Symbol:
Gli2
Name:
GLI family zinc finger 2
RGD ID:
1309270
Description:
Predicted to enable several functions, including DNA binding activity; DNA-binding transcription activator activity, RNA polymerase II-specific; and promoter-specific chromatin binding activity. Involved in positive regulation of collagen biosynthetic process; prostate gland development; and response to mechanical stimulus. Predicted to be located in several cellular components, including ciliary tip; cytoskeleton; and nuclear lumen. Predicted to be active in nucleus. Biomarker of esophageal atresia/tracheoesophageal fistula. Human ortholog(s) of this gene implicated in Culler-Jones syndrome; holoprosencephaly 9; and spina bifida. Orthologous to human GLI2 (GLI family zinc finger 2); PARTICIPATES IN Hedgehog signaling pathway; basal cell carcinoma pathway; INTERACTS WITH 17beta-estradiol; 17beta-estradiol 3-benzoate; 2,3,7,8-Tetrachlorodibenzofuran.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
GLI-Kruppel family member GLI2; LOC304729; zinc finger protein GLI2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 32,499,678 - 32,716,418 (-) NCBI GRCr8 mRatBN7.2 13 29,946,882 - 30,163,589 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 29,946,809 - 30,163,574 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 32,529,564 - 32,585,620 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 33,817,400 - 33,873,458 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 31,093,715 - 31,149,850 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 34,829,021 - 35,049,172 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 34,829,139 - 35,048,444 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 39,955,094 - 40,170,750 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 31,551,089 - 31,607,264 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 31,555,563 - 31,574,381 (-) NCBI Celera 13 29,844,054 - 29,900,050 (-) NCBI Celera Cytogenetic Map 13 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Gli2 Rat arteriovenous malformations of the brain ISO RGD:1606840 8554872 ClinVar Annotator: match by term: Arteriovenous malformations of the brain ClinVar PMID:25741868 Gli2 Rat Bardet-Biedl syndrome ISO RGD:1606840 8554872 ClinVar Annotator: match by term: Bardet-Biedl syndrome ClinVar PMID:25741868|PMID:26893459|PMID:28492532 Gli2 Rat Craniosynostosis Syndrome, Autosomal Recessive ISO RGD:1606840 8554872 ClinVar Annotator: match by term: Craniosynostosis syndrome ClinVar PMID:31292255 Gli2 Rat Culler-Jones syndrome ISO RGD:1606840 8554872 ClinVar Annotator: match by term: Culler-Jones syndrome | ClinVar Annotator: match by term: GLI2-related disorder ClinVar PMID:15994174|PMID:16327884|PMID:17576681|PMID:20685856|PMID:21204792|PMID:21416594|PMID:22967285|PMID:22978696|PMID:23408573|PMID:24744436|PMID:25741868|PMID:26334177|PMID:28191889|PMID:28492532|PMID:30629636|PMID:31292255|PMID:33057194|PMID:34921505|PMID:6726521|PMID:9536098 Gli2 Rat Developmental Disease ISO RGD:1606840 8554872 ClinVar Annotator: match by term: Developmental disorder ClinVar PMID:25741868 Gli2 Rat disorder of sexual development ISO RGD:1606840 8554872 ClinVar Annotator: match by term: Disorder of sexual differentiation ClinVar PMID:25741868 Gli2 Rat enophthalmos ISO RGD:1606840 8554872 ClinVar Annotator: match by term: Enophthalmos ClinVar PMID:25741868 Gli2 Rat epilepsy ISO RGD:1606840 8554872 ClinVar Annotator: match by term: Epilepsy ClinVar PMID:25741868 Gli2 Rat essential tremor 1 ISO RGD:1606840 8554872 ClinVar Annotator: match by term: Hand tremor ClinVar PMID:25741868 Gli2 Rat exostosis ISO RGD:1606840 8554872 ClinVar Annotator: match by term: Exostosis ClinVar PMID:25741868 Gli2 Rat genetic disease ISO RGD:1606840 8554872 ClinVar Annotator: match by term: Inborn genetic diseases ClinVar PMID:14581620|PMID:15994174|PMID:20685856|PMID:22967285|PMID:24744436|PMID:25741868|PMID:25954003|PMID:27618451|PMID:28490743|PMID:28492532|PMID:29165578|PMID:36413997|PMID:37165954 Gli2 Rat Growth Disorders ISO RGD:1606840 8554872 ClinVar Annotator: match by term: Growth Retardation ClinVar Gli2 Rat holoprosencephaly ISO RGD:1606840 8554872 ClinVar Annotator: match by term: Holoprosencephaly sequence | ClinVar Annotator: match by term: Microform holoprosencephaly ClinVar PMID:25741868 Gli2 Rat holoprosencephaly 1 ISO RGD:1606840 8554872 ClinVar Annotator: match by term: Holoprosencephaly 1 ClinVar PMID:25741868|PMID:28492532 Gli2 Rat Holoprosencephaly 10 ISO RGD:1606840 8554872 ClinVar Annotator: match by term: HOLOPROSENCEPHALY WITH MICROPHTHALMIA AND FIRST BRANCHIAL ARCH ANOMALIES ClinVar PMID:25741868|PMID:28492532 Gli2 Rat holoprosencephaly 9 ISO RGD:1606840 8554872 ClinVar Annotator: match by term: Cerebellar cyst | ClinVar Annotator: match by term: GLI2-related condition more ... ClinVar PMID:10725236|PMID:14581620|PMID:15994174|PMID:16199547|PMID:16327884|PMID:17096318|PMID:1756909|PMID:17569090|PMID:17576681|PMID:19223936|PMID:20685056|PMID:20685856|PMID:21204792|PMID:21416594|PMID:22967285|PMID:22978696|PMID:23408573|PMID:24744436|PMID:25056824|PMID:25741868|PMID:26334177|PMID:26893459|PMID:28191889|PMID:28492532|PMID:29095814|PMID:29165578|PMID:29876959|PMID:30548673|PMID:3320637|PMID:33729509|PMID:34198905|PMID:34387403|PMID:34906515|PMID:34921505|PMID:37165954|PMID:9536098 Gli2 Rat Hypertelorism ISO RGD:1606840 8554872 ClinVar Annotator: match by term: Hypertelorism ClinVar PMID:25741868 Gli2 Rat intellectual disability ISO RGD:1606840 8554872 ClinVar Annotator: match by term: intellectual disabilities ClinVar PMID:25741868 Gli2 Rat microcephaly ISO RGD:1606840 8554872 ClinVar Annotator: match by term: Microcephaly ClinVar PMID:25741868|PMID:28492532 Gli2 Rat optic nerve disease ISO RGD:1606840 8554872 ClinVar Annotator: match by term: Abnormal optic nerve morphology ClinVar Gli2 Rat partial androgen insensitivity syndrome ISO RGD:1606840 8554872 ClinVar Annotator: match by term: Partial androgen insensitivity syndrome ClinVar PMID:19223936|PMID:21204792|PMID:22967285|PMID:23408573|PMID:25741868|PMID:28492532 Gli2 Rat Pituitary Stalk Interruption Syndrome ISO RGD:1606840 8554872 ClinVar Annotator: match by term: Pituitary stalk interruption syndrome ClinVar PMID:25741868 Gli2 Rat spermatogenic failure 57 ISO RGD:1606840 8554872 ClinVar Annotator: match by term: Male infertility with azoospermia or oligozoospermia due to single gene more ... ClinVar PMID:25741868|PMID:28492532 Gli2 Rat syndromic microphthalmia 5 ISO RGD:1606840 8554872 ClinVar Annotator: match by term: Anophthalmia-microphthalmia syndrome ClinVar PMID:25741868|PMID:26893459|PMID:28492532 Gli2 Rat Tremor ISO RGD:1606840 8554872 ClinVar Annotator: match by term: Tremor ClinVar PMID:25741868 Gli2 Rat White-Sutton syndrome ISO RGD:1606840 8554872 ClinVar Annotator: match by term: Intellectual disability-microcephaly-strabismus-behavioral abnormalities syndrome ClinVar PMID:25741868
Only show annotations with direct experimental evidence (0 objects hidden)
Gli2 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO RGD:1606840 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of GLI2 mRNA CTD PMID:22079256 Gli2 Rat 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene multiple interactions ISO RGD:1319523 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Gli2 Rat 1,2-dichloroethane decreases expression ISO RGD:1319523 6480464 ethylene dichloride results in decreased expression of GLI2 mRNA CTD PMID:28960355 Gli2 Rat 17beta-estradiol affects expression ISO RGD:1606840 6480464 Estradiol affects the expression of GLI2 mRNA CTD PMID:14699072|PMID:22574217 Gli2 Rat 17beta-estradiol multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of GLI2 mRNA CTD PMID:32741896 Gli2 Rat 17beta-estradiol multiple interactions ISO RGD:1606840 6480464 [Estradiol co-treated with TGFB1 protein] results in increased expression of GLI2 mRNA CTD PMID:30165855 Gli2 Rat 17beta-estradiol 3-benzoate multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of GLI2 mRNA CTD PMID:32741896 Gli2 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO RGD:1319523 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Gli2 Rat 2,2',4,4'-Tetrabromodiphenyl ether multiple interactions ISO RGD:1606840 6480464 [2,2',4,4'-tetrabromodiphenyl ether affects the methylation of GLI2 gene] which affects the expression of GLI2 mRNA CTD PMID:32653021 Gli2 Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO RGD:1319523 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Gli2 Rat 2,3',4,4',5-Pentachlorobiphenyl affects expression ISO RGD:1319523 6480464 2,3',4,4',5-pentachlorobiphenyl affects the expression of GLI2 mRNA CTD PMID:31388691 Gli2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1319523 6480464 Tetrachlorodibenzodioxin affects the expression of GLI2 mRNA CTD PMID:24058054 Gli2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1319523 6480464 Tetrachlorodibenzodioxin results in increased expression of GLI2 mRNA CTD PMID:16120747|PMID:17586704 Gli2 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2,3,7,8-tetrachlorodibenzofuran results in decreased expression of GLI2 mRNA CTD PMID:32109520 Gli2 Rat 2,4,4'-trichlorobiphenyl multiple interactions ISO RGD:1319523 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Gli2 Rat 2,4-D multiple interactions ISO RGD:1319523 6480464 [lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose more ... CTD PMID:37567420 Gli2 Rat 3,3',4,4'-tetrachlorobiphenyl affects expression ISO RGD:1606840 6480464 3,4,3',4'-tetrachlorobiphenyl affects the expression of GLI2 mRNA CTD PMID:20638727 Gli2 Rat 4-hydroperoxycyclophosphamide decreases expression ISO RGD:1319523 6480464 perfosfamide results in decreased expression of GLI2 mRNA CTD PMID:19429390 Gli2 Rat 5-aza-2'-deoxycytidine decreases expression ISO RGD:1606840 6480464 Decitabine results in decreased expression of GLI2 mRNA CTD PMID:19363521 Gli2 Rat 5-aza-2'-deoxycytidine multiple interactions ISO RGD:1606840 6480464 TP53 protein affects the reaction [Decitabine results in decreased expression of GLI2 mRNA] CTD PMID:19363521 Gli2 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of GLI2 mRNA CTD PMID:24780913|PMID:25825206|PMID:36843608 Gli2 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of GLI2 mRNA CTD PMID:30047161 Gli2 Rat Ac-Ser-Asp-Lys-Pro-OH multiple interactions EXP 6480464 [goralatide co-treated with Captopril] inhibits the reaction [Silicon Dioxide results in increased expression of GLI2 more ... CTD PMID:31181250 Gli2 Rat Ac-Ser-Asp-Lys-Pro-OH multiple interactions ISO RGD:1606840 6480464 [goralatide co-treated with Captopril] inhibits the reaction [AGT protein results in increased expression of GLI2 more ... CTD PMID:31181250 Gli2 Rat acetaldehyde affects expression ISO RGD:1319523 6480464 Acetaldehyde affects the expression of GLI2 mRNA CTD PMID:22634333 Gli2 Rat aflatoxin B1 increases methylation ISO RGD:1606840 6480464 Aflatoxin B1 results in increased methylation of GLI2 gene CTD PMID:27153756 Gli2 Rat Aflatoxin B2 alpha affects methylation ISO RGD:1606840 6480464 aflatoxin B2 affects the methylation of GLI2 intron CTD PMID:30157460 Gli2 Rat aldehydo-D-glucose affects localization ISO RGD:1606840 6480464 Glucose affects the localization of GLI2 protein CTD PMID:33992720 Gli2 Rat aldehydo-D-glucose multiple interactions ISO RGD:1319523 6480464 [lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose more ... CTD PMID:37567420 Gli2 Rat all-trans-retinoic acid decreases expression ISO RGD:1606840 6480464 Tretinoin results in decreased expression of GLI2 mRNA CTD PMID:21934132 Gli2 Rat antirheumatic drug increases expression ISO RGD:1606840 6480464 Antirheumatic Agents results in increased expression of GLI2 mRNA CTD PMID:24449571 Gli2 Rat aristolochic acid A decreases expression ISO RGD:1606840 6480464 aristolochic acid I results in decreased expression of GLI2 mRNA CTD PMID:33212167 Gli2 Rat Aroclor 1254 decreases expression ISO RGD:1319523 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of GLI2 mRNA; Chlorodiphenyl (54% Chlorine) results in more ... CTD PMID:30578594 Gli2 Rat arsane increases expression ISO RGD:1319523 6480464 Arsenic results in increased expression of GLI2 mRNA CTD PMID:23942117 Gli2 Rat arsane multiple interactions ISO RGD:1606840 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of GLI2 more ... CTD PMID:39836092 Gli2 Rat arsane affects methylation ISO RGD:1606840 6480464 Arsenic affects the methylation of GLI2 gene CTD PMID:25304211 Gli2 Rat arsenic atom increases expression ISO RGD:1319523 6480464 Arsenic results in increased expression of GLI2 mRNA CTD PMID:23942117 Gli2 Rat arsenic atom multiple interactions ISO RGD:1606840 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of GLI2 more ... CTD PMID:39836092 Gli2 Rat arsenic atom affects methylation ISO RGD:1606840 6480464 Arsenic affects the methylation of GLI2 gene CTD PMID:25304211 Gli2 Rat arsenous acid increases response to substance ISO RGD:1606840 6480464 GLI2 protein results in increased susceptibility to Arsenic Trioxide CTD PMID:21183792 Gli2 Rat arsenous acid multiple interactions EXP 6480464 Arsenic Trioxide inhibits the reaction [Cisplatin results in increased expression of GLI2 protein]; Curcumin promotes more ... CTD PMID:31612257 Gli2 Rat arsenous acid decreases response to substance ISO RGD:1606840 6480464 GLI2 protein results in decreased susceptibility to Arsenic Trioxide CTD PMID:20707922 Gli2 Rat arsenous acid decreases expression ISO RGD:1606840 6480464 Arsenic Trioxide results in decreased expression of GLI2 mRNA CTD PMID:23861973|PMID:24685274|PMID:25945059 Gli2 Rat aspartame decreases expression ISO RGD:1606840 6480464 Aspartame results in decreased expression of GLI2 protein CTD PMID:33992720 Gli2 Rat benzo[a]pyrene affects methylation ISO RGD:1606840 6480464 Benzo(a)pyrene affects the methylation of GLI2 intron CTD PMID:30157460 Gli2 Rat benzo[a]pyrene increases expression ISO RGD:1606840 6480464 Benzo(a)pyrene results in increased expression of GLI2 mRNA CTD PMID:32234424 Gli2 Rat benzo[a]pyrene diol epoxide I decreases expression ISO RGD:1606840 6480464 7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in decreased expression of GLI2 mRNA CTD PMID:19150397 Gli2 Rat benzo[e]pyrene decreases methylation ISO RGD:1606840 6480464 benzo(e)pyrene results in decreased methylation of GLI2 polyA tail CTD PMID:30157460 Gli2 Rat benzo[e]pyrene affects methylation ISO RGD:1606840 6480464 benzo(e)pyrene affects the methylation of GLI2 intron CTD PMID:30157460 Gli2 Rat bis(2-ethylhexyl) phthalate decreases expression ISO RGD:1319523 6480464 Diethylhexyl Phthalate results in decreased expression of GLI2 mRNA CTD PMID:28085963|PMID:34319233 Gli2 Rat bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of GLI2 mRNA CTD PMID:35810816 Gli2 Rat bis(2-ethylhexyl) phthalate decreases methylation ISO RGD:1319523 6480464 Diethylhexyl Phthalate results in decreased methylation of GLI2 intron CTD PMID:32864567 Gli2 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of GLI2 mRNA CTD PMID:25181051 Gli2 Rat bisphenol A affects methylation ISO RGD:1606840 6480464 bisphenol A affects the methylation of GLI2 gene CTD PMID:31601247 Gli2 Rat bisphenol A affects methylation ISO RGD:1319523 6480464 bisphenol A affects the methylation of GLI2 promoter CTD PMID:27334623 Gli2 Rat bisphenol A decreases methylation ISO RGD:1319523 6480464 bisphenol A results in decreased methylation of GLI2 promoter CTD PMID:27312807 Gli2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of GLI2 mRNA CTD PMID:30816183 Gli2 Rat bisphenol F decreases expression ISO RGD:1319523 6480464 bisphenol F results in decreased expression of GLI2 mRNA CTD PMID:38685157 Gli2 Rat cadmium dichloride increases expression ISO RGD:1606840 6480464 Cadmium Chloride results in increased expression of GLI2 mRNA CTD PMID:38382870 Gli2 Rat captopril multiple interactions ISO RGD:1606840 6480464 [goralatide co-treated with Captopril] inhibits the reaction [AGT protein results in increased expression of GLI2 more ... CTD PMID:31181250 Gli2 Rat captopril multiple interactions EXP 6480464 [goralatide co-treated with Captopril] inhibits the reaction [Silicon Dioxide results in increased expression of GLI2 more ... CTD PMID:31181250 Gli2 Rat carbamazepine affects expression ISO RGD:1319523 6480464 Carbamazepine affects the expression of GLI2 mRNA CTD PMID:22634333 Gli2 Rat CGP 52608 multiple interactions ISO RGD:1606840 6480464 CGP 52608 promotes the reaction [RORA protein binds to GLI2 gene] CTD PMID:28238834 Gli2 Rat chromium(6+) multiple interactions ISO RGD:1319523 6480464 [Potassium Dichromate results in increased abundance of chromium hexavalent ion] which results in increased expression more ... CTD PMID:31756458 Gli2 Rat cisplatin decreases expression ISO RGD:1606840 6480464 Cisplatin results in decreased expression of GLI2 mRNA CTD PMID:27392435 Gli2 Rat cisplatin multiple interactions EXP 6480464 Arsenic Trioxide inhibits the reaction [Cisplatin results in increased expression of GLI2 protein]; Curcumin inhibits more ... CTD PMID:31612257 Gli2 Rat cisplatin increases expression EXP 6480464 Cisplatin results in increased expression of GLI2 protein CTD PMID:31612257 Gli2 Rat cisplatin multiple interactions ISO RGD:1606840 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of GLI2 mRNA CTD PMID:27392435 Gli2 Rat cocaine decreases expression EXP 6480464 Cocaine results in decreased expression of GLI2 mRNA CTD PMID:27899881 Gli2 Rat colforsin daropate hydrochloride multiple interactions EXP 6480464 Colforsin inhibits the reaction [Carbon Tetrachloride results in increased expression of GLI2 mRNA] CTD PMID:27590029 Gli2 Rat copper atom increases expression EXP 6480464 Copper deficiency results in increased expression of GLI2 mRNA CTD PMID:26033743 Gli2 Rat copper(0) increases expression EXP 6480464 Copper deficiency results in increased expression of GLI2 mRNA CTD PMID:26033743 Gli2 Rat crotonaldehyde decreases expression ISO RGD:1606840 6480464 2-butenal results in decreased expression of GLI2 mRNA CTD PMID:20471460 Gli2 Rat curcumin multiple interactions EXP 6480464 Curcumin inhibits the reaction [Cisplatin results in increased expression of GLI2 protein]; Curcumin promotes the more ... CTD PMID:31612257 Gli2 Rat Cyclopamine decreases expression EXP 6480464 cyclopamine results in decreased expression of GLI2 mRNA CTD PMID:21703336 Gli2 Rat cyproconazole affects expression ISO RGD:1319523 6480464 cyproconazole affects the expression of GLI2 mRNA CTD PMID:22045034 Gli2 Rat D-glucose affects localization ISO RGD:1606840 6480464 Glucose affects the localization of GLI2 protein CTD PMID:33992720 Gli2 Rat D-glucose multiple interactions ISO RGD:1319523 6480464 [lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose more ... CTD PMID:37567420 Gli2 Rat dexamethasone decreases expression ISO RGD:1606840 6480464 Dexamethasone results in decreased expression of GLI2 mRNA CTD PMID:25047013 Gli2 Rat diarsenic trioxide decreases response to substance ISO RGD:1606840 6480464 GLI2 protein results in decreased susceptibility to Arsenic Trioxide CTD PMID:20707922 Gli2 Rat diarsenic trioxide multiple interactions EXP 6480464 Arsenic Trioxide inhibits the reaction [Cisplatin results in increased expression of GLI2 protein]; Curcumin promotes more ... CTD PMID:31612257 Gli2 Rat diarsenic trioxide increases response to substance ISO RGD:1606840 6480464 GLI2 protein results in increased susceptibility to Arsenic Trioxide CTD PMID:21183792 Gli2 Rat diarsenic trioxide decreases expression ISO RGD:1606840 6480464 Arsenic Trioxide results in decreased expression of GLI2 mRNA CTD PMID:23861973|PMID:24685274|PMID:25945059 Gli2 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of GLI2 mRNA CTD PMID:25213187|PMID:27079746 Gli2 Rat diethyl malate affects expression ISO RGD:1319523 6480464 diethyl malate affects the expression of GLI2 mRNA CTD PMID:24814887 Gli2 Rat disodium selenite decreases expression ISO RGD:1319523 6480464 Sodium Selenite results in decreased expression of GLI2 mRNA CTD PMID:23274088 Gli2 Rat dorsomorphin multiple interactions ISO RGD:1606840 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Gli2 Rat elemental selenium increases expression ISO RGD:1606840 6480464 Selenium results in increased expression of GLI2 mRNA CTD PMID:19244175 Gli2 Rat embelin decreases expression ISO RGD:1606840 6480464 embelin results in decreased expression of GLI2 protein CTD PMID:24694877 Gli2 Rat embelin decreases expression ISO RGD:1319523 6480464 embelin results in decreased expression of GLI2 protein CTD PMID:24694877 Gli2 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of GLI2 mRNA CTD PMID:29391264 Gli2 Rat ethanol increases expression ISO RGD:1319523 6480464 Ethanol results in increased expression of GLI2 mRNA CTD PMID:30319688 Gli2 Rat flusilazole affects expression ISO RGD:1319523 6480464 flusilazole affects the expression of GLI2 mRNA CTD PMID:22634333 Gli2 Rat formaldehyde decreases expression ISO RGD:1606840 6480464 Formaldehyde results in decreased expression of GLI2 mRNA CTD PMID:23416264 Gli2 Rat formaldehyde multiple interactions ISO RGD:1606840 6480464 [HSPA1A protein co-treated with 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one co-treated with Formaldehyde] results in increased expression of GLI2 protein; more ... CTD PMID:30600586 Gli2 Rat FR900359 decreases phosphorylation ISO RGD:1606840 6480464 FR900359 results in decreased phosphorylation of GLI2 protein CTD PMID:37730182 Gli2 Rat fructose multiple interactions ISO RGD:1319523 6480464 [lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose more ... CTD PMID:37567420 Gli2 Rat furan increases expression EXP 6480464 furan results in increased expression of GLI2 mRNA CTD PMID:27387713 Gli2 Rat gallic acid decreases expression ISO RGD:1606840 6480464 Gallic Acid results in decreased expression of GLI2 mRNA CTD PMID:34408198 Gli2 Rat gemcitabine affects expression ISO RGD:1606840 6480464 Gemcitabine affects the expression of GLI2 mRNA CTD PMID:20103597 Gli2 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of GLI2 mRNA CTD PMID:33387578 Gli2 Rat glucose affects localization ISO RGD:1606840 6480464 Glucose affects the localization of GLI2 protein CTD PMID:33992720 Gli2 Rat glucose multiple interactions ISO RGD:1319523 6480464 [lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose more ... CTD PMID:37567420 Gli2 Rat goralatide multiple interactions EXP 6480464 [goralatide co-treated with Captopril] inhibits the reaction [Silicon Dioxide results in increased expression of GLI2 more ... CTD PMID:31181250 Gli2 Rat goralatide multiple interactions ISO RGD:1606840 6480464 [goralatide co-treated with Captopril] inhibits the reaction [AGT protein results in increased expression of GLI2 more ... CTD PMID:31181250 Gli2 Rat lipopolysaccharide decreases expression ISO RGD:1319523 6480464 Lipopolysaccharides results in decreased expression of GLI2 mRNA CTD PMID:12057914 Gli2 Rat LY294002 multiple interactions ISO RGD:1606840 6480464 [HSPA1A protein co-treated with 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one co-treated with Formaldehyde] results in increased expression of GLI2 protein CTD PMID:30600586 Gli2 Rat methapyrilene decreases methylation ISO RGD:1606840 6480464 Methapyrilene results in decreased methylation of GLI2 polyA tail CTD PMID:30157460 Gli2 Rat methapyrilene affects methylation ISO RGD:1606840 6480464 Methapyrilene affects the methylation of GLI2 intron CTD PMID:30157460 Gli2 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of GLI2 mRNA CTD PMID:30047161 Gli2 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of GLI2 gene CTD PMID:35440735 Gli2 Rat methylisothiazolinone decreases expression ISO RGD:1606840 6480464 2-methyl-4-isothiazolin-3-one results in decreased expression of GLI2 mRNA CTD PMID:31629900 Gli2 Rat methylmercury chloride increases expression ISO RGD:1606840 6480464 methylmercuric chloride results in increased expression of GLI2 mRNA CTD PMID:23179753|PMID:26272509 Gli2 Rat methylmercury chloride multiple interactions ISO RGD:1606840 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Gli2 Rat nitrofen decreases expression EXP 6480464 nitrofen results in decreased expression of GLI2 mRNA CTD PMID:33484710 Gli2 Rat Nor-9-carboxy-delta9-THC multiple interactions ISO RGD:1606840 6480464 [Cannabinoids results in increased abundance of 11-nor-delta(9)-tetrahydrocannabinol-9-carboxylic acid] which affects the methylation of GLI2 gene CTD PMID:30521419 Gli2 Rat paracetamol decreases expression ISO RGD:1606840 6480464 Acetaminophen results in decreased expression of GLI2 mRNA CTD PMID:22230336 Gli2 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of GLI2 mRNA CTD PMID:33387578 Gli2 Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of GLI2 mRNA CTD PMID:32680482 Gli2 Rat PCB138 multiple interactions ISO RGD:1319523 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Gli2 Rat potassium chromate decreases expression ISO RGD:1606840 6480464 potassium chromate(VI) results in decreased expression of GLI2 mRNA CTD PMID:22079256 Gli2 Rat potassium chromate multiple interactions ISO RGD:1606840 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of GLI2 mRNA CTD PMID:22079256 Gli2 Rat potassium dichromate multiple interactions ISO RGD:1319523 6480464 [Potassium Dichromate results in increased abundance of chromium hexavalent ion] which results in increased expression more ... CTD PMID:31756458 Gli2 Rat progesterone affects expression ISO RGD:1319523 6480464 Progesterone affects the expression of GLI2 mRNA CTD PMID:17251523 Gli2 Rat quercetin multiple interactions ISO RGD:1606840 6480464 SHH protein inhibits the reaction [Quercetin results in decreased expression of GLI2 protein] CTD PMID:33070227 Gli2 Rat quercetin decreases expression ISO RGD:1606840 6480464 Quercetin results in decreased expression of GLI2 mRNA; Quercetin results in decreased expression of GLI2 more ... CTD PMID:33070227 Gli2 Rat SB 431542 multiple interactions ISO RGD:1606840 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Gli2 Rat selenium atom increases expression ISO RGD:1606840 6480464 Selenium results in increased expression of GLI2 mRNA CTD PMID:19244175 Gli2 Rat silicon dioxide decreases expression ISO RGD:1606840 6480464 Silicon Dioxide analog results in decreased expression of GLI2 mRNA CTD PMID:23806026 Gli2 Rat silicon dioxide increases expression EXP 6480464 Silicon Dioxide results in increased expression of GLI2 protein CTD PMID:31181250 Gli2 Rat silicon dioxide multiple interactions EXP 6480464 [goralatide co-treated with Captopril] inhibits the reaction [Silicon Dioxide results in increased expression of GLI2 more ... CTD PMID:31181250 Gli2 Rat silver atom increases expression ISO RGD:1606840 6480464 Silver results in increased expression of GLI2 mRNA CTD PMID:26551752 Gli2 Rat silver atom increases expression ISO RGD:1319523 6480464 Silver results in increased expression of GLI2 mRNA CTD PMID:27131904 Gli2 Rat silver atom decreases expression ISO RGD:1606840 6480464 Silver results in decreased expression of GLI2 mRNA CTD PMID:26551752 Gli2 Rat silver(0) decreases expression ISO RGD:1606840 6480464 Silver results in decreased expression of GLI2 mRNA CTD PMID:26551752 Gli2 Rat silver(0) increases expression ISO RGD:1319523 6480464 Silver results in increased expression of GLI2 mRNA CTD PMID:27131904 Gli2 Rat silver(0) increases expression ISO RGD:1606840 6480464 Silver results in increased expression of GLI2 mRNA CTD PMID:26551752 Gli2 Rat sodium arsenite decreases expression ISO RGD:1319523 6480464 sodium arsenite results in decreased expression of GLI2 mRNA; sodium arsenite results in decreased expression more ... CTD PMID:20179202|PMID:25448440|PMID:37682722 Gli2 Rat sodium arsenite multiple interactions ISO RGD:1606840 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of GLI2 more ... CTD PMID:39836092 Gli2 Rat Soman decreases expression EXP 6480464 Soman results in decreased expression of GLI2 mRNA CTD PMID:19281266 Gli2 Rat sonidegib decreases expression ISO RGD:1319523 6480464 sonidegib results in decreased expression of GLI2 mRNA CTD PMID:24973920 Gli2 Rat sonidegib decreases response to substance ISO RGD:1606840 6480464 GLI2 protein results in decreased susceptibility to sonidegib CTD PMID:24973920 Gli2 Rat sonidegib multiple interactions ISO RGD:1319523 6480464 sonidegib inhibits the reaction [SUFU gene mutant form results in increased expression of GLI2 mRNA] CTD PMID:24973920 Gli2 Rat sunitinib increases expression ISO RGD:1606840 6480464 Sunitinib results in increased expression of GLI2 mRNA CTD PMID:31533062 Gli2 Rat temozolomide decreases expression ISO RGD:1606840 6480464 Temozolomide results in decreased expression of GLI2 mRNA CTD PMID:31758290 Gli2 Rat testosterone multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of GLI2 mRNA CTD PMID:32741896 Gli2 Rat tetrachloromethane increases expression ISO RGD:1319523 6480464 Carbon Tetrachloride results in increased expression of GLI2 mRNA; Carbon Tetrachloride results in increased expression more ... CTD PMID:31816328|PMID:32996673 Gli2 Rat tetrachloromethane multiple interactions ISO RGD:1319523 6480464 GANT 61 inhibits the reaction [Carbon Tetrachloride results in increased expression of GLI2 mRNA]; GANT more ... CTD PMID:31816328|PMID:32996673 Gli2 Rat tetrachloromethane multiple interactions EXP 6480464 Colforsin inhibits the reaction [Carbon Tetrachloride results in increased expression of GLI2 mRNA] CTD PMID:27590029 Gli2 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of GLI2 mRNA CTD PMID:27590029 Gli2 Rat titanium dioxide increases methylation ISO RGD:1319523 6480464 titanium dioxide results in increased methylation of GLI2 gene CTD PMID:35295148 Gli2 Rat trichostatin A decreases expression ISO RGD:1606840 6480464 trichostatin A results in decreased expression of GLI2 mRNA CTD PMID:24935251|PMID:26272509 Gli2 Rat trichostatin A multiple interactions ISO RGD:1606840 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Gli2 Rat triptonide decreases expression ISO RGD:1319523 6480464 triptonide results in decreased expression of GLI2 mRNA CTD PMID:33045310 Gli2 Rat valproic acid increases expression ISO RGD:1606840 6480464 Valproic Acid results in increased expression of GLI2 mRNA CTD PMID:19101580 Gli2 Rat valproic acid multiple interactions ISO RGD:1606840 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Gli2 Rat valproic acid decreases expression ISO RGD:1606840 6480464 Valproic Acid results in decreased expression of GLI2 mRNA CTD PMID:23179753|PMID:26272509|PMID:28001369 Gli2 Rat valproic acid affects expression ISO RGD:1319523 6480464 Valproic Acid affects the expression of GLI2 mRNA CTD PMID:22045034 Gli2 Rat vinclozolin decreases methylation EXP 6480464 vinclozolin results in decreased methylation of GLI2 gene CTD PMID:31682807 Gli2 Rat vismodegib increases response to substance ISO RGD:1319523 6480464 GLI2 gene mutant form results in increased susceptibility to HhAntag691 CTD PMID:27585885 Gli2 Rat vismodegib decreases response to substance ISO RGD:1606840 6480464 GLI2 protein results in decreased susceptibility to HhAntag691 CTD PMID:24973920 Gli2 Rat vismodegib decreases expression ISO RGD:1319523 6480464 HhAntag691 results in decreased expression of GLI2 mRNA CTD PMID:24973920 Gli2 Rat vismodegib decreases expression ISO RGD:1606840 6480464 HhAntag691 results in decreased expression of GLI2 mRNA CTD PMID:22087285 Gli2 Rat vismodegib multiple interactions ISO RGD:1606840 6480464 [GLI1 mRNA co-treated with GLI2 mRNA] affects the reaction [HhAntag691 results in decreased expression of more ... CTD PMID:22087285|PMID:31181250 Gli2 Rat vismodegib multiple interactions ISO RGD:1319523 6480464 GLI2 gene mutant form promotes the reaction [HhAntag691 inhibits the reaction [SHH protein results in more ... CTD PMID:24973920|PMID:27585885 Gli2 Rat vitamin E increases expression ISO RGD:1606840 6480464 Vitamin E results in increased expression of GLI2 mRNA CTD PMID:19244175 Gli2 Rat zinc oxide increases expression ISO RGD:1319523 6480464 Zinc Oxide results in increased expression of GLI2 mRNA CTD PMID:33236829
Biological Process
Only show annotations with direct experimental evidence (0 objects hidden)
Gli2 Rat anatomical structure formation involved in morphogenesis acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:95729 PMID:9731531 RGD PMID:9731531 Gli2 Rat anterior/posterior pattern specification acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:95729 PMID:22841643 RGD PMID:22841643 Gli2 Rat axon guidance acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:1857509 PMID:10409510 RGD PMID:10409510 Gli2 Rat branching morphogenesis of an epithelial tube acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:1857509 PMID:9731531 RGD PMID:9731531 Gli2 Rat cell differentiation acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:1857509 PMID:9636069, PMID:9655799 RGD PMID:9636069|PMID:9655799 Gli2 Rat cell population proliferation acts_upstream_of ISO RGD:1319523 1624291 MGI:1857509|MGI:98297 PMID:15496441, PMID:16054035, PMID:9731531 RGD PMID:15496441|PMID:16054035|PMID:9731531 Gli2 Rat cellular response to virus involved_in ISO RGD:1606840|UniProtKB:P10070-1|UniProtKB:P10070-2|UniProtKB:P10070-3|UniProtKB:P10070-4 1624291 PMID:9557682 RGD PMID:9557682 Gli2 Rat cerebellar cortex morphogenesis acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:2446434|MGI:3664541|MGI:95727 PMID:16571625 RGD PMID:16571625 Gli2 Rat chondrocyte differentiation acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:1915509 PMID:23333501 RGD PMID:23333501 Gli2 Rat cochlea morphogenesis acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:1857509 PMID:17395647 RGD PMID:17395647 Gli2 Rat developmental growth acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:2446434|MGI:3664541 PMID:16571630 RGD PMID:16571630 Gli2 Rat dorsal/ventral neural tube patterning acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:1857509|MGI:2145349|MGI:2442827|MGI:95729 PMID:17395647, PMID:18590716, PMID:19286674, PMID:20159594, PMID:28817564, PMID:9247260 RGD PMID:17395647|PMID:18590716|PMID:19286674|PMID:20159594|PMID:28817564|PMID:9247260 Gli2 Rat dorsal/ventral pattern formation acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:95727 PMID:16342201 RGD PMID:16342201 Gli2 Rat embryonic digestive tract development acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:1857509 PMID:10693670 RGD PMID:10693670 Gli2 Rat embryonic digit morphogenesis acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:3834146 PMID:19056373 RGD PMID:19056373 Gli2 Rat epidermal cell differentiation involved_in ISO RGD:1606840,UniProtKB:P10070-2 1624291 PMID:12165851 RGD PMID:12165851 Gli2 Rat epithelial cell proliferation acts_upstream_of ISO RGD:1319523 1624291 MGI:1857509|MGI:98297 PMID:16054035, PMID:9731531 RGD PMID:16054035|PMID:9731531 Gli2 Rat floor plate formation acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:1857509 PMID:9636069, PMID:9655799 RGD PMID:9636069|PMID:9655799 Gli2 Rat gene expression involved_in ISO RGD:1319523 1624291 MGI:1857509 PMID:29659575 RGD PMID:29659575 Gli2 Rat gene expression acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:1857509 PMID:23201751 RGD PMID:23201751 Gli2 Rat hair follicle morphogenesis involved_in ISO RGD:1606840 1624291 PMID:15994174 RGD PMID:15994174 Gli2 Rat head development acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:3834146 PMID:19056373 RGD PMID:19056373 Gli2 Rat heart development acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:95729 PMID:11172440 RGD PMID:11172440 Gli2 Rat hindbrain development acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:1857164|MGI:1857509|MGI:98297 PMID:15496441, PMID:8575294 RGD PMID:15496441|PMID:8575294 Gli2 Rat hindgut morphogenesis acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:1857509|MGI:95729 PMID:11485934 RGD PMID:11485934 Gli2 Rat in utero embryonic development acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:3834146 PMID:19056373 RGD PMID:19056373 Gli2 Rat kidney development acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:95729 PMID:11172440 RGD PMID:11172440 Gli2 Rat lung development acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:1857509|MGI:95727 PMID:10725236, PMID:9731531 RGD PMID:10725236|PMID:9731531 Gli2 Rat mammary gland development acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:1857509 PMID:11783999 RGD PMID:11783999 Gli2 Rat mammary gland duct morphogenesis acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:1857509 PMID:11783999 RGD PMID:11783999 Gli2 Rat morphogenesis of an epithelium acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:1857509 PMID:16707121 RGD PMID:16707121 Gli2 Rat negative regulation of apoptotic process acts_upstream_of_or_within ISO RGD:1319523 1624291 PMID:19056373 RGD PMID:19056373 Gli2 Rat negative regulation of chondrocyte differentiation acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:1857509 PMID:17328886 RGD PMID:17328886 Gli2 Rat negative regulation of smoothened signaling pathway acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:1932386 PMID:28778798 RGD PMID:28778798 Gli2 Rat negative regulation of transcription by RNA polymerase II involved_in ISO RGD:1606840|UniProtKB:P10070-5 1624291 PMID:15994174 RGD PMID:15994174 Gli2 Rat negative regulation of transcription by RNA polymerase II acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:95727 PMID:16611981 RGD PMID:16611981 Gli2 Rat neural tube development acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:3834146 PMID:19056373 RGD PMID:19056373 Gli2 Rat neuron development acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:1857509 PMID:16267219 RGD PMID:16267219 Gli2 Rat neuron differentiation acts_upstream_of ISO RGD:1319523 1624291 MGI:97490 PMID:16950124 RGD PMID:16950124 Gli2 Rat notochord regression acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:95727 PMID:10725236 RGD PMID:10725236 Gli2 Rat odontogenesis of dentin-containing tooth acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:1857509|MGI:95729 PMID:9655803 RGD PMID:9655803 Gli2 Rat osteoblast development acts_upstream_of_or_within ISO RGD:1319523 1624291 PMID:16880529 RGD PMID:16880529 Gli2 Rat osteoblast differentiation involved_in ISO RGD:1606840,UniProtKB:P10070-2 1624291 PMID:12165851 RGD PMID:12165851 Gli2 Rat osteoblast differentiation acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:1915509 PMID:22771375 RGD PMID:22771375 Gli2 Rat pattern specification process acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:1857164|MGI:95729 PMID:14602680, PMID:8575294 RGD PMID:14602680|PMID:8575294 Gli2 Rat pituitary gland development acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:95727 PMID:10725236 RGD PMID:10725236 Gli2 Rat positive regulation of cell population proliferation acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:1857509|MGI:98297 PMID:15496441, PMID:19056373 RGD PMID:15496441|PMID:19056373 Gli2 Rat positive regulation of collagen biosynthetic process IMP 155791684 RGD Gli2 Rat positive regulation of DNA replication involved_in ISO RGD:1606840 1624291 PMID:12165851 RGD PMID:12165851 Gli2 Rat positive regulation of DNA-templated transcription involved_in ISO RGD:1319523 1624291 PMID:16254602, PMID:17035233 RGD PMID:16254602|PMID:17035233 Gli2 Rat positive regulation of DNA-templated transcription acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:1857509 PMID:15614767, PMID:17328886, PMID:18590716 RGD PMID:15614767|PMID:17328886|PMID:18590716 Gli2 Rat positive regulation of DNA-templated transcription involved_in ISO RGD:1606840 1624291 PMID:15175043 RGD PMID:15175043 Gli2 Rat positive regulation of DNA-templated transcription involved_in ISO RGD:1606840,UniProtKB:P10070-2 1624291 PMID:12165851 RGD PMID:12165851 Gli2 Rat positive regulation of epithelial cell proliferation acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:1857509|MGI:98297 PMID:16054035, PMID:9731531 RGD PMID:16054035|PMID:9731531 Gli2 Rat positive regulation of neuron differentiation acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:97490 PMID:16950124 RGD PMID:16950124 Gli2 Rat positive regulation of stem cell proliferation acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:1857509 PMID:9731531 RGD PMID:9731531 Gli2 Rat positive regulation of transcription by RNA polymerase II involved_in ISO RGD:1606840|UniProtKB:P10070-2|UniProtKB:P10070-3 1624291 PMID:16553965 RGD PMID:16553965 Gli2 Rat positive regulation of transcription by RNA polymerase II involved_in ISO RGD:1319523 1624291 PMID:16880529 RGD PMID:16880529 Gli2 Rat positive regulation of transcription by RNA polymerase II acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:98297 PMID:16880529, PMID:16950124 RGD PMID:16880529|PMID:16950124 Gli2 Rat positive regulation of transcription by RNA polymerase II involved_in ISO RGD:1606840|UniProtKB:P10070-2 1624291 PMID:12165851 RGD PMID:12165851 Gli2 Rat positive regulation of transcription by RNA polymerase II involved_in ISO RGD:1606840|UniProtKB:P10070-1 1624291 PMID:15994174 RGD PMID:15994174 Gli2 Rat positive regulation of transcription by RNA polymerase II involved_in ISO RGD:1606840|UniProtKB:P10070-1|UniProtKB:P10070-2|UniProtKB:P10070-3|UniProtKB:P10070-4 1624291 PMID:9557682 RGD PMID:9557682 Gli2 Rat prostate gland development IEP 1303367 RGD Gli2 Rat prostatic bud formation acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:1857509 PMID:16707121 RGD PMID:16707121 Gli2 Rat proximal/distal pattern formation acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:95727|MGI:95729 PMID:16342201 RGD PMID:16342201 Gli2 Rat regulation of cerebellar granule cell precursor proliferation acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:2446434|MGI:3664541|MGI:95727 PMID:16571625 RGD PMID:16571625 Gli2 Rat regulation of smoothened signaling pathway acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:2145349 PMID:28817564 RGD PMID:28817564 Gli2 Rat regulation of transcription by RNA polymerase II involved_in IBA FB:FBgn0004859|MGI:2386723|MGI:2444289|MGI:95727|MGI:95728|MGI:95729|PANTHER:PTN000456649|UniProtKB:P08151|UniProtKB:P10070|UniProtKB:P10071|ZFIN:ZDB-GENE-030321-1|ZFIN:ZDB-GENE-041111-162 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Gli2 Rat regulation of transcription by RNA polymerase II involved_in IEA InterPro:IPR043359 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Gli2 Rat response to mechanical stimulus IEP 2303055 RGD Gli2 Rat skeletal system development acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:1857509 PMID:9006072 RGD PMID:9006072 Gli2 Rat smoothened signaling pathway involved_in ISO RGD:1606840 1624291 PMID:15994174, PMID:31279575 RGD PMID:15994174|PMID:31279575 Gli2 Rat smoothened signaling pathway involved_in IBA MGI:95727|MGI:95728|MGI:95729|PANTHER:PTN001836086|UniProtKB:P08151|UniProtKB:P10070|UniProtKB:P10071|ZFIN:ZDB-GENE-030321-1|ZFIN:ZDB-GENE-990706-8 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Gli2 Rat smoothened signaling pathway acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:1857509|MGI:2446434|MGI:3664541|MGI:3834146|MGI:95727 PMID:16571625, PMID:19056373, PMID:19124651 RGD PMID:16571625|PMID:19056373|PMID:19124651 Gli2 Rat smoothened signaling pathway involved in dorsal/ventral neural tube patterning acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:2442827|MGI:95729 PMID:17395647, PMID:20159594 RGD PMID:17395647|PMID:20159594 Gli2 Rat smoothened signaling pathway involved in spinal cord motor neuron cell fate specification acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:95729 PMID:15215207 RGD PMID:15215207 Gli2 Rat smoothened signaling pathway involved in ventral spinal cord interneuron specification acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:95729 PMID:15215207 RGD PMID:15215207 Gli2 Rat spinal cord dorsal/ventral patterning acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:1857509|MGI:2158472|MGI:95729|MGI:99833 PMID:11748151, PMID:15215207, PMID:16364285 RGD PMID:11748151|PMID:15215207|PMID:16364285 Gli2 Rat spinal cord motor neuron cell fate specification acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:95729 PMID:15215207 RGD PMID:15215207 Gli2 Rat spinal cord motor neuron differentiation acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:1857509 PMID:21552265 RGD PMID:21552265 Gli2 Rat spinal cord ventral commissure morphogenesis acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:1857509 PMID:10409510 RGD PMID:10409510 Gli2 Rat stem cell proliferation acts_upstream_of ISO RGD:1319523 1624291 MGI:1857509 PMID:9731531 RGD PMID:9731531 Gli2 Rat tube development acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:95729 PMID:9731531 RGD PMID:9731531 Gli2 Rat ventral midline development acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:1857509|MGI:95727 PMID:10725236 RGD PMID:10725236 Gli2 Rat ventral spinal cord development acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:2158472 PMID:11748151 RGD PMID:11748151 Gli2 Rat ventral spinal cord interneuron specification acts_upstream_of_or_within ISO RGD:1319523 1624291 MGI:95729 PMID:15215207 RGD PMID:15215207
Cellular Component
Only show annotations with direct experimental evidence (0 objects hidden)
Gli2 Rat axoneme located_in ISO RGD:1319523 1624291 PMID:21209331 RGD PMID:21209331 Gli2 Rat centrosome located_in ISO RGD:1606840|UniProtKB:P10070-5 1624291 RGD GO_REF:0000052 Gli2 Rat ciliary basal body located_in ISO RGD:1606840|UniProtKB:P10070-5 1624291 RGD GO_REF:0000052 Gli2 Rat ciliary tip located_in ISO RGD:1319523 1624291 PMID:21653639, PMID:29038301 RGD PMID:21653639|PMID:29038301 Gli2 Rat cilium located_in ISO RGD:1319523 1624291 PMID:16254602, PMID:19286674, PMID:19654211, PMID:19684112, PMID:21209331, PMID:22689656, PMID:25644602, PMID:29487109 RGD PMID:16254602|PMID:19286674|PMID:19654211|PMID:19684112|PMID:21209331|PMID:22689656|PMID:25644602|PMID:29487109 Gli2 Rat cytoplasm located_in ISO RGD:1319523 1624291 MGI:1345643 PMID:16316410, PMID:19286674, PMID:19684112 RGD PMID:16316410|PMID:19286674|PMID:19684112 Gli2 Rat membrane located_in ISO RGD:1319523 1624291 PMID:19286674 RGD PMID:19286674 Gli2 Rat motile cilium located_in ISO RGD:1319523 1624291 PMID:18590716 RGD PMID:18590716 Gli2 Rat nuclear speck located_in ISO RGD:1319523 1624291 PMID:19684112 RGD PMID:19684112 Gli2 Rat nucleolus located_in ISO RGD:1606840|UniProtKB:P10070-5 1624291 RGD GO_REF:0000052 Gli2 Rat nucleoplasm located_in ISO RGD:1606840|UniProtKB:P10070-5 1624291 RGD GO_REF:0000052 Gli2 Rat nucleus located_in ISO RGD:1606840 1624291 PMID:26565916 RGD PMID:26565916 Gli2 Rat nucleus located_in IEA ARBA:ARBA00026330 1600115 GO_REF:0000117 UniProt GO_REF:0000117 Gli2 Rat nucleus located_in IEA UniProtKB-SubCell:SL-0191 1600115 GO_REF:0000044 UniProt GO_REF:0000044 Gli2 Rat nucleus located_in IEA InterPro:IPR043359 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Gli2 Rat nucleus is_active_in IBA FB:FBgn0004859|MGI:2386723|MGI:2444289|MGI:95727|MGI:95728|MGI:95729|PANTHER:PTN000456649|UniProtKB:P08151|UniProtKB:P10070|UniProtKB:P10071|ZFIN:ZDB-GENE-990706-8 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Gli2 Rat nucleus located_in ISO RGD:1319523 1624291 PMID:11238441, PMID:16254602, PMID:16316410, PMID:18590716, PMID:19286674, PMID:19684112, PMID:25808752 RGD PMID:11238441|PMID:16254602|PMID:16316410|PMID:18590716|PMID:19286674|PMID:19684112|PMID:25808752 Gli2 Rat nucleus located_in ISO RGD:1606840|UniProtKB:P10070-1|UniProtKB:P10070-4 1624291 PMID:9557682 RGD PMID:9557682
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
Gli2 Rat chromatin binding enables ISO RGD:1319523 1624291 PMID:16396903 RGD PMID:16396903 Gli2 Rat chromatin DNA binding enables ISO RGD:1319523 1624291 PMID:23201751 RGD PMID:23201751 Gli2 Rat DNA-binding transcription activator activity, RNA polymerase II-specific enables ISO RGD:1319523 1624291 PMID:16880529 RGD PMID:16880529 Gli2 Rat DNA-binding transcription factor activity enables ISO RGD:1606840 1624291 PMID:15994174 RGD PMID:15994174 Gli2 Rat DNA-binding transcription factor activity enables ISO RGD:1319523 1624291 PMID:16880529 RGD PMID:16880529 Gli2 Rat DNA-binding transcription factor activity enables ISO RGD:1606840|UniProtKB:P10070-1|UniProtKB:P10070-4 1624291 PMID:9557682 RGD PMID:9557682 Gli2 Rat DNA-binding transcription factor activity, RNA polymerase II-specific enables IBA FB:FBgn0004859|MGI:2386723|MGI:2444289|MGI:95727|MGI:95728|PANTHER:PTN000456649|ZFIN:ZDB-GENE-030321-1|ZFIN:ZDB-GENE-041111-162 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Gli2 Rat promoter-specific chromatin binding enables ISO RGD:1606840 1624291 PMID:26565916 RGD PMID:26565916 Gli2 Rat promoter-specific chromatin binding enables ISO RGD:1319523 1624291 PMID:25808752 RGD PMID:25808752 Gli2 Rat protein binding enables ISO RGD:1319523 1624291 PR:Q3ULA2|PR:Q6ZWS8|PR:Q9Z0P7|UniProtKB:P46684|UniProtKB:Q61572|UniProtKB:Q62520|UniProtKB:Q6ZWS8|UniProtKB:Q9UMX1 PMID:11238441, PMID:16611981, PMID:19286674, PMID:19684112, PMID:19955409, PMID:21211521, PMID:24217340, PMID:25808752 RGD PMID:11238441|PMID:16611981|PMID:19286674|PMID:19684112|PMID:19955409|PMID:21211521|PMID:24217340|PMID:25808752 Gli2 Rat protein binding enables ISO RGD:1606840 1624291 UniProtKB:P12755|UniProtKB:P84022|UniProtKB:Q12948|UniProtKB:Q99816|UniProtKB:Q9Y297 PMID:12435627, PMID:25670079, PMID:26565916, PMID:35044719 RGD PMID:12435627|PMID:25670079|PMID:26565916|PMID:35044719 Gli2 Rat RNA polymerase II cis-regulatory region sequence-specific DNA binding enables IBA MGI:2444289|MGI:95727|MGI:95728|PANTHER:PTN000456649|UniProtKB:P10071 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Gli2 Rat RNA polymerase II cis-regulatory region sequence-specific DNA binding enables ISO RGD:1319523 1624291 PMID:15614767, PMID:16880529 RGD PMID:15614767|PMID:16880529 Gli2 Rat RNA polymerase II transcription regulatory region sequence-specific DNA binding enables IEA InterPro:IPR043359 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Gli2 Rat sequence-specific DNA binding enables ISO RGD:1606840 1624291 PMID:15175043, PMID:26565916, PMID:9557682 RGD PMID:15175043|PMID:26565916|PMID:9557682 Gli2 Rat sequence-specific DNA binding enables ISO RGD:1319523 1624291 PMID:16611981 RGD PMID:16611981 Gli2 Rat sequence-specific DNA binding enables IEA ARBA:ARBA00026779 1600115 GO_REF:0000117 UniProt GO_REF:0000117 Gli2 Rat sequence-specific double-stranded DNA binding enables ISO RGD:1606840 1624291 PMID:28473536 RGD PMID:28473536 Gli2 Rat transcription cis-regulatory region binding enables ISO RGD:1319523 1624291 PMID:19124651 RGD PMID:19124651 Gli2 Rat zinc ion binding enables ISO RGD:1606840 1624291 PMID:8378770 RGD PMID:8378770 Gli2 Rat zinc ion binding enables IEA UniProtKB-KW:KW-0863 1600115 GO_REF:0000043 UniProt GO_REF:0000043
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(-)-epigallocatechin 3-gallate (ISO) 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO) 1,2-dichloroethane (ISO) 17beta-estradiol (EXP,ISO) 17beta-estradiol 3-benzoate (EXP) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4,4'-trichlorobiphenyl (ISO) 2,4-D (ISO) 3,3',4,4'-tetrachlorobiphenyl (ISO) 4-hydroperoxycyclophosphamide (ISO) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP) Ac-Ser-Asp-Lys-Pro-OH (EXP,ISO) acetaldehyde (ISO) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) aldehydo-D-glucose (ISO) all-trans-retinoic acid (ISO) antirheumatic drug (ISO) aristolochic acid A (ISO) Aroclor 1254 (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (EXP,ISO) aspartame (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) benzo[e]pyrene (ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) cadmium dichloride (ISO) captopril (EXP,ISO) carbamazepine (ISO) CGP 52608 (ISO) chromium(6+) (ISO) cisplatin (EXP,ISO) cocaine (EXP) colforsin daropate hydrochloride (EXP) copper atom (EXP) copper(0) (EXP) crotonaldehyde (ISO) curcumin (EXP) Cyclopamine (EXP) cyproconazole (ISO) D-glucose (ISO) dexamethasone (ISO) diarsenic trioxide (EXP,ISO) dibutyl phthalate (EXP) diethyl malate (ISO) disodium selenite (ISO) dorsomorphin (ISO) elemental selenium (ISO) embelin (ISO) endosulfan (EXP) ethanol (ISO) flusilazole (ISO) formaldehyde (ISO) FR900359 (ISO) fructose (ISO) furan (EXP) gallic acid (ISO) gemcitabine (ISO) gentamycin (EXP) glucose (ISO) goralatide (EXP,ISO) lipopolysaccharide (ISO) LY294002 (ISO) methapyrilene (ISO) methimazole (EXP) methoxychlor (EXP) methylisothiazolinone (ISO) methylmercury chloride (ISO) nitrofen (EXP) Nor-9-carboxy-delta9-THC (ISO) paracetamol (EXP,ISO) paraquat (EXP) PCB138 (ISO) potassium chromate (ISO) potassium dichromate (ISO) progesterone (ISO) quercetin (ISO) SB 431542 (ISO) selenium atom (ISO) silicon dioxide (EXP,ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) Soman (EXP) sonidegib (ISO) sunitinib (ISO) temozolomide (ISO) testosterone (EXP) tetrachloromethane (EXP,ISO) titanium dioxide (ISO) trichostatin A (ISO) triptonide (ISO) valproic acid (ISO) vinclozolin (EXP) vismodegib (ISO) vitamin E (ISO) zinc oxide (ISO)
1.
Hedgehog signaling update.
Cohen MM, Am J Med Genet A. 2010 Aug;152A(8):1875-914. doi: 10.1002/ajmg.a.32909.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
4.
Sonic hedgehog (SHH) and glioblastoma-2 (Gli-2) expressions are associated with poor jaundice-free survival in biliary atresia.
Jung HY, etal., J Pediatr Surg. 2015 Mar;50(3):371-6. doi: 10.1016/j.jpedsurg.2014.08.025. Epub 2014 Dec 20.
5.
Murine models of VACTERL syndrome: Role of sonic hedgehog signaling pathway.
Kim PC, etal., J Pediatr Surg. 2001 Feb;36(2):381-4. doi: 10.1053/jpsu.2001.20722.
6.
Suppression of hedgehog signaling regulates hepatic stellate cell activation and collagen secretion.
Li T, etal., Int J Clin Exp Pathol. 2015 Nov 1;8(11):14574-9. eCollection 2015.
7.
Genetic research and structural dysplasia assessment of anorectal malformations in neonatal male rats induced by di(n-butyl) phthalate.
Liu ZH, etal., Environ Toxicol. 2016 Mar;31(3):261-8. doi: 10.1002/tox.22040. Epub 2014 Sep 12.
8.
Sonic Hedgehog Signaling Affected by Promoter Hypermethylation Induces Aberrant Gli2 Expression in Spina Bifida.
Lu XL, etal., Mol Neurobiol. 2016 Oct;53(8):5413-24. doi: 10.1007/s12035-015-9447-0. Epub 2015 Oct 7.
9.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
10.
Frequent deregulations in the hedgehog signaling network and cross-talks with the epidermal growth factor receptor pathway involved in cancer progression and targeted therapies.
Mimeault M and Batra SK, Pharmacol Rev. 2010 Sep;62(3):497-524.
11.
Anorectal malformations caused by defects in sonic hedgehog signaling.
Mo R, etal., Am J Pathol. 2001 Aug;159(2):765-74.
12.
Biomechanical regulation of hedgehog signaling in vascular smooth muscle cells in vitro and in vivo.
Morrow D, etal., Am J Physiol Cell Physiol. 2007 Jan;292(1):C488-96. Epub 2006 Aug 30.
13.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
14.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
15.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
16.
Sonic hedgehog-patched Gli signaling in the developing rat prostate gland: lobe-specific suppression by neonatal estrogens reduces ductal growth and branching.
Pu Y, etal., Dev Biol 2004 Sep 15;273(2):257-75.
17.
GOA pipeline
RGD automated data pipeline
18.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
19.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
20.
Comprehensive gene review and curation
RGD comprehensive gene curation
21.
Defective sonic hedgehog signaling in esophageal atresia with tracheoesophageal fistula.
Spilde TL, etal., Surgery. 2003 Aug;134(2):345-50.
22.
Down-regulation of SHH/BMP4 signalling in human anorectal malformations.
Zhang J, etal., J Int Med Res. 2009 Nov-Dec;37(6):1842-50.
Gli2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 32,499,678 - 32,716,418 (-) NCBI GRCr8 mRatBN7.2 13 29,946,882 - 30,163,589 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 29,946,809 - 30,163,574 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 32,529,564 - 32,585,620 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 33,817,400 - 33,873,458 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 31,093,715 - 31,149,850 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 34,829,021 - 35,049,172 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 34,829,139 - 35,048,444 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 39,955,094 - 40,170,750 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 31,551,089 - 31,607,264 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 31,555,563 - 31,574,381 (-) NCBI Celera 13 29,844,054 - 29,900,050 (-) NCBI Celera Cytogenetic Map 13 q11 NCBI
GLI2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 120,735,868 - 120,992,653 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 120,735,623 - 120,992,653 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 121,493,444 - 121,750,229 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 121,266,327 - 121,466,321 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 2 114,879,848 - 115,075,199 (+) NCBI Celera Cytogenetic Map 2 q14.2 NCBI HuRef 2 113,876,969 - 114,072,693 (+) NCBI HuRef CHM1_1 2 121,559,011 - 121,754,271 (+) NCBI CHM1_1 T2T-CHM13v2.0 2 121,171,586 - 121,428,571 (+) NCBI T2T-CHM13v2.0
Gli2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 118,761,791 - 118,987,578 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 118,761,862 - 118,981,349 (-) Ensembl GRCm39 Ensembl GRCm38 1 118,834,061 - 119,054,405 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 118,834,132 - 119,053,619 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 120,730,638 - 120,950,196 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 120,661,607 - 120,881,165 (-) NCBI MGSCv36 mm8 Celera 1 121,494,112 - 121,713,823 (-) NCBI Celera Cytogenetic Map 1 E2.3 NCBI cM Map 1 52.17 NCBI
Gli2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955459 8,892,869 - 9,118,499 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955459 8,892,917 - 9,124,672 (-) NCBI ChiLan1.0 ChiLan1.0
GLI2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 13 22,735,243 - 22,992,365 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2B 22,750,199 - 23,007,333 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2B 7,665,403 - 7,922,840 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2B 121,242,932 - 121,499,411 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2B 121,303,831 - 121,497,442 (+) Ensembl panpan1.1 panPan2
GLI2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 19 29,128,401 - 29,383,324 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 19 29,130,227 - 29,383,658 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 19 29,385,203 - 29,640,495 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 19 30,500,404 - 30,754,986 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 19 30,501,230 - 30,755,556 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 19 29,191,227 - 29,444,875 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 19 29,361,839 - 29,547,733 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 19 30,542,746 - 30,798,466 (-) NCBI UU_Cfam_GSD_1.0
Gli2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405303 91,769,648 - 92,002,404 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936469 49,617,095 - 49,673,213 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936469 49,616,552 - 49,788,760 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
GLI2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 15 30,313,817 - 30,579,306 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 15 30,312,528 - 30,580,272 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 15 35,267,097 - 35,303,278 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
GLI2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 10 9,302,890 - 9,561,287 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 10 9,304,645 - 9,369,115 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666061 13,127,973 - 13,388,785 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Gli2
.
Predicted Target Of
Count of predictions: 771 Count of miRNA genes: 313 Interacting mature miRNAs: 402 Transcripts: ENSRNOT00000009963 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2317027 Aia22 Adjuvant induced arthritis QTL 22 2.29 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 13 1 34266636 Rat 2302275 Gluco37 Glucose level QTL 37 3.8 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 13 11929449 46193066 Rat 7207885 Glom27 Glomerulus QTL 27 3.9 kidney glomerulus integrity trait (VT:0010546) kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139) 13 20605871 101339738 Rat 1558644 Cm45 Cardiac mass QTL 45 3.6 0.002 heart mass (VT:0007028) heart wet weight (CMO:0000069) 13 23692969 68692969 Rat 9589141 Insul28 Insulin level QTL 28 10.82 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 13 9313465 54313465 Rat 2317034 Aia9 Adjuvant induced arthritis QTL 9 4.62 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 13 11766535 32331607 Rat 1581554 Pur11 Proteinuria QTL 11 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 5994833 77046787 Rat 61391 Bp5 Blood pressure QTL 5 5.6 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 13 22301875 67301875 Rat 1300163 Cardf1 Cardiac cell morphology QTL 1 4.18 aorta morphology trait (VT:0000272) artery lesion measurement (CMO:0000975) 13 11929449 45417941 Rat 631672 Iddm12 Insulin dependent diabetes mellitus QTL 12 2.2 0.0032 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 13 5994668 34535351 Rat 2317040 Aia21 Adjuvant induced arthritis QTL 21 2.75 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 13 9831541 54831541 Rat 6893338 Cm76 Cardiac mass QTL 76 0 0.99 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 13 23692969 68692969 Rat 631645 Bp121 Blood pressure QTL 121 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 14915655 59915655 Rat 2317046 Aia8 Adjuvant induced arthritis QTL 8 3.9700000286102295 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 13 9831541 54831541 Rat 2317044 Aia23 Adjuvant induced arthritis QTL 23 2.3 joint integrity trait (VT:0010548) ankle joint diameter (CMO:0002148) 13 11766535 32331607 Rat 1581570 Eae17 Experimental allergic encephalomyelitis QTL 17 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 13 8897350 101631289 Rat 61339 Bp24 Blood pressure QTL 24 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 5994668 44807491 Rat 70170 Eae14 Experimental allergic encephalomyelitis QTL 14 0.0024 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 13 23203448 68203448 Rat 1331784 Bp222 Blood pressure QTL 222 2.944 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 17694436 53050594 Rat 1581573 Uae36 Urinary albumin excretion QTL 36 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 5994833 77046787 Rat 1354666 Bp244 Blood pressure QTL 244 4.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 1 101056920 Rat 9589164 Gluco66 Glucose level QTL 66 6.67 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 13 15158722 60158722 Rat 738036 Lnnr4 Liver neoplastic nodule remodeling QTL 4 3.64 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number (CMO:0001461) 13 1 42356786 Rat 7411662 Foco29 Food consumption QTL 29 20.8 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 13 9313465 54313465 Rat
D13M1Mit189
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 13 30,094,422 - 30,094,583 (+) MAPPER mRatBN7.2 Rnor_6.0 13 34,979,897 - 34,980,057 NCBI Rnor6.0 Rnor_5.0 13 40,103,087 - 40,103,247 UniSTS Rnor5.0 RGSC_v3.4 13 31,699,189 - 31,699,349 UniSTS RGSC3.4 Celera 13 29,993,046 - 29,993,206 UniSTS Cytogenetic Map 13 q11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000009963 ⟹ ENSRNOP00000009963
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 29,946,809 - 30,163,574 (-) Ensembl Rnor_6.0 Ensembl 13 34,829,139 - 35,048,444 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000104979 ⟹ ENSRNOP00000093230
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 29,947,623 - 30,163,340 (-) Ensembl
RefSeq Acc Id:
NM_001107169 ⟹ NP_001100639
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 32,499,678 - 32,716,418 (-) NCBI mRatBN7.2 13 29,946,882 - 30,163,589 (-) NCBI Rnor_6.0 13 34,829,021 - 34,885,485 (-) NCBI Rnor_5.0 13 39,955,094 - 40,170,750 (-) NCBI RGSC_v3.4 13 31,551,089 - 31,607,264 (-) RGD Celera 13 29,844,054 - 29,900,050 (-) RGD
Sequence:
GTTCCTCAGCAGCTCCTGCCATCTTTCCACGTGCCTTTGCCGATTGACATGAGACACCAGGAGGGAAGGTACCATTATGACCCTCACCCTGTCCACGGTGTGCACGGGCCTCCCACGCTAAGTGGCAG
hide sequence
RefSeq Acc Id:
XM_039090669 ⟹ XP_038946597
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 32,499,678 - 32,663,884 (-) NCBI mRatBN7.2 13 29,948,464 - 30,111,037 (-) NCBI
RefSeq Acc Id:
NP_001100639 ⟸ NM_001107169
- UniProtKB:
A6K7W2 (UniProtKB/TrEMBL), F1M2B7 (UniProtKB/TrEMBL)
- Sequence:
MRHQEGRYHYDPHPVHGVHGPPTLSGSPVISDISLIRLSPHPAGPGESPFSAHHPYMNPHMEHYLRSVHSSPTLSMISAARGLSPADVAHEHLKERGLFSLAAPGTNPSDYYHQMTLMASHPTPYGDI
hide sequence
Ensembl Acc Id:
ENSRNOP00000009963 ⟸ ENSRNOT00000009963
RefSeq Acc Id:
XP_038946597 ⟸ XM_039090669
- Peptide Label:
isoform X1
- UniProtKB:
A6K7W2 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000093230 ⟸ ENSRNOT00000104979
RGD ID: 13698761 Promoter ID: EPDNEW_R9286 Type: multiple initiation site Name: Gli2_1 Description: GLI family zinc finger 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 13 35,048,525 - 35,048,585 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2009-03-24
Gli2
GLI family zinc finger 2
Gli2
GLI-Kruppel family member GLI2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Gli2
GLI-Kruppel family member GLI2
Gli2_predicted
GLI-Kruppel family member GLI2 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Gli2_predicted
GLI-Kruppel family member GLI2 (predicted)
Symbol and Name status set to approved
70820 APPROVED
