CMO:0001402) 12 19610870 46669029 Rat 5684888 Pia42 Pristane induced arthritis QTL 42 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 19610870 42828880 Rat 1549912 Bp268 Blood pressure QTL 268 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 13182736 46669029 Rat 2302060 Pia37 Pristane induced arthritis QTL 37 6.1 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 13198157 46669029 Rat 9590147 Scort7 Serum corticosterone level QTL 7 13.61 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 12 1 42110980 Rat 1641928 Alcrsp5 Alcohol response QTL 5 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 12 12812385 46669029 Rat 1300162 Bp188 Blood pressure QTL 188 3.19 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 32103174 45899022 Rat 8552912 Pigfal6 Plasma insulin-like growth factor 1 level QTL 6 5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564498 46669029 Rat 1549829 Scl48 Serum cholesterol level QTL 48 5 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 12 9603277 46669029 Rat 10059594 Kidm46 Kidney mass QTL 46 3.79 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 12 6107579 46669029 Rat 9590086 Insglur6 Insulin/glucose ratio QTL 6 18.97 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 12 1 42110980 Rat 8552918 Pigfal7 Plasma insulin-like growth factor 1 level QTL 7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 1549902 Bp269 Blood pressure QTL 269 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 13182736 46669029 Rat 1600386 Calcic2 Intracellular calcium level QTL 2 0.001 platelet physiology trait (VT:0005464) platelet intracellular calcium level (CMO:0000922) 12 28064433 46669029 Rat 1302792 Scl21 Serum cholesterol level QTL 21 3.8 0.0011 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 12 7196730 46669029 Rat 61404 Bw120 Body weight QTL 120 5.1 body mass (VT:0001259) body mass index (BMI) (CMO:0000105) 12 12351619 46669029 Rat 1300175 Cm5 Cardiac mass QTL 5 3.78 heart mass (VT:0007028) heart left ventricle weight to body weight ratio (CMO:0000530) 12 28064433 45899022 Rat 8693658 Alc33 Alcohol consumption QTL 33 2.1 0.68 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 12 23081340 43551788 Rat 2293699 Bss49 Bone structure and strength QTL 49 5.61 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 12 10474137 46669029 Rat 1331761 Bp218 Blood pressure QTL 218 2.973 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 12 11073825 45055165 Rat 634351 Apr5 Acute phase response QTL 5 6.7 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 12 1 44503507 Rat 8694179 Bw150 Body weight QTL 150 2.9 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 634350 Apr4 Acute phase response QTL 4 6 orosomucoid 1 amount (VT:0010541) plasma orosomucoid 1 level (CMO:0001467) 12 1172005 46172005 Rat 7411545 Bw128 Body weight QTL 128 5.2 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 7411547 Bw129 Body weight QTL 129 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 6 5564495 46669029 Rat 737979 Pia22 Pristane induced arthritis QTL 22 53.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 1 44465750 Rat 2303569 Gluco44 Glucose level QTL 44 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 12812385 46669029 Rat 7411586 Foco5 Food consumption QTL 5 5.4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 2303575 Insul14 Insulin level QTL 14 4 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 12 1 42450532 Rat 7411588 Foco6 Food consumption QTL 6 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 2302042 Pia38 Pristane induced arthritis QTL 38 3.5 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 1 44503507 Rat 2300186 Bmd59 Bone mineral density QTL 59 7.1 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 12 10474137 46669029 Rat 7411595 Foco9 Food consumption QTL 9 4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 7411597 Foco10 Food consumption QTL 10 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 7411660 Foco28 Food consumption QTL 28 10.9 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat
RH141586
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 41,878,005 - 41,878,206 (+) MAPPER mRatBN7.2 Rnor_6.0 12 47,638,396 - 47,638,596 NCBI Rnor6.0 Rnor_5.0 12 49,431,689 - 49,431,889 UniSTS Rnor5.0 RGSC_v3.4 12 43,166,115 - 43,166,315 UniSTS RGSC3.4 Celera 12 43,493,696 - 43,493,896 UniSTS Cytogenetic Map 12 q16 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000001577 ⟹ ENSRNOP00000001577
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 41,877,889 - 41,892,427 (-) Ensembl Rnor_6.0 Ensembl 12 47,638,274 - 47,653,638 (-) Ensembl
RefSeq Acc Id:
NM_001191666 ⟹ NP_001178595
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 47,538,520 - 47,552,948 (-) NCBI mRatBN7.2 12 41,877,889 - 41,892,319 (-) NCBI Rnor_6.0 12 47,638,279 - 47,652,707 (-) NCBI Rnor_5.0 12 49,431,571 - 49,446,355 (-) NCBI Celera 12 43,493,579 - 43,506,170 (-) NCBI
Sequence:
ATGGCGCTCCCCACGCTGCCCTCTTATTGGTCCAACCGCAGACCCGCGAATATCCGCTACCGCCAGCAACAGCAGGAGGACGAGTTTCGCCAGCAGTGGGAGCAGAACAGTCGCTATTTCAAGACGTG
hide sequence
RefSeq Acc Id:
XM_006249451 ⟹ XP_006249513
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 47,538,520 - 47,553,895 (-) NCBI mRatBN7.2 12 41,877,888 - 41,893,264 (-) NCBI Rnor_6.0 12 47,638,278 - 47,653,602 (-) NCBI Rnor_5.0 12 49,431,571 - 49,446,355 (-) NCBI
Sequence:
GCGGGACCCTCGGAGCCTGCGGGCGCGAGATCGAGCTAAGGCCGGCAACTCTTCTCCGCGAACCTCCGGCGCCAGGCGCAGGAGTCAGAGATGGCGCTCCCCACGCTGCCCTCTTATTGGTCCAACCG
hide sequence
RefSeq Acc Id:
XM_006249452 ⟹ XP_006249514
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 47,538,520 - 47,553,834 (-) NCBI mRatBN7.2 12 41,877,888 - 41,893,203 (-) NCBI Rnor_6.0 12 47,638,278 - 47,653,540 (-) NCBI Rnor_5.0 12 49,431,571 - 49,446,355 (-) NCBI
Sequence:
CCTCCGGCGCCAGGCGCAGGAGTCAGAGGTTAGGCTGGGCCGAGGGGCAGGACGAGGCGTCGCG
hide sequence
RefSeq Acc Id:
XM_039089503 ⟹ XP_038945431
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 47,538,520 - 47,552,898 (-) NCBI mRatBN7.2 12 41,877,888 - 41,892,268 (-) NCBI
RefSeq Acc Id:
NP_001178595 ⟸ NM_001191666
- UniProtKB:
D3ZY42 (UniProtKB/TrEMBL), A6J1Z0 (UniProtKB/TrEMBL)
- Sequence:
MALPTLPSYWSNRRPANIRYRQQQQEDEFRQQWEQNSRYFKTWDLHNSKQTEWTSKTSYQRSMHALYCGKMEEERRKNLEVRRERLRKLMLEEQDLLAEELEELRLSMSLRERRLREQHRDLKSAREE
hide sequence
RefSeq Acc Id:
XP_006249513 ⟸ XM_006249451
- Peptide Label:
isoform X1
- UniProtKB:
D3ZY42 (UniProtKB/TrEMBL), A6J1Z0 (UniProtKB/TrEMBL)
- Sequence:
MALPTLPSYWSNRRPANIRYRQQQQEDEFRQQWEQNSRYFKTWDLHNSKQTEWTSKTSYQRSMHALYCGKMEEERRKNLEVRRERLRKLMLEEQDLLAEELEELRLSMSLRERRLREQHRDLKSAREE
hide sequence
RefSeq Acc Id:
XP_006249514 ⟸ XM_006249452
- Peptide Label:
isoform X1
- UniProtKB:
D3ZY42 (UniProtKB/TrEMBL), A6J1Z0 (UniProtKB/TrEMBL)
- Sequence:
MALPTLPSYWSNRRPANIRYRQQQQEDEFRQQWEQNSRYFKTWDLHNSKQTEWTSKTSYQRSMHALYCGKMEEERRKNLEVRRERLRKLMLEEQDLLAEELEELRLSMSLRERRLREQHRDLKSAREE
hide sequence
Ensembl Acc Id:
ENSRNOP00000001577 ⟸ ENSRNOT00000001577
RefSeq Acc Id:
XP_038945431 ⟸ XM_039089503
- Peptide Label:
isoform X2
- UniProtKB:
A6J1Z0 (UniProtKB/TrEMBL)
RGD ID: 13698708 Promoter ID: EPDNEW_R9233 Type: initiation region Name: Tchp_1 Description: trichoplein, keratin filament binding SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 12 47,653,661 - 47,653,721 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Tchp
trichoplein, keratin filament binding
Tchp_predicted
trichoplein, keratin filament binding (predicted)
'predicted' is removed
2292626 APPROVED
2006-03-30
Tchp_predicted
trichoplein, keratin filament binding (predicted)
RGD1310813_predicted
similar to hypothetical protein MGC10854 (predicted)
Symbol and Name updated
1299863 APPROVED
2005-01-20
RGD1310813_predicted
similar to hypothetical protein MGC10854 (predicted)
LOC304547_predicted
Symbol and Name status set to approved
1331353 APPROVED
2005-01-12
LOC304547_predicted
similar to hypothetical protein MGC10854 (predicted)
Symbol and Name status set to provisional
70820 PROVISIONAL
