Symbol:
Emc2
Name:
ER membrane protein complex subunit 2
RGD ID:
1310430
Description:
Predicted to contribute to membrane insertase activity. Predicted to be involved in protein insertion into ER membrane by stop-transfer membrane-anchor sequence and tail-anchored membrane protein insertion into ER membrane. Predicted to be located in endoplasmic reticulum membrane. Predicted to be extrinsic component of endoplasmic reticulum membrane. Predicted to be part of EMC complex. Orthologous to human EMC2 (ER membrane protein complex subunit 2); INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 3-chloropropane-1,2-diol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC362905; RGD1310430; similar to RIKEN cDNA 4921531G14; tetratricopeptide repeat domain 35; tetratricopeptide repeat protein 35; TPR repeat protein 35; Ttc35
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 76,471,899 - 76,508,866 (+) NCBI GRCr8 mRatBN7.2 7 74,587,196 - 74,624,163 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 74,587,175 - 74,625,189 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 76,430,651 - 76,467,739 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 78,633,156 - 78,670,238 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 78,501,148 - 78,538,291 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 82,338,639 - 82,377,389 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 82,338,663 - 82,377,109 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 82,349,425 - 82,385,901 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 79,265,488 - 79,300,317 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 79,286,206 - 79,323,421 (+) NCBI Celera 7 71,581,687 - 71,618,534 (+) NCBI Celera Cytogenetic Map 7 q31 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Emc2 Rat (+)-catechin multiple interactions ISO RGD:1321326 6480464 [Catechin co-treated with Grape Seed Proanthocyanidins] results in decreased expression of TTC35 mRNA CTD PMID:24763279 Emc2 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO RGD:1321326 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of EMC2 mRNA CTD PMID:22079256 Emc2 Rat 1,2-dimethylhydrazine decreases expression ISO RGD:1321327 6480464 1,2-Dimethylhydrazine results in decreased expression of TTC35 mRNA CTD PMID:22206623 Emc2 Rat 1,2-dimethylhydrazine multiple interactions ISO RGD:1321327 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of EMC2 mRNA CTD PMID:22206623 Emc2 Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of EMC2 mRNA CTD PMID:29097150 Emc2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1321327 6480464 Tetrachlorodibenzodioxin affects the expression of EMC2 mRNA CTD PMID:21570461 Emc2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of EMC2 mRNA CTD PMID:21215274 Emc2 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of TTC35 protein CTD PMID:26072098 Emc2 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:1321327 6480464 bisphenol S results in increased expression of EMC2 mRNA CTD PMID:39298647 Emc2 Rat 4,4'-sulfonyldiphenol decreases methylation ISO RGD:1321326 6480464 bisphenol S results in decreased methylation of EMC2 gene CTD PMID:31601247 Emc2 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of EMC2 mRNA CTD PMID:31881176 Emc2 Rat aflatoxin B1 decreases methylation ISO RGD:1321326 6480464 Aflatoxin B1 results in decreased methylation of EMC2 gene CTD PMID:27153756 Emc2 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of EMC2 mRNA CTD PMID:38685447 Emc2 Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of EMC2 mRNA CTD PMID:30779732 Emc2 Rat aristolochic acid A decreases expression ISO RGD:1321326 6480464 aristolochic acid I results in decreased expression of EMC2 mRNA CTD PMID:33212167 Emc2 Rat Aroclor 1254 decreases expression ISO RGD:1321327 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of TTC35 mRNA CTD PMID:23650126 Emc2 Rat arsenite(3-) multiple interactions ISO RGD:1321326 6480464 arsenite promotes the reaction [G3BP1 protein binds to EMC2 mRNA] CTD PMID:32406909 Emc2 Rat benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of EMC2 mRNA CTD PMID:21839799 Emc2 Rat bisphenol A decreases expression ISO RGD:1321327 6480464 bisphenol A results in decreased expression of EMC2 mRNA CTD PMID:26512966|PMID:33221593 Emc2 Rat bisphenol A decreases expression ISO RGD:1321326 6480464 bisphenol A results in decreased expression of EMC2 protein CTD PMID:34186270 Emc2 Rat bisphenol A affects expression ISO RGD:1321326 6480464 bisphenol A affects the expression of EMC2 mRNA CTD PMID:30903817 Emc2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of TTC35 mRNA CTD PMID:25181051 Emc2 Rat copper atom multiple interactions ISO RGD:1321327 6480464 MT1 affects the reaction [Copper results in increased expression of EMC2 mRNA]; MT2 affects the more ... CTD PMID:16629173 Emc2 Rat copper(0) multiple interactions ISO RGD:1321327 6480464 MT1 affects the reaction [Copper results in increased expression of EMC2 mRNA]; MT2 affects the more ... CTD PMID:16629173 Emc2 Rat cyclosporin A increases expression ISO RGD:1321326 6480464 Cyclosporine results in increased expression of EMC2 mRNA; Cyclosporine results in increased expression of TTC35 more ... CTD PMID:20106945|PMID:25562108 Emc2 Rat DDE increases expression ISO RGD:1321326 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of EMC2 mRNA CTD PMID:38568856 Emc2 Rat dextran sulfate decreases expression ISO RGD:1321327 6480464 Dextran Sulfate results in decreased expression of EMC2 protein CTD PMID:32272095 Emc2 Rat dextran sulfate multiple interactions ISO RGD:1321327 6480464 Erianin inhibits the reaction [Dextran Sulfate results in decreased expression of EMC2 protein] CTD PMID:32272095 Emc2 Rat Dibutyl phosphate affects expression ISO RGD:1321326 6480464 di-n-butylphosphoric acid affects the expression of EMC2 mRNA CTD PMID:37042841 Emc2 Rat dibutyl phthalate decreases expression ISO RGD:1321327 6480464 Dibutyl Phthalate results in decreased expression of EMC2 mRNA CTD PMID:21266533 Emc2 Rat dicrotophos decreases expression ISO RGD:1321326 6480464 dicrotophos results in decreased expression of EMC2 mRNA CTD PMID:28302478 Emc2 Rat erianin multiple interactions ISO RGD:1321327 6480464 Erianin inhibits the reaction [Dextran Sulfate results in decreased expression of EMC2 protein] CTD PMID:32272095 Emc2 Rat ethanol affects splicing ISO RGD:1321327 6480464 Ethanol affects the splicing of EMC2 mRNA CTD PMID:30319688 Emc2 Rat ethyl methanesulfonate decreases expression ISO RGD:1321326 6480464 Ethyl Methanesulfonate results in decreased expression of TTC35 mRNA CTD PMID:23649840 Emc2 Rat folic acid multiple interactions ISO RGD:1321327 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of EMC2 mRNA CTD PMID:22206623 Emc2 Rat ivermectin decreases expression ISO RGD:1321326 6480464 Ivermectin results in decreased expression of EMC2 protein CTD PMID:32959892 Emc2 Rat methidathion increases expression ISO RGD:1321327 6480464 methidathion results in increased expression of EMC2 mRNA CTD PMID:34813904 Emc2 Rat methyl methanesulfonate decreases expression ISO RGD:1321326 6480464 Methyl Methanesulfonate results in decreased expression of TTC35 mRNA CTD PMID:23649840 Emc2 Rat okadaic acid decreases expression ISO RGD:1321326 6480464 Okadaic Acid results in decreased expression of EMC2 mRNA CTD PMID:38832940 Emc2 Rat paracetamol affects expression ISO RGD:1321327 6480464 Acetaminophen affects the expression of EMC2 mRNA CTD PMID:17562736 Emc2 Rat perfluorohexanesulfonic acid increases expression ISO RGD:1321327 6480464 perfluorohexanesulfonic acid results in increased expression of EMC2 mRNA CTD PMID:37995155 Emc2 Rat perfluorooctane-1-sulfonic acid decreases expression ISO RGD:1321326 6480464 perfluorooctane sulfonic acid results in decreased expression of EMC2 mRNA CTD PMID:27153767 Emc2 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:1321327 6480464 [perfluorooctane sulfonic acid co-treated with Pectins] results in increased expression of EMC2 mRNA CTD PMID:36331819 Emc2 Rat potassium chromate multiple interactions ISO RGD:1321326 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of EMC2 mRNA CTD PMID:22079256 Emc2 Rat potassium chromate decreases expression ISO RGD:1321326 6480464 potassium chromate(VI) results in decreased expression of EMC2 mRNA CTD PMID:22079256 Emc2 Rat resveratrol increases expression ISO RGD:1321327 6480464 resveratrol results in increased expression of EMC2 protein CTD PMID:25505154 Emc2 Rat resveratrol multiple interactions ISO RGD:1321326 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of TTC35 mRNA CTD PMID:23557933 Emc2 Rat tamoxifen affects expression ISO RGD:1321326 6480464 Tamoxifen affects the expression of EMC2 mRNA CTD PMID:14699072 Emc2 Rat titanium dioxide increases methylation ISO RGD:1321327 6480464 titanium dioxide results in increased methylation of TTC35 gene; titanium dioxide results in increased methylation more ... CTD PMID:35295148 Emc2 Rat toluene decreases expression EXP 6480464 Toluene results in decreased expression of EMC2 mRNA CTD PMID:22166486 Emc2 Rat trichloroethene decreases methylation EXP 6480464 Trichloroethylene results in decreased methylation of TTC35 gene CTD PMID:27618143 Emc2 Rat valproic acid decreases methylation ISO RGD:1321326 6480464 Valproic Acid results in decreased methylation of EMC2 gene CTD PMID:29154799 Emc2 Rat vorinostat increases expression ISO RGD:1321326 6480464 vorinostat results in increased expression of EMC2 mRNA CTD PMID:27188386
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
Emc2 Rat membrane insertase activity contributes_to ISS UniProtKB:Q15006 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Emc2 Rat membrane insertase activity contributes_to IEA UniProtKB:Q15006|ensembl:ENSP00000220853 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Emc2 Rat membrane insertase activity contributes_to ISO RGD:1321326 1624291 PMID:29809151, PMID:30415835 RGD PMID:29809151|PMID:30415835 Emc2 Rat protein binding enables ISO RGD:1321326 1624291 UniProtKB:O43402|UniProtKB:Q53Y03|UniProtKB:Q7L8J4|UniProtKB:Q8N4V1|UniProtKB:Q96GW1|UniProtKB:Q9H4A3|UniProtKB:Q9P0I2|UniProtKB:Q9UHA2|UniProtKB:Q9UKT9|UniProtKB:Q9Y3B6|UniProtKB:Q9Y5F1 PMID:16189514, PMID:22119785, PMID:25416956, PMID:26496610, PMID:28514442, PMID:30021884, PMID:32296183, PMID:32439656, PMID:33961781, PMID:33964204, PMID:35271311 RGD PMID:16189514|PMID:22119785|PMID:25416956|PMID:26496610|PMID:28514442|PMID:30021884|PMID:32296183|PMID:32439656|PMID:33961781|PMID:33964204|PMID:35271311
Cellular Component
cytoplasm (IEA,ISO,ISS) EMC complex (IBA,IEA,ISO,ISS) endoplasmic reticulum (IEA,ISO,ISS) endoplasmic reticulum membrane (IEA,ISO,ISS) extrinsic component of endoplasmic reticulum membrane (IEA,ISO,ISS) membrane (IEA)
Emc2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 76,471,899 - 76,508,866 (+) NCBI GRCr8 mRatBN7.2 7 74,587,196 - 74,624,163 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 74,587,175 - 74,625,189 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 76,430,651 - 76,467,739 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 78,633,156 - 78,670,238 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 78,501,148 - 78,538,291 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 82,338,639 - 82,377,389 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 82,338,663 - 82,377,109 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 82,349,425 - 82,385,901 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 79,265,488 - 79,300,317 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 79,286,206 - 79,323,421 (+) NCBI Celera 7 71,581,687 - 71,618,534 (+) NCBI Celera Cytogenetic Map 7 q31 NCBI
EMC2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 8 108,443,624 - 108,489,196 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 8 108,443,601 - 108,489,196 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 8 109,455,853 - 109,501,425 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 8 109,525,029 - 109,568,312 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 8 109,525,028 - 109,568,312 NCBI Celera 8 105,642,999 - 105,686,297 (+) NCBI Celera Cytogenetic Map 8 q23.1 NCBI HuRef 8 104,777,276 - 104,820,161 (+) NCBI HuRef CHM1_1 8 109,496,105 - 109,539,394 (+) NCBI CHM1_1 T2T-CHM13v2.0 8 109,572,105 - 109,617,653 (+) NCBI T2T-CHM13v2.0
Emc2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 15 43,340,603 - 43,391,174 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 15 43,340,625 - 43,391,159 (+) Ensembl GRCm39 Ensembl GRCm38 15 43,477,229 - 43,527,777 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 15 43,477,229 - 43,527,763 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 15 43,308,775 - 43,359,323 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 15 43,307,303 - 43,357,851 (+) NCBI MGSCv36 mm8 Celera 15 43,953,653 - 43,997,401 (+) NCBI Celera Cytogenetic Map 15 B3.2 NCBI cM Map 15 16.75 NCBI
Emc2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955417 31,019,403 - 31,051,976 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955417 31,019,389 - 31,048,143 (+) NCBI ChiLan1.0 ChiLan1.0
EMC2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 7 125,819,488 - 125,865,710 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 8 101,342,846 - 101,389,664 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 8 105,095,815 - 105,144,333 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 8 107,243,288 - 107,292,469 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 8 107,243,311 - 107,292,469 (+) Ensembl panpan1.1 panPan2
EMC2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 13 9,069,782 - 9,224,255 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 13 9,047,943 - 9,448,642 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 13 9,342,945 - 9,744,989 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 13 9,342,930 - 9,388,166 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 13 9,085,878 - 9,487,856 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 13 9,210,613 - 9,612,673 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 13 9,291,379 - 9,693,503 (+) NCBI UU_Cfam_GSD_1.0
Emc2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405303 28,927,949 - 28,971,914 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936470 36,350,969 - 36,398,008 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936470 36,354,048 - 36,397,977 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
EMC2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 29,017,517 - 29,079,270 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 28,981,118 - 29,079,270 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 31,452,650 - 31,473,612 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
EMC2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 8 103,159,689 - 103,209,374 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 8 103,159,754 - 103,212,214 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666039 37,371,382 - 37,421,395 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
.
Predicted Target Of
Count of predictions: 39 Count of miRNA genes: 33 Interacting mature miRNAs: 39 Transcripts: ENSRNOT00000006890 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1300179 Kidm5 Kidney mass QTL 5 3.51 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 43747012 135012528 Rat 2293667 Bss42 Bone structure and strength QTL 42 7.25 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 7 47651439 92651439 Rat 10053722 Scort27 Serum corticosterone level QTL 27 2.41 0.0083 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 7 43228750 88228750 Rat 2317035 Aia16 Adjuvant induced arthritis QTL 16 2.71 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 7 59238038 104238038 Rat 1300127 Srn1 Serum renin concentration QTL 1 3.87 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 7 29409683 84928080 Rat 2293678 Bss24 Bone structure and strength QTL 24 6.71 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 7 47651439 92651439 Rat 1358361 Sradr5 Stress Responsive Adrenal Weight QTL 5 5.55 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 7 43747012 108555253 Rat 1357338 Stl17 Serum triglyceride level QTL 17 3.23 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 7 69736356 112729554 Rat 631513 Scl7 Serum cholesterol level QTL 7 4.1 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 7 37960569 82960569 Rat 634331 Pia17 Pristane induced arthritis QTL 17 4.7 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 7 73829340 130221005 Rat 2293685 Bmd21 Bone mineral density QTL 21 4.2 0.0003 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 7 47651439 92651439 Rat 10755453 Coatc12 Coat color QTL 12 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 31112832 76112832 Rat 631504 Cm27 Cardiac mass QTL 27 3.45 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 7 44421311 118198041 Rat 70173 Niddm19 Non-insulin dependent diabetes mellitus QTL 19 4.33 0.00005 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 7 64002457 135012528 Rat 634326 Hc3 Hypercalciuria QTL 3 2.1 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 7 42787314 87787314 Rat 2293696 Bmd32 Bone mineral density QTL 32 5.1 0.0001 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 7 47651439 92651439 Rat 7411605 Foco14 Food consumption QTL 14 24.1 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 34293282 79293282 Rat 1300151 Bp181 Blood pressure QTL 181 3.36 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 7 53612714 103945643 Rat 1559283 Emca4 Estrogen-induced mammary cancer QTL 4 3.7 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 7 62004452 101773158 Rat 1643004 Pain2 Pain QTL 2 1 mechanical nociception trait (VT:0002734) self mutilation severity score (CMO:0002145) 7 9462246 98011544 Rat 738030 Anxrr8 Anxiety related response QTL 8 4.1 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 46590070 91590070 Rat 1300149 Cm6 Cardiac mass QTL 6 4.09 heart mass (VT:0007028) heart left ventricle weight to body weight ratio (CMO:0000530) 7 43747099 102228765 Rat 631534 Lnnr1 Liver neoplastic nodule remodeling QTL 1 3.85 0.001 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705) 7 34293282 79293282 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 2293707 Bss32 Bone structure and strength QTL 32 7.64 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 7 47651439 92651439 Rat 61357 Bp38 Blood pressure QTL 38 1.6 0.052 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 41333674 119109060 Rat 2293644 Bmd29 Bone mineral density QTL 29 5.4 0.0001 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 7 47651439 92651439 Rat 2316947 Rf58 Renal function QTL 58 7.8 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 7 68938720 113886318 Rat 2300178 Bmd54 Bone mineral density QTL 54 5.3 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 7 47651439 92651439 Rat 1298528 Bp169 Blood pressure QTL 169 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 61074194 106074194 Rat 61428 Scl3 Serum cholesterol level QTL 3 3.2 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 7 44867533 89867533 Rat 1300132 Bp182 Blood pressure QTL 182 3.49 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 7 19654317 84928080 Rat 1576303 Ept7 Estrogen-induced pituitary tumorigenesis QTL 7 3.7 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 7 62004452 101773158 Rat 2316955 Stl24 Serum triglyceride level QTL 24 7.1 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 7 68938720 113886318 Rat 2316952 Pur22 Proteinuria QTL 22 5.2 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 7 68938720 113886318 Rat 631540 Bw9 Body weight QTL 9 4.5 body mass (VT:0001259) body weight (CMO:0000012) 7 69736226 117455174 Rat
D7Got56
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 74,607,635 - 74,607,814 (+) MAPPER mRatBN7.2 Rnor_6.0 7 82,359,621 - 82,359,799 NCBI Rnor6.0 Rnor_5.0 7 82,369,729 - 82,369,907 UniSTS Rnor5.0 RGSC_v3.4 7 79,283,386 - 79,283,562 RGD RGSC3.4 RGSC_v3.4 7 79,283,387 - 79,283,565 UniSTS RGSC3.4 RGSC_v3.1 7 79,304,116 - 79,304,292 RGD Celera 7 71,602,128 - 71,602,306 UniSTS RH 3.4 Map 7 519.7 RGD RH 3.4 Map 7 519.7 UniSTS Cytogenetic Map 7 q31 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000006890 ⟹ ENSRNOP00000006890
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 74,593,805 - 74,625,187 (+) Ensembl Rnor_6.0 Ensembl 7 82,338,663 - 82,377,109 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000114447 ⟹ ENSRNOP00000084502
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 74,587,207 - 74,625,189 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000115694 ⟹ ENSRNOP00000088541
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 74,587,175 - 74,625,187 (+) Ensembl
RefSeq Acc Id:
NM_001113785 ⟹ NP_001107257
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 76,471,899 - 76,508,866 (+) NCBI mRatBN7.2 7 74,587,196 - 74,624,163 (+) NCBI Rnor_6.0 7 82,338,639 - 82,377,389 (+) NCBI Rnor_5.0 7 82,349,425 - 82,385,901 (+) NCBI RGSC_v3.4 7 79,265,488 - 79,300,317 (+) RGD Celera 7 71,581,687 - 71,618,534 (+) RGD
Sequence:
CCGCTGCCTCTAGGTTCTAGGAAGATGGCGAAGGTCACTGAGCGTTACGATGTGACTTGGGAAGAAATGCGAGATAAAATGAGAAAATGGCGAGAAGAAAATTCAAGAAATAGTGAACAAATTATGGA
hide sequence
RefSeq Acc Id:
NP_001107257 ⟸ NM_001113785
- UniProtKB:
B0BNG0 (UniProtKB/Swiss-Prot), A6HRA5 (UniProtKB/TrEMBL), A0A8I5ZZJ5 (UniProtKB/TrEMBL)
- Sequence:
MAKVTERYDVTWEEMRDKMRKWREENSRNSEQIMEVGEELINDYASKLGDDIWIIYEQVMIAALDYGRDDLALFCLQELRRQFPGSHRVKRLTGMRFEAMERYDDAIQLYDRILQEDPTNTAARKRKI
hide sequence
Ensembl Acc Id:
ENSRNOP00000006890 ⟸ ENSRNOT00000006890
Ensembl Acc Id:
ENSRNOP00000088541 ⟸ ENSRNOT00000115694
Ensembl Acc Id:
ENSRNOP00000084502 ⟸ ENSRNOT00000114447
RGD ID: 13695333 Promoter ID: EPDNEW_R5841 Type: multiple initiation site Name: Emc2_1 Description: ER membrane protein complex subunit 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 82,338,651 - 82,338,711 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2012-10-17
Emc2
ER membrane protein complex subunit 2
Ttc35
tetratricopeptide repeat domain 35
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-02-27
Ttc35
tetratricopeptide repeat domain 35
RGD1310430_predicted
similar to RIKEN cDNA 4921531G14 (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-20
RGD1310430_predicted
similar to RIKEN cDNA 4921531G14 (predicted)
LOC362905_predicted
Symbol and Name status set to approved
1331353 APPROVED
2005-01-12
LOC362905_predicted
similar to RIKEN cDNA 4921531G14 (predicted)
Symbol and Name status set to provisional
70820 PROVISIONAL
