Symbol:
Dhx36
Name:
DEAH-box helicase 36
RGD ID:
1308767
Description:
Enables pre-miRNA binding activity. Involved in positive regulation of dendritic spine morphogenesis; positive regulation of gene expression; and positive regulation of intracellular mRNA localization. Located in axon; dendrite; and perikaryon. Orthologous to human DHX36 (DEAH-box helicase 36); PARTICIPATES IN RNA degradation pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene; 4-amino-2,6-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
ATP-dependent DNA/RNA helicase DHX36; ATP-dependent RNA helicase DHX36; DEAD/H box polypeptide 36; DEAH (Asp-Glu-Ala-His) box polypeptide 36; DEAH-box protein 36; G4-resolvase-1; G4R1; LOC310461; MLE-like protein 1; probable ATP-dependent RNA helicase DHX36
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
DHX36 (DEAH-box helicase 36) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Dhx36 (DEAH-box helicase 36) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Dhx36 (DEAH-box helicase 36) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
DHX36 (DEAH-box helicase 36) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
DHX36 (DEAH-box helicase 36) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Dhx36 (DEAH-box helicase 36) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
DHX36 (DEAH-box helicase 36) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
DHX36 (DEAH-box helicase 36) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Dhx36 (DEAH-box helicase 36) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
DHX36 (DEAH-box helicase 36)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Dhx36 (DEAH-box helicase 36)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
dhx36 (DEAH (Asp-Glu-Ala-His) box polypeptide 36)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
YLR419W
Alliance
DIOPT (InParanoid|OrthoInspector|SonicParanoid)
Drosophila melanogaster (fruit fly):
Rhau
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
dhx36
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 149,006,089 - 149,044,192 (-) NCBI GRCr8 mRatBN7.2 2 146,856,469 - 146,894,577 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 146,856,469 - 146,894,572 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 153,533,266 - 153,574,345 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 151,638,135 - 151,676,173 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 146,270,518 - 146,308,556 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 152,785,844 - 152,824,549 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 152,785,844 - 152,824,547 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 172,178,850 - 172,217,986 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 152,122,767 - 152,161,219 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 152,075,160 - 152,111,181 (-) NCBI Celera 2 141,195,467 - 141,233,553 (-) NCBI Celera Cytogenetic Map 2 q31 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Dhx36 Rat (1->4)-beta-D-glucan multiple interactions ISO RGD:1318733 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of DHX36 mRNA CTD PMID:36331819 Dhx36 Rat (S)-nicotine increases expression ISO RGD:1318733 6480464 Nicotine results in increased expression of DHX36 mRNA CTD PMID:17997037 Dhx36 Rat 1,2-dimethylhydrazine decreases expression ISO RGD:1318733 6480464 1,2-Dimethylhydrazine results in decreased expression of DHX36 mRNA CTD PMID:22206623 Dhx36 Rat 1-chloro-2,4-dinitrobenzene affects binding ISO RGD:1318732 6480464 Dinitrochlorobenzene binds to DHX36 protein CTD PMID:32991956 Dhx36 Rat 17beta-estradiol increases expression ISO RGD:1318733 6480464 Estradiol results in increased expression of DHX36 mRNA CTD PMID:39298647 Dhx36 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO RGD:1318732 6480464 2,2',4,4'-tetrabromodiphenyl ether results in decreased expression of DHX36 protein CTD PMID:31675489 Dhx36 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1318733 6480464 Tetrachlorodibenzodioxin results in increased expression of DHX36 mRNA CTD PMID:19465110 Dhx36 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of DHX36 mRNA CTD PMID:34747641 Dhx36 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1318733 6480464 Tetrachlorodibenzodioxin affects the expression of DHX36 mRNA CTD PMID:21570461 Dhx36 Rat 2,4,6-tribromophenol decreases expression ISO RGD:1318732 6480464 2,4,6-tribromophenol results in decreased expression of DHX36 mRNA CTD PMID:31675489 Dhx36 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2,6-dinitrotoluene affects the expression of DHX36 mRNA CTD PMID:21346803 Dhx36 Rat 2-methylcholine affects expression ISO RGD:1318732 6480464 beta-methylcholine affects the expression of DHX36 mRNA CTD PMID:21179406 Dhx36 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO RGD:1318732 6480464 tetrabromobisphenol A results in decreased expression of DHX36 protein CTD PMID:31675489 Dhx36 Rat 4,4'-diaminodiphenylmethane decreases expression ISO RGD:1318733 6480464 4,4'-diaminodiphenylmethane results in decreased expression of DHX36 mRNA CTD PMID:18648102 Dhx36 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:1318733 6480464 bisphenol S results in increased expression of DHX36 mRNA CTD PMID:39298647 Dhx36 Rat 4-amino-2,6-dinitrotoluene affects expression EXP 6480464 4-amino-2,6-dinitrotoluene affects the expression of DHX36 mRNA CTD PMID:21346803 Dhx36 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of DHX36 mRNA CTD PMID:38685447 Dhx36 Rat aristolochic acid A decreases expression ISO RGD:1318732 6480464 aristolochic acid I results in decreased expression of DHX36 mRNA CTD PMID:33212167 Dhx36 Rat arsane multiple interactions ISO RGD:1318732 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Dhx36 Rat arsenic atom multiple interactions ISO RGD:1318732 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Dhx36 Rat arsenite(3-) decreases expression ISO RGD:1318733 6480464 arsenite results in decreased expression of DHX36 protein CTD PMID:37955338 Dhx36 Rat benzo[a]pyrene increases expression ISO RGD:1318733 6480464 Benzo(a)pyrene results in increased expression of DHX36 mRNA CTD PMID:22228805 Dhx36 Rat benzo[a]pyrene increases methylation ISO RGD:1318732 6480464 Benzo(a)pyrene results in increased methylation of DHX36 promoter CTD PMID:27901495 Dhx36 Rat benzo[a]pyrene diol epoxide I decreases expression ISO RGD:1318732 6480464 7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in decreased expression of DHX36 mRNA CTD PMID:20018196 Dhx36 Rat bis(2-ethylhexyl) phthalate decreases expression ISO RGD:1318733 6480464 Diethylhexyl Phthalate results in decreased expression of DHX36 mRNA CTD PMID:33754040 Dhx36 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of DHX36 mRNA CTD PMID:25181051|PMID:30816183|PMID:33296240|PMID:34947998 Dhx36 Rat bisphenol A decreases expression ISO RGD:1318732 6480464 bisphenol A results in decreased expression of DHX36 protein CTD PMID:31675489|PMID:37567409 Dhx36 Rat bisphenol A decreases expression ISO RGD:1318733 6480464 bisphenol A results in decreased expression of DHX36 mRNA CTD PMID:33221593 Dhx36 Rat C60 fullerene increases expression EXP 6480464 fullerene C60 results in increased expression of DHX36 mRNA CTD PMID:19167457 Dhx36 Rat cadmium atom multiple interactions ISO RGD:1318732 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of DHX36 more ... CTD PMID:35301059 Dhx36 Rat cadmium atom multiple interactions ISO RGD:1318733 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of DHX36 more ... CTD PMID:37325564 Dhx36 Rat cadmium dichloride multiple interactions ISO RGD:1318732 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of DHX36 more ... CTD PMID:35301059 Dhx36 Rat cadmium dichloride multiple interactions ISO RGD:1318733 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of DHX36 more ... CTD PMID:37325564 Dhx36 Rat caffeine affects phosphorylation ISO RGD:1318732 6480464 Caffeine affects the phosphorylation of DHX36 protein CTD PMID:35688186 Dhx36 Rat chloroprene increases expression EXP 6480464 Chloroprene results in increased expression of DHX36 mRNA CTD PMID:23125180 Dhx36 Rat chlorpyrifos decreases expression ISO RGD:1318733 6480464 Chlorpyrifos results in decreased expression of DHX36 mRNA CTD PMID:37019170 Dhx36 Rat copper(II) sulfate increases expression ISO RGD:1318732 6480464 Copper Sulfate results in increased expression of DHX36 mRNA CTD PMID:19549813 Dhx36 Rat coumarin increases phosphorylation ISO RGD:1318732 6480464 coumarin results in increased phosphorylation of DHX36 protein CTD PMID:35688186 Dhx36 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of DHX36 mRNA CTD PMID:27523638 Dhx36 Rat cyclosporin A increases expression ISO RGD:1318732 6480464 Cyclosporine results in increased expression of DHX36 mRNA CTD PMID:25562108 Dhx36 Rat decabromodiphenyl ether decreases expression ISO RGD:1318732 6480464 decabromobiphenyl ether results in decreased expression of DHX36 protein CTD PMID:31675489 Dhx36 Rat Dibutyl phosphate affects expression ISO RGD:1318732 6480464 di-n-butylphosphoric acid affects the expression of DHX36 mRNA CTD PMID:37042841 Dhx36 Rat disodium selenite increases expression ISO RGD:1318732 6480464 Sodium Selenite results in increased expression of DHX36 mRNA CTD PMID:18175754 Dhx36 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of DHX36 mRNA CTD PMID:25152437 Dhx36 Rat doxorubicin decreases expression ISO RGD:1318732 6480464 Doxorubicin results in decreased expression of DHX36 mRNA CTD PMID:29803840 Dhx36 Rat doxorubicin multiple interactions ISO RGD:1318732 6480464 [VRK1 protein affects the susceptibility to Doxorubicin] which affects the phosphorylation of DHX36 protein CTD PMID:38367682 Dhx36 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of DHX36 mRNA CTD PMID:24136188 Dhx36 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of DHX36 mRNA CTD PMID:24136188 Dhx36 Rat folic acid decreases expression ISO RGD:1318733 6480464 Folic Acid results in decreased expression of DHX36 mRNA CTD PMID:25629700 Dhx36 Rat FR900359 increases phosphorylation ISO RGD:1318732 6480464 FR900359 results in increased phosphorylation of DHX36 protein CTD PMID:37730182 Dhx36 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of DHX36 mRNA CTD PMID:22061828 Dhx36 Rat haloperidol decreases expression ISO RGD:1318732 6480464 Haloperidol results in decreased expression of DHX36 protein CTD PMID:34122009 Dhx36 Rat ivermectin decreases expression ISO RGD:1318732 6480464 Ivermectin results in decreased expression of DHX36 protein CTD PMID:32959892 Dhx36 Rat kainic acid increases expression ISO RGD:1318733 6480464 Kainic Acid results in increased expression of DHX36 mRNA CTD PMID:17997037 Dhx36 Rat ketamine decreases expression EXP 6480464 Ketamine results in decreased expression of DHX36 mRNA CTD PMID:20080153 Dhx36 Rat manganese atom multiple interactions ISO RGD:1318732 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Dhx36 Rat manganese(0) multiple interactions ISO RGD:1318732 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Dhx36 Rat manganese(II) chloride multiple interactions ISO RGD:1318732 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Dhx36 Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of DHX36 mRNA CTD PMID:30467583 Dhx36 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of DHX36 mRNA CTD PMID:38685447 Dhx36 Rat methylparaben increases expression ISO RGD:1318732 6480464 methylparaben results in increased expression of DHX36 mRNA CTD PMID:31745603 Dhx36 Rat miconazole decreases expression ISO RGD:1318733 6480464 Miconazole results in decreased expression of DHX36 mRNA CTD PMID:27462272 Dhx36 Rat nicotine increases expression ISO RGD:1318733 6480464 Nicotine results in increased expression of DHX36 mRNA CTD PMID:17997037 Dhx36 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of DHX36 mRNA CTD PMID:25729387 Dhx36 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:1318733 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of DHX36 mRNA CTD PMID:36331819 Dhx36 Rat phenobarbital decreases expression ISO RGD:1318733 6480464 Phenobarbital results in decreased expression of DHX36 mRNA CTD PMID:23091169 Dhx36 Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of DHX36 mRNA CTD PMID:19162173 Dhx36 Rat pregnenolone 16alpha-carbonitrile decreases expression EXP 6480464 Pregnenolone Carbonitrile results in decreased expression of DHX36 mRNA CTD PMID:19162173 Dhx36 Rat resveratrol multiple interactions ISO RGD:1318732 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of DHX36 mRNA CTD PMID:23557933 Dhx36 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of DHX36 mRNA CTD PMID:19013527 Dhx36 Rat SB 431542 multiple interactions ISO RGD:1318732 6480464 [LDN 193189 co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in decreased expression of DHX36 more ... CTD PMID:37664457 Dhx36 Rat sodium arsenite multiple interactions ISO RGD:1318732 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Dhx36 Rat sodium arsenite increases activity ISO RGD:1318732 6480464 sodium arsenite results in increased activity of DHX36 protein CTD PMID:30528433 Dhx36 Rat sulindac increases expression EXP 6480464 Sulindac results in increased expression of DHX36 mRNA CTD PMID:24136188 Dhx36 Rat thapsigargin increases expression ISO RGD:1318733 6480464 Thapsigargin results in increased expression of DHX36 protein CTD PMID:24648495 Dhx36 Rat thapsigargin increases expression EXP 6480464 Thapsigargin results in increased expression of DHX36 protein CTD PMID:35544339 Dhx36 Rat thimerosal increases expression ISO RGD:1318732 6480464 Thimerosal results in increased expression of DHX36 mRNA CTD PMID:27188386 Dhx36 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of DHX36 mRNA CTD PMID:25729387 Dhx36 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of DHX36 mRNA CTD PMID:33387578 Dhx36 Rat triphenyl phosphate affects expression ISO RGD:1318732 6480464 triphenyl phosphate affects the expression of DHX36 mRNA CTD PMID:37042841 Dhx36 Rat troglitazone decreases expression ISO RGD:1318733 6480464 troglitazone results in decreased expression of DHX36 mRNA CTD PMID:28973697 Dhx36 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of DHX36 mRNA CTD PMID:19015723 Dhx36 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of DHX36 mRNA CTD PMID:20566332|PMID:23034163 Dhx36 Rat vorinostat decreases expression ISO RGD:1318732 6480464 vorinostat results in decreased expression of DHX36 mRNA CTD PMID:27188386
Cellular Component
Only show annotations with direct experimental evidence (0 objects hidden)
Dhx36 Rat axon located_in IDA 13792545 PMID:23651854 UniProt Dhx36 Rat axon located_in IEA UniProtKB-SubCell:SL-0279 1600115 GO_REF:0000044 UniProt GO_REF:0000044 Dhx36 Rat cell projection located_in IEA UniProtKB-KW:KW-0966 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Dhx36 Rat chromosome located_in IEA UniProtKB-KW:KW-0158 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Dhx36 Rat chromosome, telomeric region located_in ISO RGD:1318732 1624291 PMID:20472641, PMID:21846770 RGD PMID:20472641|PMID:21846770 Dhx36 Rat chromosome, telomeric region located_in IEA UniProtKB:Q9H2U1|ensembl:ENSP00000417078 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Dhx36 Rat chromosome, telomeric region located_in IEA UniProtKB-SubCell:SL-0276 1600115 GO_REF:0000044 UniProt GO_REF:0000044 Dhx36 Rat chromosome, telomeric region located_in IEA UniProtKB-KW:KW-0779 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Dhx36 Rat chromosome, telomeric region located_in ISS UniProtKB:Q9H2U1 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Dhx36 Rat cytoplasm located_in ISO RGD:1318732 1624291 PMID:14731398, PMID:18279852, PMID:18854321, PMID:20696886 RGD PMID:14731398|PMID:18279852|PMID:18854321|PMID:20696886 Dhx36 Rat cytoplasm located_in IEA UniProtKB:Q9H2U1|ensembl:ENSP00000417078 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Dhx36 Rat cytoplasm located_in IEA UniProtKB-SubCell:SL-0086 1600115 GO_REF:0000044 UniProt GO_REF:0000044 Dhx36 Rat cytoplasm is_active_in IBA MGI:1919412|MGI:1920081|PANTHER:PTN002707150|UniProtKB:Q7L2E3|UniProtKB:Q9H2U1 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Dhx36 Rat cytoplasm located_in ISS UniProtKB:Q9H2U1 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Dhx36 Rat cytoplasm located_in IEA UniProtKB-KW:KW-0963 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Dhx36 Rat cytoplasmic stress granule located_in ISO RGD:1318732 1624291 PMID:18854321 RGD PMID:18854321 Dhx36 Rat cytoplasmic stress granule located_in IEA UniProtKB-SubCell:SL-0496 1600115 GO_REF:0000044 UniProt GO_REF:0000044 Dhx36 Rat cytoplasmic stress granule located_in IEA UniProtKB:Q9H2U1|ensembl:ENSP00000417078 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Dhx36 Rat cytosol located_in ISO RGD:1318732|UniProtKB:Q9H2U1-1|UniProtKB:Q9H2U1-2|UniProtKB:Q9H2U1-3 1624291 RGD GO_REF:0000052 Dhx36 Rat cytosol located_in IEA UniProtKB:Q9H2U1|ensembl:ENSP00000417078 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Dhx36 Rat cytosol located_in IEA UniProtKB:Q8VHK9|ensembl:ENSMUSP00000029336 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Dhx36 Rat cytosol located_in ISO RGD:1318733 1624291 PMID:21703541 RGD PMID:21703541 Dhx36 Rat cytosol located_in ISS UniProtKB:Q8VHK9 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Dhx36 Rat cytosol located_in IEA UniProtKB-SubCell:SL-0091 1600115 GO_REF:0000044 UniProt GO_REF:0000044 Dhx36 Rat dendrite located_in IDA 13792545 PMID:23651854 UniProt Dhx36 Rat dendrite located_in IEA UniProtKB-SubCell:SL-0283 1600115 GO_REF:0000044 UniProt GO_REF:0000044 Dhx36 Rat mitochondrion located_in IEA UniProtKB-SubCell:SL-0173 1600115 GO_REF:0000044 UniProt GO_REF:0000044 Dhx36 Rat mitochondrion located_in IEA UniProtKB-KW:KW-0496 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Dhx36 Rat nuclear speck located_in ISS UniProtKB:Q9H2U1 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Dhx36 Rat nuclear speck located_in IEA UniProtKB:Q9H2U1|ensembl:ENSP00000417078 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Dhx36 Rat nuclear speck located_in IEA UniProtKB-SubCell:SL-0186 1600115 GO_REF:0000044 UniProt GO_REF:0000044 Dhx36 Rat nuclear speck located_in ISO RGD:1318732 1624291 PMID:18279852 RGD PMID:18279852 Dhx36 Rat nucleoplasm located_in ISO RGD:1318732|UniProtKB:Q9H2U1-1|UniProtKB:Q9H2U1-2|UniProtKB:Q9H2U1-3 1624291 RGD GO_REF:0000052 Dhx36 Rat nucleoplasm located_in IEA UniProtKB:Q9H2U1|ensembl:ENSP00000417078 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Dhx36 Rat nucleus located_in IEA UniProtKB-SubCell:SL-0191 1600115 GO_REF:0000044 UniProt GO_REF:0000044 Dhx36 Rat nucleus located_in IEA UniProtKB-KW:KW-0539 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Dhx36 Rat nucleus is_active_in IBA PANTHER:PTN000717298|UniProtKB:Q9H2U1 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Dhx36 Rat nucleus located_in IEA UniProtKB:Q9H2U1|ensembl:ENSP00000417078 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Dhx36 Rat nucleus located_in ISO RGD:1318732 1624291 PMID:14731398, PMID:18279852, PMID:18854321 RGD PMID:14731398|PMID:18279852|PMID:18854321 Dhx36 Rat nucleus located_in ISS UniProtKB:Q9H2U1 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Dhx36 Rat perikaryon located_in IDA 13792545 PMID:23651854 UniProt Dhx36 Rat perikaryon located_in IEA UniProtKB-SubCell:SL-0197 1600115 GO_REF:0000044 UniProt GO_REF:0000044
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
Dhx36 Rat ATP binding enables ISS UniProtKB:Q05B79 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Dhx36 Rat ATP binding enables IEA InterPro:IPR011545 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Dhx36 Rat ATP binding enables IEA UniProtKB-KW:KW-0067 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Dhx36 Rat ATP hydrolysis activity enables IEA RHEA:13065 1600115 GO_REF:0000116 RHEA GO_REF:0000116 Dhx36 Rat ATP-dependent activity, acting on DNA enables ISO RGD:1318732 1624291 PMID:21586581 RGD PMID:21586581 Dhx36 Rat ATP-dependent activity, acting on DNA enables IEA UniProtKB:Q9H2U1|ensembl:ENSP00000417078 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Dhx36 Rat catalytic activity, acting on a nucleic acid enables IEA UniProtKB:Q8VHK9|ensembl:ENSMUSP00000029336 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Dhx36 Rat catalytic activity, acting on a nucleic acid enables IEA UniProtKB:Q9H2U1|ensembl:ENSP00000417078 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Dhx36 Rat catalytic activity, acting on a nucleic acid enables ISS UniProtKB:Q05B79 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Dhx36 Rat catalytic activity, acting on a nucleic acid enables ISO RGD:1318732 1624291 PMID:16150737, PMID:18842585 RGD PMID:16150737|PMID:18842585 Dhx36 Rat catalytic activity, acting on a nucleic acid enables ISS UniProtKB:Q8VHK9 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Dhx36 Rat catalytic activity, acting on a nucleic acid enables ISO RGD:1318733 1624291 PMID:25611385 RGD PMID:25611385 Dhx36 Rat DNA binding enables IEA UniProtKB-KW:KW-0238 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Dhx36 Rat DNA helicase activity enables ISS UniProtKB:Q8VHK9 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Dhx36 Rat DNA helicase activity enables ISO RGD:1318733 1624291 PMID:25611385 RGD PMID:25611385 Dhx36 Rat DNA helicase activity enables IBA FB:FBgn0032883|MGI:1919412|PANTHER:PTN001053965|UniProtKB:Q9H2U1 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Dhx36 Rat DNA helicase activity enables IEA UniProtKB:Q8VHK9|ensembl:ENSMUSP00000029336 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Dhx36 Rat DNA helicase activity enables IEA UniProtKB:Q9H2U1|ensembl:ENSP00000417078 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Dhx36 Rat DNA helicase activity enables ISO RGD:1318732 1624291 PMID:16150737, PMID:18842585, PMID:25579584 RGD PMID:16150737|PMID:18842585|PMID:25579584 Dhx36 Rat double-stranded RNA binding enables ISO RGD:1318732 1624291 PMID:21266579 RGD PMID:21266579 Dhx36 Rat double-stranded RNA binding enables IEA UniProtKB:Q8VHK9|ensembl:ENSMUSP00000029336 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Dhx36 Rat double-stranded RNA binding enables ISO RGD:1318733 1624291 PMID:21703541 RGD PMID:21703541 Dhx36 Rat double-stranded RNA binding enables IEA UniProtKB:Q9H2U1|ensembl:ENSP00000417078 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Dhx36 Rat G-quadruplex DNA binding enables ISO RGD:1318733 1624291 PMID:25611385 RGD PMID:25611385 Dhx36 Rat G-quadruplex DNA binding enables IEA UniProtKB:Q9H2U1|ensembl:ENSP00000417078 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Dhx36 Rat G-quadruplex DNA binding enables IEA UniProtKB:Q8VHK9|ensembl:ENSMUSP00000029336 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Dhx36 Rat G-quadruplex DNA binding enables IBA MGI:1919412|PANTHER:PTN000433435|UniProtKB:Q05B79|UniProtKB:Q9H2U1 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Dhx36 Rat G-quadruplex DNA binding enables ISO RGD:1318732 1624291 PMID:16150737, PMID:18842585, PMID:21586581, PMID:21993297, PMID:24151078 RGD PMID:16150737|PMID:18842585|PMID:21586581|PMID:21993297|PMID:24151078 Dhx36 Rat G-quadruplex DNA binding enables ISS UniProtKB:Q05B79 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Dhx36 Rat G-quadruplex DNA binding enables ISS UniProtKB:Q9H2U1 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Dhx36 Rat G-quadruplex DNA binding enables ISS UniProtKB:Q8VHK9 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Dhx36 Rat G-quadruplex RNA binding enables ISS UniProtKB:Q9H2U1 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Dhx36 Rat G-quadruplex RNA binding enables IBA FB:FBgn0032883|PANTHER:PTN001053965|UniProtKB:Q9H2U1 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Dhx36 Rat G-quadruplex RNA binding enables IEA UniProtKB:Q9H2U1|ensembl:ENSP00000417078 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Dhx36 Rat G-quadruplex RNA binding enables ISO RGD:1318732 1624291 PMID:18842585, PMID:20472641, PMID:21149580, PMID:21846770, PMID:22238380, PMID:24151078, PMID:24369427, PMID:25579584, PMID:26489465, PMID:27940037 RGD PMID:18842585|PMID:20472641|PMID:21149580|PMID:21846770|PMID:22238380|PMID:24151078|PMID:24369427|PMID:25579584|PMID:26489465|PMID:27940037 Dhx36 Rat helicase activity enables IEA UniProtKB-KW:KW-0347 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Dhx36 Rat histone deacetylase binding enables ISO RGD:1318733 1624291 PMID:21590736 RGD PMID:21590736 Dhx36 Rat histone deacetylase binding enables IEA UniProtKB:Q8VHK9|ensembl:ENSMUSP00000029336 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Dhx36 Rat hydrolase activity enables IEA UniProtKB-KW:KW-0378 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Dhx36 Rat magnesium ion binding enables ISS UniProtKB:Q9H2U1 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Dhx36 Rat magnesium ion binding enables IEA UniProtKB:Q9H2U1|ensembl:ENSP00000417078 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Dhx36 Rat magnesium ion binding enables ISO RGD:1318732 1624291 PMID:16150737, PMID:21846770 RGD PMID:16150737|PMID:21846770 Dhx36 Rat magnesium ion binding enables ISS UniProtKB:Q05B79 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Dhx36 Rat metal ion binding enables IEA UniProtKB-KW:KW-0479 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Dhx36 Rat mRNA 3'-UTR AU-rich region binding enables ISS UniProtKB:Q9H2U1 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Dhx36 Rat mRNA 3'-UTR AU-rich region binding enables IEA UniProtKB:Q9H2U1|ensembl:ENSP00000417078 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Dhx36 Rat mRNA 3'-UTR AU-rich region binding enables ISO RGD:1318732 1624291 PMID:14731398, PMID:26489465 RGD PMID:14731398|PMID:26489465 Dhx36 Rat mRNA 3'-UTR binding enables ISS UniProtKB:Q9H2U1 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Dhx36 Rat mRNA 3'-UTR binding enables IEA UniProtKB:Q9H2U1|ensembl:ENSP00000417078 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Dhx36 Rat mRNA 3'-UTR binding enables ISO RGD:1318732 1624291 PMID:24369427 RGD PMID:24369427 Dhx36 Rat mRNA 5'-UTR binding enables ISS UniProtKB:Q9H2U1 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Dhx36 Rat mRNA 5'-UTR binding enables IEA UniProtKB:Q9H2U1|ensembl:ENSP00000417078 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Dhx36 Rat mRNA 5'-UTR binding enables ISO RGD:1318732 1624291 PMID:26489465 RGD PMID:26489465 Dhx36 Rat nucleic acid binding enables IEA ARBA:ARBA00029220 1600115 GO_REF:0000117 UniProt GO_REF:0000117 Dhx36 Rat nucleic acid binding enables IEA InterPro:IPR011545 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Dhx36 Rat nucleotide binding enables IEA UniProtKB-KW:KW-0547 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Dhx36 Rat pre-miRNA binding enables IDA 13792545 PMID:23651854 UniProt Dhx36 Rat protein binding enables ISO RGD:1318732 1624291 UniProtKB:O14746|UniProtKB:O15379|UniProtKB:O60832|UniProtKB:O95453|UniProtKB:P17844|UniProtKB:Q01780|UniProtKB:Q03468|UniProtKB:Q12906|UniProtKB:Q13547|UniProtKB:Q15717|UniProtKB:Q92841|UniProtKB:Q99836|UniProtKB:Q9NQT5|UniProtKB:Q9UKV8|UniProtKB:Q9UL18 PMID:14731398, PMID:17932509, PMID:18279852, PMID:20696886, PMID:21846770, PMID:26030138, PMID:26489465 RGD PMID:14731398|PMID:17932509|PMID:18279852|PMID:20696886|PMID:21846770|PMID:26030138|PMID:26489465 Dhx36 Rat protein binding enables ISO RGD:1318733 1624291 PR:Q9JIK5|UniProtKB:Q6NZM9|UniProtKB:Q9JIK5 PMID:21590736, PMID:21703541 RGD PMID:21590736|PMID:21703541 Dhx36 Rat protein binding enables ISO RGD:1318732,UniProtKB:Q9H2U1-3 1624291 UniProtKB:P30519|UniProtKB:P62826 PMID:32814053 RGD PMID:32814053 Dhx36 Rat RNA binding enables ISO RGD:1318732 1624291 PMID:18854321 RGD PMID:18854321 Dhx36 Rat RNA binding enables IEA UniProtKB:Q9H2U1|ensembl:ENSP00000417078 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Dhx36 Rat RNA binding enables IEA UniProtKB-KW:KW-0694 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Dhx36 Rat RNA helicase activity enables ISS UniProtKB:Q9H2U1 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Dhx36 Rat RNA helicase activity enables IEA EC:3.6.4.13 1600115 GO_REF:0000003 UniProt GO_REF:0000003 Dhx36 Rat RNA helicase activity enables IBA FB:FBgn0032883|MGI:1920081|PANTHER:PTN001053965|UniProtKB:Q7L2E3|UniProtKB:Q9H2U1 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Dhx36 Rat RNA helicase activity enables IEA UniProtKB:Q9H2U1|ensembl:ENSP00000417078 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Dhx36 Rat RNA helicase activity enables ISO RGD:1318732 1624291 PMID:14731398, PMID:18842585, PMID:21846770 RGD PMID:14731398|PMID:18842585|PMID:21846770 Dhx36 Rat RNA polymerase II cis-regulatory region sequence-specific DNA binding enables ISS UniProtKB:Q8VHK9 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Dhx36 Rat RNA polymerase II cis-regulatory region sequence-specific DNA binding enables IEA UniProtKB:Q9H2U1|ensembl:ENSP00000417078 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Dhx36 Rat RNA polymerase II cis-regulatory region sequence-specific DNA binding enables IEA UniProtKB:Q8VHK9|ensembl:ENSMUSP00000029336 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Dhx36 Rat RNA polymerase II cis-regulatory region sequence-specific DNA binding enables ISO RGD:1318733 1624291 PMID:25611385 RGD PMID:25611385 Dhx36 Rat RNA polymerase II cis-regulatory region sequence-specific DNA binding enables ISS UniProtKB:Q9H2U1 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Dhx36 Rat RNA polymerase II cis-regulatory region sequence-specific DNA binding enables ISO RGD:1318732 1624291 PMID:21586581, PMID:21993297 RGD PMID:21586581|PMID:21993297 Dhx36 Rat single-stranded DNA binding enables ISO RGD:1318732 1624291 PMID:20696886 RGD PMID:20696886 Dhx36 Rat single-stranded DNA binding enables IEA UniProtKB:Q9H2U1|ensembl:ENSP00000417078 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Dhx36 Rat telomerase RNA binding enables ISS UniProtKB:Q9H2U1 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Dhx36 Rat telomerase RNA binding enables IEA UniProtKB:Q9H2U1|ensembl:ENSP00000417078 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Dhx36 Rat telomerase RNA binding enables ISO RGD:1318732 1624291 PMID:21149580, PMID:21846770, PMID:22238380 RGD PMID:21149580|PMID:21846770|PMID:22238380 Dhx36 Rat transcription cis-regulatory region binding enables ISO RGD:1318733 1624291 PMID:21590736 RGD PMID:21590736 Dhx36 Rat transcription cis-regulatory region binding enables IEA UniProtKB:Q8VHK9|ensembl:ENSMUSP00000029336 1600115 GO_REF:0000107 Ensembl GO_REF:0000107
Imported Annotations - KEGG (archival)
(1->4)-beta-D-glucan (ISO) (S)-nicotine (ISO) 1,2-dimethylhydrazine (ISO) 1-chloro-2,4-dinitrobenzene (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (ISO) 2,6-dinitrotoluene (EXP) 2-methylcholine (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-amino-2,6-dinitrotoluene (EXP) amitrole (EXP) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) C60 fullerene (EXP) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) chloroprene (EXP) chlorpyrifos (ISO) copper(II) sulfate (ISO) coumarin (ISO) Cuprizon (EXP) cyclosporin A (ISO) decabromodiphenyl ether (ISO) Dibutyl phosphate (ISO) disodium selenite (ISO) diuron (EXP) doxorubicin (ISO) finasteride (EXP) flutamide (EXP) folic acid (ISO) FR900359 (ISO) gentamycin (EXP) haloperidol (ISO) ivermectin (ISO) kainic acid (ISO) ketamine (EXP) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methapyrilene (EXP) methimazole (EXP) methylparaben (ISO) miconazole (ISO) nicotine (ISO) oxaliplatin (EXP) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) pirinixic acid (EXP) pregnenolone 16alpha-carbonitrile (EXP) resveratrol (ISO) rotenone (EXP) SB 431542 (ISO) sodium arsenite (ISO) sulindac (EXP) thapsigargin (EXP,ISO) thimerosal (ISO) topotecan (EXP) trichloroethene (EXP) triphenyl phosphate (ISO) troglitazone (ISO) vinclozolin (EXP) vorinostat (ISO)
Biological Process
3'-UTR-mediated mRNA destabilization (IEA,ISO,ISS) cell differentiation (IEA) cellular response to arsenite ion (IEA,ISO) cellular response to heat (IEA,ISO) cellular response to UV (IEA,ISO,ISS) defense response to virus (IEA) immune system process (IEA) innate immune response (IEA) negative regulation of translation (IEA,ISO,ISS) ossification (IEA,ISO) positive regulation of canonical NF-kappaB signal transduction (IEA,ISO,ISS) positive regulation of cardioblast differentiation (IEA,ISO,ISS) positive regulation of cytoplasmic translation (IEA,ISO,ISS) positive regulation of dendritic spine morphogenesis (IMP) positive regulation of gene expression (IMP) positive regulation of hematopoietic progenitor cell differentiation (IEA,ISO,ISS) positive regulation of interferon-alpha production (IEA,ISO) positive regulation of intracellular mRNA localization (IMP) positive regulation of mRNA 3'-end processing (IEA,ISO,ISS) positive regulation of myeloid dendritic cell cytokine production (IEA,ISO) positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay (IEA,ISO) positive regulation of telomere maintenance (IEA,ISO) positive regulation of telomere maintenance via telomere lengthening (IEA,ISO) positive regulation of transcription by RNA polymerase II (IEA,ISO,ISS) positive regulation of transcription initiation by RNA polymerase II (IEA,ISO,ISS) regulation of embryonic development (IEA,ISO,ISS) regulation of mRNA stability (IEA,ISO,ISS) regulation of transcription by RNA polymerase III (IEA,ISO,ISS) regulation of translation (IEA) response to exogenous dsRNA (IEA,ISO) response to virus (IEA,ISO) spermatogenesis (IEA,ISO,ISS) telomerase RNA stabilization (IEA,ISO)
Cellular Component
axon (IDA,IEA) cell projection (IEA) chromosome (IEA) chromosome, telomeric region (IEA,ISO,ISS) cytoplasm (IBA,IEA,ISO,ISS) cytoplasmic stress granule (IEA,ISO) cytosol (IEA,ISO,ISS) dendrite (IDA,IEA) mitochondrion (IEA) nuclear speck (IEA,ISO,ISS) nucleoplasm (IEA,ISO) nucleus (IBA,IEA,ISO,ISS) perikaryon (IDA,IEA)
Molecular Function
ATP binding (IEA,ISS) ATP hydrolysis activity (IEA) ATP-dependent activity, acting on DNA (IEA,ISO) catalytic activity, acting on a nucleic acid (IEA,ISO,ISS) DNA binding (IEA) DNA helicase activity (IBA,IEA,ISO,ISS) double-stranded RNA binding (IEA,ISO) G-quadruplex DNA binding (IBA,IEA,ISO,ISS) G-quadruplex RNA binding (IBA,IEA,ISO,ISS) helicase activity (IEA) histone deacetylase binding (IEA,ISO) hydrolase activity (IEA) magnesium ion binding (IEA,ISO,ISS) metal ion binding (IEA) mRNA 3'-UTR AU-rich region binding (IEA,ISO,ISS) mRNA 3'-UTR binding (IEA,ISO,ISS) mRNA 5'-UTR binding (IEA,ISO,ISS) nucleic acid binding (IEA) nucleotide binding (IEA) pre-miRNA binding (IDA) protein binding (ISO) RNA binding (IEA,ISO) RNA helicase activity (IBA,IEA,ISO,ISS) RNA polymerase II cis-regulatory region sequence-specific DNA binding (IEA,ISO,ISS) single-stranded DNA binding (IEA,ISO) telomerase RNA binding (IEA,ISO,ISS) transcription cis-regulatory region binding (IEA,ISO)
Dhx36 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 149,006,089 - 149,044,192 (-) NCBI GRCr8 mRatBN7.2 2 146,856,469 - 146,894,577 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 146,856,469 - 146,894,572 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 153,533,266 - 153,574,345 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 151,638,135 - 151,676,173 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 146,270,518 - 146,308,556 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 152,785,844 - 152,824,549 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 152,785,844 - 152,824,547 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 172,178,850 - 172,217,986 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 152,122,767 - 152,161,219 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 152,075,160 - 152,111,181 (-) NCBI Celera 2 141,195,467 - 141,233,553 (-) NCBI Celera Cytogenetic Map 2 q31 NCBI
DHX36 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 154,272,546 - 154,324,487 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 154,272,546 - 154,324,487 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 153,990,335 - 154,042,276 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 155,476,152 - 155,524,971 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 155,476,159 - 155,524,973 NCBI Celera 3 152,414,134 - 152,462,946 (-) NCBI Celera Cytogenetic Map 3 q25.2 NCBI HuRef 3 151,388,213 - 151,437,233 (-) NCBI HuRef CHM1_1 3 153,956,666 - 154,005,426 (-) NCBI CHM1_1 T2T-CHM13v2.0 3 157,046,825 - 157,098,745 (-) NCBI T2T-CHM13v2.0
Dhx36 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 62,375,436 - 62,414,464 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 62,375,434 - 62,414,425 (-) Ensembl GRCm39 Ensembl GRCm38 3 62,468,015 - 62,507,034 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 62,468,013 - 62,507,004 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 62,272,564 - 62,310,910 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 62,558,012 - 62,594,917 (-) NCBI MGSCv36 mm8 Celera 3 62,146,120 - 62,183,742 (-) NCBI Celera Cytogenetic Map 3 E1 NCBI cM Map 3 29.97 NCBI
Dhx36 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955448 5,634,072 - 5,676,319 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955448 5,634,072 - 5,676,272 (-) NCBI ChiLan1.0 ChiLan1.0
DHX36 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 152,190,111 - 152,241,082 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 152,194,843 - 152,245,768 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 151,331,468 - 151,382,406 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 158,885,041 - 158,935,952 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 158,885,541 - 158,935,871 (-) Ensembl panpan1.1 panPan2
DHX36 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 23 48,404,351 - 48,456,360 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 23 48,407,316 - 48,456,654 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 23 48,271,774 - 48,335,495 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 23 49,034,891 - 49,086,747 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 23 49,036,423 - 49,086,673 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 23 48,615,676 - 48,679,491 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 23 48,671,780 - 48,735,432 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 23 48,954,309 - 49,018,059 (-) NCBI UU_Cfam_GSD_1.0
Dhx36 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 87,746,909 - 87,787,083 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936519 1,946,652 - 1,987,070 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936519 1,946,684 - 1,987,036 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
DHX36 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 94,298,794 - 94,350,308 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 94,298,790 - 94,350,333 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 102,367,281 - 102,396,208 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
DHX36 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 15 36,387,242 - 36,438,133 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 15 36,387,228 - 36,437,606 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666041 9,049,856 - 9,103,295 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Dhx36
.
Predicted Target Of
Count of predictions: 562 Count of miRNA genes: 264 Interacting mature miRNAs: 338 Transcripts: ENSRNOT00000019824 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
1578648 Bss11 Bone structure and strength QTL 11 4.7 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 2 114837527 211674221 Rat 2293671 Bss44 Bone structure and strength QTL 44 10.97 0.0001 lumbar vertebra morphology trait (VT:0010494) lumbar vertebra cortical cross-sectional area (CMO:0001690) 2 43162366 148478373 Rat 631566 Bp90 Blood pressure QTL 90 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 102803808 147803808 Rat 1298074 Bp164 Blood pressure QTL 164 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 6907363 Bp357 Blood pressure QTL 357 4.1 0.002 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 129540907 174540907 Rat 1354648 Bp239 Blood pressure QTL 239 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118463 226797303 Rat 1358360 Sradr2 Stress Responsive Adrenal Weight QTL 2 10.24 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 2 129164097 152195315 Rat 1354649 Kidm17 Kidney mass QTL 17 2.9 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 2 81754530 227146641 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 1298076 Bp166 Blood pressure QTL 166 0.0009 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 136445150 202447032 Rat 152025245 Scl81 Serum cholesterol level QTL 81 3.49 blood cholesterol amount (VT:0000180) 2 122609194 206936711 Rat 1549828 Bp258 Blood pressure QTL 258 0.03 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 142323368 150650069 Rat 631198 Cm22 Cardiac mass QTL 22 4.3 0.0008 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 2 76539322 150540526 Rat 1554319 Bmd2 Bone mineral density QTL 2 13.4 0.0001 lumbar vertebra area (VT:0010570) lumbar vertebra cross-sectional area (CMO:0001689) 2 114837675 212549332 Rat 1581569 Uae32 Urinary albumin excretion QTL 32 0.0001 urine protein amount (VT:0005160) urine albumin excretion rate (CMO:0000757) 2 78665619 219826953 Rat 10043136 Iddm54 Insulin dependent diabetes mellitus QTL 54 3.4 0.0001 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 2 143657411 190602963 Rat 61467 Bp14 Blood pressure QTL 14 2.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 43154682 202446871 Rat 70175 BpQTLCluster3 Blood pressure QTL cluster 3 4.128 arterial blood pressure trait (VT:2000000) absolute change in systolic blood pressure (CMO:0000607) 2 135552573 202446871 Rat 1358901 Cm38 Cardiac mass QTL 38 2 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 1359030 Bp277 Blood pressure QTL 277 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 114837527 185876470 Rat 1331760 Bp206 Blood pressure QTL 206 3.62454 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 56043031 202447032 Rat 1581502 Esta3 Estrogen-induced thymic atrophy QTL 3 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 2 136916935 189599348 Rat 1358899 Kidm23 Kidney mass QTL 23 3.88 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358908 Bw49 Body weight QTL 49 3.36 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 1582257 Gluco21 Glucose level QTL 21 3.1 0.0035 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 118111229 157142209 Rat 1358910 Kidm27 Kidney mass QTL 27 5.77 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358911 Kidm28 Kidney mass QTL 28 5.42 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358904 Cm39 Cardiac mass QTL 39 2.26 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 8662836 Vetf8 Vascular elastic tissue fragility QTL 8 0.66 thoracic aorta molecular composition trait (VT:0010568) aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003) 2 104559726 149559726 Rat 1358887 Bw50 Body weight QTL 50 2.39 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 1298080 Bp163 Blood pressure QTL 163 0.02 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118275 202447032 Rat 8662832 Vetf7 Vascular elastic tissue fragility QTL 7 3.5 aorta elastin amount (VT:0003905) aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002) 2 81689826 221035911 Rat 5135226 Leukc2 Leukocyte quantity QTL 2 eosinophil quantity (VT:0002602) blood eosinophil count (CMO:0000033) 2 118111229 149559726 Rat 1298085 Bp165 Blood pressure QTL 165 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 1358894 Kidm24 Kidney mass QTL 24 4.03 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1359022 Ppulsi1 Prepulse inhibition QTL 1 3.63 prepulse inhibition trait (VT:0003088) acoustic startle response measurement (CMO:0001519) 2 136916935 213594495 Rat 724534 Uae6 Urinary albumin excretion QTL 6 10 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 2 78665619 249053267 Rat 61374 Edpm2 Estrogen-dependent pituitary mass QTL 2 4.42 0.86 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 2 76539322 202447032 Rat 1331794 Bp202 Blood pressure QTL 202 3.66819 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 141194931 223265385 Rat 71113 Cari2 Carrageenan-induced inflammation QTL 2 2.7 0.009 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 2 141596551 202447032 Rat 1331805 Cm29 Cardiac mass QTL 29 3.50746 heart mass (VT:0007028) heart wet weight (CMO:0000069) 2 141194931 223265385 Rat 634308 Sach6 Saccharin preference QTL 6 4.9 taste sensitivity trait (VT:0001986) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 2 112456140 212696837 Rat 1358917 Cm42 Cardiac mass QTL 42 2.82 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 724568 Uae13 Urinary albumin excretion QTL 13 4.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 2 143157029 210020885 Rat 1358913 Cm41 Cardiac mass QTL 41 2.73 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 1300165 Rf9 Renal function QTL 9 3.28 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 2 133914684 202447032 Rat 7488933 Bp368 Blood pressure QTL 368 0.004 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 142323368 147803808 Rat 61401 Niddm2 Non-insulin dependent diabetes mellitus QTL 2 4.54 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 144599348 189599348 Rat 631507 Bp105 Blood pressure QTL 105 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 112456140 212696837 Rat 738007 Anxrr7 Anxiety related response QTL 7 4.4 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 2 118189491 163189491 Rat 9685068 Swd7 Spike wave discharge measurement QTL 7 3.2 0.01 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge rate (CMO:0001739) 2 141656606 147588984 Rat 2293835 Kiddil5 Kidney dilation QTL 5 3.8 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 42804607 157142209 Rat 1581552 Pur12 Proteinuria QTL 12 5.19 0.0009 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 2 112103657 148076632 Rat 1558653 Prcr1 Prostate cancer resistance QTL 1 5 prostate integrity trait (VT:0010571) area of ventral prostate occupied by tumorous lesions to total ventral prostate area ratio (CMO:0000899) 2 72532993 157142209 Rat 1354622 Kidm16 Kidney mass QTL 16 3 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 2 81754530 222436696 Rat 631266 Bp132 Blood pressure QTL 132 0.0005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 46123260 202447032 Rat 2293843 Kiddil6 Kidney dilation QTL 6 3.1 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 42804607 182042367 Rat 1354594 Despr10 Despair related QTL 10 2e-06 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 2 114654253 159654253 Rat 152025206 Hrtrt23 Heart rate QTL 23 5.98 heart pumping trait (VT:2000009) 2 28484589 169504100 Rat 1354605 Rf48 Renal function QTL 48 2.9 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 2 74786664 206665859 Rat 6903312 Bw112 Body weight QTL 112 3.2 0.0013 body mass (VT:0001259) body weight (CMO:0000012) 2 143657569 184114274 Rat 152025204 Hrtrt22 Heart rate QTL 22 5.6 heart pumping trait (VT:2000009) 2 28484589 169504100 Rat 1354601 Slep1 Serum leptin concentration QTL 1 5.39 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 2 43171017 184114403 Rat
RH128402
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 146,856,637 - 146,856,834 (+) MAPPER mRatBN7.2 Rnor_6.0 2 152,786,013 - 152,786,209 NCBI Rnor6.0 Rnor_5.0 2 172,179,019 - 172,179,215 UniSTS Rnor5.0 RGSC_v3.4 2 152,122,936 - 152,123,132 UniSTS RGSC3.4 Celera 2 141,195,636 - 141,195,832 UniSTS RH 3.4 Map 18 390.0 UniSTS RH 3.4 Map 2 957.4 UniSTS Cytogenetic Map 2 q31 UniSTS
AU022184
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 146,858,763 - 146,858,872 (+) MAPPER mRatBN7.2 Rnor_6.0 2 152,788,139 - 152,788,247 NCBI Rnor6.0 Rnor_5.0 2 172,181,145 - 172,181,253 UniSTS Rnor5.0 RGSC_v3.4 2 152,125,062 - 152,125,170 UniSTS RGSC3.4 Celera 2 141,197,762 - 141,197,870 UniSTS Cytogenetic Map 2 q31 UniSTS
BE115449
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 146,863,018 - 146,863,168 (+) MAPPER mRatBN7.2 Rnor_6.0 2 152,792,393 - 152,792,542 NCBI Rnor6.0 Rnor_5.0 2 172,185,399 - 172,185,548 UniSTS Rnor5.0 RGSC_v3.4 2 152,129,316 - 152,129,465 UniSTS RGSC3.4 Celera 2 141,202,016 - 141,202,165 UniSTS RH 3.4 Map 2 960.3 UniSTS Cytogenetic Map 2 q31 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000019824 ⟹ ENSRNOP00000019824
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 146,856,469 - 146,894,572 (-) Ensembl Rnor_6.0 Ensembl 2 152,785,844 - 152,824,547 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000118321 ⟹ ENSRNOP00000086951
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 146,856,469 - 146,894,572 (-) Ensembl
RefSeq Acc Id:
NM_001107678 ⟹ NP_001101148
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 149,006,089 - 149,044,191 (-) NCBI mRatBN7.2 2 146,856,469 - 146,894,572 (-) NCBI Rnor_6.0 2 152,785,844 - 152,824,547 (-) NCBI Rnor_5.0 2 172,178,850 - 172,217,986 (-) NCBI RGSC_v3.4 2 152,122,767 - 152,161,219 (-) RGD Celera 2 141,195,467 - 141,233,553 (-) RGD
Sequence:
AATGTGCGCCCGCTTCCGGTCCTGGGCGCCATTTTCAGCGGTTGAGTTTTGGTGGTACCTGTAGTCGTCTCGGACAATGAGCTACGACTATCATCAGAGCTGGAGCCGCGACGGGGGCCCACGGGGCT
hide sequence
RefSeq Acc Id:
XM_008761047 ⟹ XP_008759269
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 149,010,687 - 149,044,192 (-) NCBI mRatBN7.2 2 146,862,811 - 146,894,577 (-) NCBI Rnor_6.0 2 152,791,525 - 152,824,549 (-) NCBI
Sequence:
GTAATGTGCGCCCGCTTCCGGTCCTGGGCGCCATTTTCAGCGGTTGAGTTTTGGTGGTACCTGT
hide sequence
RefSeq Acc Id:
XR_005500288
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 149,006,203 - 149,044,192 (-) NCBI mRatBN7.2 2 146,856,583 - 146,894,576 (-) NCBI
RefSeq Acc Id:
XR_351724
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 149,006,203 - 149,044,192 (-) NCBI mRatBN7.2 2 146,856,583 - 146,894,576 (-) NCBI Rnor_6.0 2 152,785,958 - 152,824,549 (-) NCBI Rnor_5.0 2 172,178,850 - 172,217,986 (-) NCBI
Sequence:
GTAATGTGCGCCCGCTTCCGGTCCTGGGCGCCATTTTCAGCGGTTGAGTTTTGGTGGTACCTGT
hide sequence
RefSeq Acc Id:
NP_001101148 ⟸ NM_001107678
- UniProtKB:
D4A2Z8 (UniProtKB/TrEMBL), A0A8I6A6W1 (UniProtKB/TrEMBL)
- Sequence:
MSYDYHQSWSRDGGPRGSGQGSGGGGGGSRGSGGGGGGRGGRGRHPAHLKGREIGLWYAKKQTQKNKEAERQERAVVHMDERREEQIVQLLNSVQAKNDKDSEAQISWFAPEDHGYGTEVSSEKKINS
hide sequence
RefSeq Acc Id:
XP_008759269 ⟸ XM_008761047
- Peptide Label:
isoform X1
- Sequence:
MSYDYHQSWSRDGGPRGSGQGSGGGGGGSRGSGGGGGGRGGRGRHPAHLKGREIGLWYAKKQTQKNKEAERQERAVVHMDERREEQIVQLLNSVQAKNDKDSEAQISWFAPEDHGYGTEVSSEKKINS
hide sequence
Ensembl Acc Id:
ENSRNOP00000019824 ⟸ ENSRNOT00000019824
Ensembl Acc Id:
ENSRNOP00000086951 ⟸ ENSRNOT00000118321
RGD ID: 13691355 Promoter ID: EPDNEW_R1879 Type: multiple initiation site Name: Dhx36_1 Description: DEAH-box helicase 36 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 2 152,824,520 - 152,824,580 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-01-13
Dhx36
DEAH-box helicase 36
Dhx36
DEAH (Asp-Glu-Ala-His) box polypeptide 36
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Dhx36
DEAH (Asp-Glu-Ala-His) box polypeptide 36
Dhx36_predicted
DEAH (Asp-Glu-Ala-His) box polypeptide 36 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Dhx36_predicted
DEAH (Asp-Glu-Ala-His) box polypeptide 36 (predicted)
Symbol and Name status set to approved
70820 APPROVED
