Symbol:
Kif5c
Name:
kinesin family member 5C
RGD ID:
1308539
Description:
Enables ATP hydrolysis activity; apolipoprotein receptor binding activity; and microtubule binding activity. Involved in anterograde axonal protein transport and intracellular mRNA localization. Located in dendrite. Is active in GABA-ergic synapse and postsynaptic cytosol. Human ortholog(s) of this gene implicated in complex cortical dysplasia with other brain malformations 2 and schizophrenia. Orthologous to human KIF5C (kinesin family member 5C); PARTICIPATES IN mitochondria transport pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; alpha-Zearalanol; bis(2-ethylhexyl) phthalate.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
kinesin heavy chain; kinesin heavy chain isoform 5C; kinesin heavy chain neuron-specific 2; kinesin-1; LOC311024
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 54,441,266 - 54,591,630 (+) NCBI GRCr8 mRatBN7.2 3 34,032,082 - 34,185,597 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 34,032,105 - 34,182,413 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 37,402,568 - 37,553,043 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 45,987,291 - 46,137,761 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 43,799,352 - 43,950,019 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 35,014,157 - 35,257,417 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 35,014,538 - 35,257,407 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 40,150,177 - 40,380,889 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 30,602,210 - 30,755,482 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 30,498,932 - 30,637,511 (+) NCBI Celera 3 32,217,717 - 32,366,850 (+) NCBI Celera Cytogenetic Map 3 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Kif5c Rat 1,2-dimethylhydrazine multiple interactions ISO Kif5c (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in decreased expression of KIF5C mRNA] CTD PMID:22206623 Kif5c Rat 1,2-dimethylhydrazine decreases expression ISO Kif5c (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of KIF5C mRNA CTD PMID:22206623 Kif5c Rat 17alpha-ethynylestradiol multiple interactions ISO Kif5c (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of KIF5C mRNA CTD PMID:17942748 Kif5c Rat 17beta-estradiol multiple interactions ISO KIF5C (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in increased expression of KIF5C mRNA CTD PMID:30165855 Kif5c Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO KIF5C (Homo sapiens) 6480464 Dihydrotestosterone results in increased expression of KIF5C mRNA CTD PMID:29581250 Kif5c Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Kif5c (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of KIF5C mRNA CTD PMID:17942748 Kif5c Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of KIF5C mRNA CTD PMID:34747641 Kif5c Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Kif5c (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of KIF5C mRNA CTD PMID:21570461 Kif5c Rat 3,4-methylenedioxymethamphetamine increases expression ISO Kif5c (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of KIF5C mRNA CTD PMID:20188158 Kif5c Rat 8-Br-cAMP increases expression ISO KIF5C (Homo sapiens) 6480464 8-Bromo Cyclic Adenosine Monophosphate results in increased expression of KIF5C mRNA CTD PMID:22079614 Kif5c Rat aflatoxin B1 decreases methylation ISO KIF5C (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of KIF5C gene CTD PMID:27153756 Kif5c Rat all-trans-retinoic acid decreases expression ISO KIF5C (Homo sapiens) 6480464 Tretinoin results in decreased expression of KIF5C mRNA CTD PMID:21934132 Kif5c Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of KIF5C mRNA CTD PMID:35163327 Kif5c Rat antimycin A decreases expression ISO KIF5C (Homo sapiens) 6480464 Antimycin A results in decreased expression of KIF5C mRNA CTD PMID:33512557 Kif5c Rat aristolochic acid A decreases expression ISO KIF5C (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of KIF5C mRNA CTD PMID:33212167 Kif5c Rat aristolochic acid A increases expression ISO KIF5C (Homo sapiens) 6480464 aristolochic acid I results in increased expression of KIF5C protein CTD PMID:33212167 Kif5c Rat azoxystrobin decreases expression ISO KIF5C (Homo sapiens) 6480464 azoxystrobin results in decreased expression of KIF5C mRNA CTD PMID:33512557 Kif5c Rat benzatropine decreases expression ISO KIF5C (Homo sapiens) 6480464 Benztropine results in decreased expression of KIF5C protein CTD PMID:34122009 Kif5c Rat benzo[a]pyrene increases expression ISO Kif5c (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of KIF5C mRNA CTD PMID:19770486 Kif5c Rat benzo[a]pyrene increases methylation ISO KIF5C (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of KIF5C 3' UTR and Benzo(a)pyrene results in increased methylation of KIF5C exon CTD PMID:27901495 Kif5c Rat bis(2-ethylhexyl) phthalate decreases expression EXP 6480464 Diethylhexyl Phthalate results in decreased expression of KIF5C mRNA CTD PMID:20920545 Kif5c Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Kif5c (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of KIF5C mRNA CTD PMID:39150890 Kif5c Rat bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of KIF5C mRNA CTD PMID:31199487 Kif5c Rat bis(2-ethylhexyl) phthalate increases expression ISO KIF5C (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of KIF5C protein CTD PMID:31163220 Kif5c Rat bis(2-ethylhexyl) phthalate decreases expression ISO KIF5C (Homo sapiens) 6480464 Diethylhexyl Phthalate results in decreased expression of KIF5C mRNA CTD PMID:31163220 Kif5c Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of KIF5C mRNA CTD PMID:25181051 and PMID:33296240 Kif5c Rat bisphenol A decreases expression ISO Kif5c (Mus musculus) 6480464 bisphenol A results in decreased expression of KIF5C mRNA CTD PMID:32156529 Kif5c Rat bisphenol A increases methylation ISO KIF5C (Homo sapiens) 6480464 bisphenol A results in increased methylation of KIF5C gene CTD PMID:31601247 Kif5c Rat Brodifacoum increases expression EXP 6480464 bromfenacoum results in increased expression of KIF5C protein CTD PMID:28903499 Kif5c Rat butanal increases expression ISO KIF5C (Homo sapiens) 6480464 butyraldehyde results in increased expression of KIF5C mRNA CTD PMID:26079696 Kif5c Rat Butylbenzyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of KIF5C mRNA CTD PMID:31199487 Kif5c Rat Butylbenzyl phthalate multiple interactions ISO Kif5c (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of KIF5C mRNA CTD PMID:39150890 Kif5c Rat calcitriol increases expression ISO KIF5C (Homo sapiens) 6480464 Calcitriol results in increased expression of KIF5C mRNA CTD PMID:26485663 Kif5c Rat cannabidiol decreases expression ISO KIF5C (Homo sapiens) 6480464 Cannabidiol results in decreased expression of KIF5C protein CTD PMID:34122009 Kif5c Rat chlordecone decreases expression ISO Kif5c (Mus musculus) 6480464 Chlordecone results in decreased expression of KIF5C mRNA CTD PMID:33711761 Kif5c Rat choline multiple interactions ISO Kif5c (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of KIF5C mRNA CTD PMID:20938992 Kif5c Rat cisplatin multiple interactions ISO KIF5C (Homo sapiens) 6480464 [Cisplatin co-treated with panobinostat] affects the expression of KIF5C mRNA CTD PMID:21791302 Kif5c Rat clozapine decreases expression ISO KIF5C (Homo sapiens) 6480464 Clozapine results in decreased expression of KIF5C protein CTD PMID:34122009 Kif5c Rat copper atom multiple interactions ISO KIF5C (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of KIF5C mRNA CTD PMID:20971185 Kif5c Rat copper(0) multiple interactions ISO KIF5C (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of KIF5C mRNA CTD PMID:20971185 Kif5c Rat coumestrol multiple interactions ISO KIF5C (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of KIF5C mRNA CTD PMID:19167446 Kif5c Rat cyclosporin A decreases expression ISO KIF5C (Homo sapiens) 6480464 Cyclosporine results in decreased expression of KIF5C mRNA CTD PMID:27989131 Kif5c Rat deguelin decreases expression ISO KIF5C (Homo sapiens) 6480464 deguelin results in decreased expression of KIF5C mRNA CTD PMID:33512557 Kif5c Rat dibutyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of KIF5C mRNA CTD PMID:31199487 Kif5c Rat dibutyl phthalate multiple interactions ISO Kif5c (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of KIF5C mRNA CTD PMID:39150890 Kif5c Rat diclofenac increases expression EXP 6480464 Diclofenac results in increased expression of KIF5C mRNA CTD PMID:30723492 Kif5c Rat diethyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of KIF5C mRNA CTD PMID:31199487 Kif5c Rat diethyl phthalate multiple interactions ISO Kif5c (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of KIF5C mRNA CTD PMID:39150890 Kif5c Rat diisobutyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of KIF5C mRNA CTD PMID:31199487 Kif5c Rat diisobutyl phthalate multiple interactions ISO Kif5c (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of KIF5C mRNA CTD PMID:39150890 Kif5c Rat diisononyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of KIF5C mRNA CTD PMID:31199487 Kif5c Rat diisononyl phthalate multiple interactions ISO Kif5c (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of KIF5C mRNA CTD PMID:39150890 Kif5c Rat dorsomorphin multiple interactions ISO KIF5C (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of KIF5C mRNA CTD PMID:27188386 Kif5c Rat doxorubicin increases expression ISO KIF5C (Homo sapiens) 6480464 Doxorubicin results in increased expression of KIF5C mRNA CTD PMID:29803840 and PMID:30031762 Kif5c Rat elemental selenium decreases expression ISO KIF5C (Homo sapiens) 6480464 Selenium results in decreased expression of KIF5C mRNA CTD PMID:19244175 Kif5c Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of KIF5C mRNA CTD PMID:29391264 Kif5c Rat Enterolactone multiple interactions ISO KIF5C (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of KIF5C mRNA CTD PMID:19167446 Kif5c Rat enzalutamide decreases expression ISO KIF5C (Homo sapiens) 6480464 enzalutamide results in decreased expression of KIF5C mRNA CTD PMID:29581250 Kif5c Rat ethanol multiple interactions ISO Kif5c (Mus musculus) 6480464 Ethanol affects the expression of and affects the splicing of KIF5C mRNA CTD PMID:30319688 Kif5c Rat ethanol increases expression ISO Kif5c (Mus musculus) 6480464 Ethanol results in increased expression of KIF5C mRNA CTD PMID:30319688 Kif5c Rat fenpyroximate decreases expression ISO KIF5C (Homo sapiens) 6480464 fenpyroximate results in decreased expression of KIF5C mRNA CTD PMID:33512557 Kif5c Rat folic acid multiple interactions ISO Kif5c (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of KIF5C mRNA more ... CTD PMID:20938992 and PMID:22206623 Kif5c Rat haloperidol decreases expression ISO KIF5C (Homo sapiens) 6480464 Haloperidol results in decreased expression of KIF5C protein CTD PMID:34122009 Kif5c Rat L-methionine multiple interactions ISO Kif5c (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of KIF5C mRNA CTD PMID:20938992 Kif5c Rat lead(0) affects splicing ISO KIF5C (Homo sapiens) 6480464 Lead affects the splicing of KIF5C mRNA CTD PMID:28903495 Kif5c Rat manganese(II) chloride increases expression EXP 6480464 manganese chloride results in increased expression of KIF5C mRNA CTD PMID:28801915 Kif5c Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of KIF5C gene CTD PMID:35440735 Kif5c Rat methylmercury chloride affects expression EXP 6480464 methylmercuric chloride affects the expression of KIF5C mRNA CTD PMID:20864626 Kif5c Rat mono(2-ethylhexyl) phthalate increases expression ISO Kif5c (Mus musculus) 6480464 mono-(2-ethylhexyl)phthalate results in increased expression of KIF5C mRNA CTD PMID:22401849 Kif5c Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of KIF5C gene CTD PMID:33148267 Kif5c Rat N-methyl-4-phenylpyridinium decreases expression ISO Kif5c (Mus musculus) 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of KIF5C protein CTD PMID:26558463 Kif5c Rat N-methyl-4-phenylpyridinium increases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in increased expression of KIF5C mRNA CTD PMID:28801915 Kif5c Rat N-nitrosodiethylamine increases expression ISO Kif5c (Mus musculus) 6480464 Diethylnitrosamine results in increased expression of KIF5C mRNA CTD PMID:24535843 Kif5c Rat nickel atom increases expression ISO KIF5C (Homo sapiens) 6480464 Nickel results in increased expression of KIF5C mRNA CTD PMID:25583101 Kif5c Rat nickel sulfate increases expression ISO KIF5C (Homo sapiens) 6480464 nickel sulfate results in increased expression of KIF5C mRNA CTD PMID:22714537 Kif5c Rat p-chloromercuribenzoic acid multiple interactions ISO KIF5C (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of KIF5C mRNA CTD PMID:27188386 Kif5c Rat panobinostat multiple interactions ISO KIF5C (Homo sapiens) 6480464 [Cisplatin co-treated with panobinostat] affects the expression of KIF5C mRNA CTD PMID:21791302 Kif5c Rat paracetamol increases expression ISO KIF5C (Homo sapiens) 6480464 Acetaminophen results in increased expression of KIF5C mRNA CTD PMID:26690555 Kif5c Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of KIF5C mRNA CTD PMID:33387578 Kif5c Rat pentanal increases expression ISO KIF5C (Homo sapiens) 6480464 pentanal results in increased expression of KIF5C mRNA CTD PMID:26079696 Kif5c Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of KIF5C mRNA CTD PMID:35163327 Kif5c Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of KIF5C gene CTD PMID:33148267 Kif5c Rat picoxystrobin decreases expression ISO KIF5C (Homo sapiens) 6480464 picoxystrobin results in decreased expression of KIF5C mRNA CTD PMID:33512557 Kif5c Rat pirinixic acid multiple interactions ISO Kif5c (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of KIF5C mRNA CTD PMID:19710929 Kif5c Rat pirinixic acid increases expression ISO Kif5c (Mus musculus) 6480464 pirinixic acid results in increased expression of KIF5C mRNA CTD PMID:20813756 Kif5c Rat poly(I:C) multiple interactions EXP 6480464 [Poly I-C co-treated with HU 211] results in decreased expression of KIF5C mRNA CTD PMID:26923065 Kif5c Rat potassium chromate increases expression ISO KIF5C (Homo sapiens) 6480464 potassium chromate(VI) results in increased expression of KIF5C mRNA CTD PMID:22714537 Kif5c Rat propanal increases expression ISO KIF5C (Homo sapiens) 6480464 propionaldehyde results in increased expression of KIF5C mRNA CTD PMID:26079696 Kif5c Rat pyrimidifen decreases expression ISO KIF5C (Homo sapiens) 6480464 pyrimidifen results in decreased expression of KIF5C mRNA CTD PMID:33512557 Kif5c Rat SB 431542 multiple interactions ISO KIF5C (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of KIF5C mRNA CTD PMID:27188386 Kif5c Rat selenium atom decreases expression ISO KIF5C (Homo sapiens) 6480464 Selenium results in decreased expression of KIF5C mRNA CTD PMID:19244175 Kif5c Rat silver atom decreases expression ISO Kif5c (Mus musculus) 6480464 Silver results in decreased expression of KIF5C mRNA CTD PMID:27131904 Kif5c Rat silver(0) decreases expression ISO Kif5c (Mus musculus) 6480464 Silver results in decreased expression of KIF5C mRNA CTD PMID:27131904 Kif5c Rat sodium arsenite increases expression ISO KIF5C (Homo sapiens) 6480464 sodium arsenite results in increased expression of KIF5C mRNA CTD PMID:22714537 Kif5c Rat sunitinib increases expression ISO KIF5C (Homo sapiens) 6480464 Sunitinib results in increased expression of KIF5C mRNA CTD PMID:31533062 Kif5c Rat tebufenpyrad decreases expression ISO KIF5C (Homo sapiens) 6480464 4-chloro-N-((4-(1 and 1-dimethylethyl)phenyl)methyl)-3-ethyl-1-methyl-1H-pyrazole-5-carboxamide results in decreased expression of KIF5C mRNA CTD PMID:33512557 Kif5c Rat tert-butyl hydroperoxide increases expression ISO KIF5C (Homo sapiens) 6480464 tert-Butylhydroperoxide results in increased expression of KIF5C mRNA CTD PMID:15336504 Kif5c Rat titanium dioxide decreases methylation ISO Kif5c (Mus musculus) 6480464 titanium dioxide results in decreased methylation of KIF5C gene and titanium dioxide results in decreased methylation of KIF5C promoter CTD PMID:35295148 Kif5c Rat trichostatin A increases expression ISO KIF5C (Homo sapiens) 6480464 trichostatin A results in increased expression of KIF5C mRNA CTD PMID:28542535 Kif5c Rat triphenyl phosphate affects expression ISO KIF5C (Homo sapiens) 6480464 triphenyl phosphate affects the expression of KIF5C mRNA CTD PMID:37042841 Kif5c Rat triticonazole decreases expression EXP 6480464 triticonazole results in decreased expression of KIF5C mRNA CTD PMID:36084822 Kif5c Rat valproic acid increases expression ISO KIF5C (Homo sapiens) 6480464 Valproic Acid results in increased expression of KIF5C mRNA CTD PMID:19949822 more ... Kif5c Rat valproic acid affects splicing EXP 6480464 Valproic Acid affects the splicing of KIF5C mRNA CTD PMID:29427782 Kif5c Rat valproic acid affects expression ISO KIF5C (Homo sapiens) 6480464 Valproic Acid affects the expression of KIF5C mRNA CTD PMID:25979313 Kif5c Rat vitamin E decreases expression ISO KIF5C (Homo sapiens) 6480464 Vitamin E results in decreased expression of KIF5C mRNA CTD PMID:19244175
1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3,4-methylenedioxymethamphetamine (ISO) 8-Br-cAMP (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) antimycin A (ISO) aristolochic acid A (ISO) azoxystrobin (ISO) benzatropine (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) Brodifacoum (EXP) butanal (ISO) Butylbenzyl phthalate (EXP,ISO) calcitriol (ISO) cannabidiol (ISO) chlordecone (ISO) choline (ISO) cisplatin (ISO) clozapine (ISO) copper atom (ISO) copper(0) (ISO) coumestrol (ISO) cyclosporin A (ISO) deguelin (ISO) dibutyl phthalate (EXP,ISO) diclofenac (EXP) diethyl phthalate (EXP,ISO) diisobutyl phthalate (EXP,ISO) diisononyl phthalate (EXP,ISO) dorsomorphin (ISO) doxorubicin (ISO) elemental selenium (ISO) endosulfan (EXP) Enterolactone (ISO) enzalutamide (ISO) ethanol (ISO) fenpyroximate (ISO) folic acid (ISO) haloperidol (ISO) L-methionine (ISO) lead(0) (ISO) manganese(II) chloride (EXP) methoxychlor (EXP) methylmercury chloride (EXP) mono(2-ethylhexyl) phthalate (ISO) N,N-diethyl-m-toluamide (EXP) N-methyl-4-phenylpyridinium (EXP,ISO) N-nitrosodiethylamine (ISO) nickel atom (ISO) nickel sulfate (ISO) p-chloromercuribenzoic acid (ISO) panobinostat (ISO) paracetamol (EXP,ISO) pentanal (ISO) perfluorooctanoic acid (EXP) permethrin (EXP) picoxystrobin (ISO) pirinixic acid (ISO) poly(I:C) (EXP) potassium chromate (ISO) propanal (ISO) pyrimidifen (ISO) SB 431542 (ISO) selenium atom (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) sunitinib (ISO) tebufenpyrad (ISO) tert-butyl hydroperoxide (ISO) titanium dioxide (ISO) trichostatin A (ISO) triphenyl phosphate (ISO) triticonazole (EXP) valproic acid (EXP,ISO) vitamin E (ISO)
1.
Expression profiling of the cellular processes in uterine leiomyomas: omic approaches and IGF-2 association with leiomyosarcomas.
Bae SM, etal., Cancer Res Treat. 2004 Feb;36(1):31-42. doi: 10.4143/crt.2004.36.1.31. Epub 2004 Feb 29.
2.
Genetic modifiers and subtypes in schizophrenia: investigations of age at onset, severity, sex and family history.
Bergen SE, etal., Schizophr Res. 2014 Apr;154(1-3):48-53. doi: 10.1016/j.schres.2014.01.030. Epub 2014 Feb 26.
3.
Shank1 mRNA: dendritic transport by kinesin and translational control by the 5'untranslated region.
Falley K, etal., Traffic. 2009 Jul;10(7):844-57. doi: 10.1111/j.1600-0854.2009.00912.x. Epub 2009 Apr 11.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
6.
Kinesin expression in the central nervous system of humans and transgenic hSOD1G93A mice with amyotrophic lateral sclerosis.
Kuzma-Kozakiewicz M, etal., Neurodegener Dis. 2013;12(2):71-80. doi: 10.1159/000339529. Epub 2012 Sep 21.
7.
Regulation of mitochondrial transport in neurons.
Lin MY and Sheng ZH, Exp Cell Res. 2015 May 15;334(1):35-44. doi: 10.1016/j.yexcr.2015.01.004. Epub 2015 Jan 19.
8.
Kinesin and ncd bind through a single head to microtubules and compete for a shared MT binding site.
Lockhart A, etal., J Mol Biol. 1995 Jun 16;249(4):763-71.
9.
Huntingtin mediates dendritic transport of beta-actin mRNA in rat neurons.
Ma B, etal., Sci Rep. 2011;1:140. Epub 2011 Nov 3.
10.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
11.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
12.
GOA pipeline
RGD automated data pipeline
13.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
14.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
15.
Familial Alzheimer's disease-associated presenilin-1 alters cerebellar activity and calcium homeostasis.
Sepulveda-Falla D, etal., J Clin Invest. 2014 Apr;124(4):1552-67. doi: 10.1172/JCI66407. Epub 2014 Feb 24.
16.
c-Jun NH2-terminal kinase (JNK)-interacting protein-3 (JIP3) regulates neuronal axon elongation in a kinesin- and JNK-dependent manner.
Sun T, etal., J Biol Chem. 2013 May 17;288(20):14531-43. doi: 10.1074/jbc.M113.464453. Epub 2013 Apr 10.
17.
Delivery of GABAARs to synapses is mediated by HAP1-KIF5 and disrupted by mutant huntingtin.
Twelvetrees AE, etal., Neuron. 2010 Jan 14;65(1):53-65. doi: 10.1016/j.neuron.2009.12.007.
18.
Cargo of kinesin identified as JIP scaffolding proteins and associated signaling molecules.
Verhey KJ, etal., J Cell Biol. 2001 Mar 5;152(5):959-70.
19.
The mechanism of Ca2+ -dependent regulation of kinesin-mediated mitochondrial motility.
Wang X and Schwarz TL, Cell. 2009 Jan 9;136(1):163-74. doi: 10.1016/j.cell.2008.11.046.
20.
The RNA-binding protein MARTA2 regulates dendritic targeting of MAP2 mRNAs in rat neurons.
Zivraj KH, etal., J Neurochem. 2013 Mar;124(5):670-84. doi: 10.1111/jnc.12079. Epub 2013 Jan 20.
Kif5c Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 54,441,266 - 54,591,630 (+) NCBI GRCr8 mRatBN7.2 3 34,032,082 - 34,185,597 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 34,032,105 - 34,182,413 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 37,402,568 - 37,553,043 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 45,987,291 - 46,137,761 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 43,799,352 - 43,950,019 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 35,014,157 - 35,257,417 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 35,014,538 - 35,257,407 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 40,150,177 - 40,380,889 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 30,602,210 - 30,755,482 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 30,498,932 - 30,637,511 (+) NCBI Celera 3 32,217,717 - 32,366,850 (+) NCBI Celera Cytogenetic Map 3 q12 NCBI
KIF5C Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 148,875,227 - 149,026,759 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 148,875,227 - 149,026,759 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 149,632,796 - 149,883,273 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 149,349,289 - 149,396,266 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 36 2 149,502,042 - 149,591,519 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 2 143,347,002 - 143,497,189 (+) NCBI Celera Cytogenetic Map 2 q23.1-q23.2 NCBI HuRef 2 141,692,099 - 141,781,519 (+) NCBI HuRef HuRef 2 141,630,811 - 141,685,094 (+) NCBI HuRef CHM1_1 2 149,799,659 - 149,889,137 (+) NCBI CHM1_1 CHM1_1 2 149,638,662 - 149,692,791 (+) NCBI CHM1_1 T2T-CHM13v2.0 2 149,325,585 - 149,477,131 (+) NCBI T2T-CHM13v2.0
Kif5c Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 49,509,298 - 49,664,790 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 49,509,310 - 49,664,790 (+) Ensembl GRCm39 Ensembl GRCm38 2 49,619,286 - 49,774,778 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 49,619,298 - 49,774,778 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 49,474,834 - 49,630,298 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 49,441,323 - 49,596,787 (+) NCBI MGSCv36 mm8 Celera 2 51,292,276 - 51,447,919 (+) NCBI Celera Cytogenetic Map 2 C1.1 NCBI cM Map 2 28.68 NCBI
Kif5c Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955440 14,754,639 - 14,854,406 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955440 14,754,931 - 14,854,090 (+) NCBI ChiLan1.0 ChiLan1.0
KIF5C Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 13 25,901,834 - 26,053,898 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2B 25,916,801 - 26,068,844 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2B 10,836,356 - 10,987,683 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2B 153,235,329 - 153,387,221 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2B 153,235,329 - 153,387,221 (+) Ensembl panpan1.1 panPan2
KIF5C Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 19 50,535,622 - 50,684,485 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 19 50,535,456 - 50,668,738 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 19 50,659,035 - 50,807,788 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 19 52,008,886 - 52,158,206 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 19 52,008,672 - 52,154,871 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 19 50,652,619 - 50,801,801 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 19 50,787,472 - 50,935,851 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 19 52,186,427 - 52,334,911 (+) NCBI UU_Cfam_GSD_1.0
Kif5c Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405303 113,186,109 - 113,337,599 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936469 28,280,095 - 28,431,695 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936469 28,282,921 - 28,431,638 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
KIF5C Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 15 3,190,343 - 3,361,410 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 15 3,190,341 - 3,361,470 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 15 2,730,440 - 2,901,563 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
KIF5C Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 10 34,285,048 - 34,441,918 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 10 34,285,037 - 34,444,863 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666040 165,078,867 - 165,231,441 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Kif5c
.
Predicted Target Of
Count of predictions: 53 Count of miRNA genes: 49 Interacting mature miRNAs: 51 Transcripts: ENSRNOT00000006341 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1298073 Cm13 Cardiac mass QTL 13 2.5 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 25013911 38192233 Rat 10401810 Kidm53 Kidney mass QTL 53 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 3 8227194 47233430 Rat 2298542 Neuinf11 Neuroinflammation QTL 11 3.9 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 3 15005422 76927699 Rat 631832 Sach1 Saccharin preference QTL 1 2.7 0.02 consumption behavior trait (VT:0002069) calculated saccharin drink intake volume (CMO:0001600) 3 27494621 44188411 Rat 737818 Hcar12 Hepatocarcinoma resistance QTL 12 2.6 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 3 29463235 118376539 Rat 631568 Bp92 Blood pressure QTL 92 2.2 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 1 39874793 Rat 9590286 Uminl1 Urine mineral level QTL 1 3.5 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 3 28249687 73249687 Rat 4889966 Bss95 Bone structure and strength QTL 95 4.4 tibia area (VT:1000281) tibia-fibula cross-sectional area (CMO:0001718) 3 1 36847613 Rat 2313093 Bmd77 Bone mineral density QTL 77 2.2 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 3 27494621 50302886 Rat 12879852 Cm93 Cardiac mass QTL 93 0.001 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 3 18311454 47233430 Rat 12879853 Am5 Aortic mass QTL 5 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 3 18311454 47233430 Rat 12879854 Kidm63 Kidney mass QTL 63 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 3 18311454 47233430 Rat 61356 Bp37 Blood pressure QTL 37 3 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 3 30684642 75684642 Rat 1358905 Hrtrt17 Heart rate QTL 17 5.9 0.000014 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 3 10861912 89878372 Rat 12879849 Bw180 Body weight QTL 180 0.037 body mass (VT:0001259) body weight (CMO:0000012) 3 18311454 47233430 Rat 70191 BpQTLcluster4 Blood pressure QTL cluster 4 3 arterial blood pressure trait (VT:2000000) absolute change in systolic blood pressure (CMO:0000607) 3 10778704 50302886 Rat 12879850 Cm91 Cardiac mass QTL 91 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 3 18311454 47233430 Rat 2313101 Bmd76 Bone mineral density QTL 76 3.6 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 3 27494621 50302886 Rat 731172 Bp151 Blood pressure QTL 151 0.04 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 18311454 47233430 Rat 12879851 Cm92 Cardiac mass QTL 92 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 18311454 47233430 Rat 8694196 Abfw2 Abdominal fat weight QTL 2 16.58 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 3 28249687 73249687 Rat 1358885 Bp251 Blood pressure QTL 251 3.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 2290452 Scl56 Serum cholesterol level QTL 56 2.26 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 3 1 91609953 Rat 12879868 Am6 Aortic mass QTL 6 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 3 31426403 70668733 Rat 11565451 Bw177 Body weight QTL 177 0.002 body mass (VT:0001259) body weight (CMO:0000012) 3 31426403 70668733 Rat 1358888 Bp264 Blood pressure QTL 264 4.43 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 11565452 Kidm57 Kidney mass QTL 57 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 3 31426403 70668733 Rat 12879866 Cm94 Cardiac mass QTL 94 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 31426403 70668733 Rat 12879867 Cm95 Cardiac mass QTL 95 0.047 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 3 31426403 70668733 Rat 2302055 Pia30 Pristane induced arthritis QTL 30 3.5 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111) 3 27936919 72936919 Rat 70216 Cm14 Cardiac mass QTL 14 2.1 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 31172320 163586636 Rat 1354589 Bw31 Body weight QTL 31 3.3 body mass (VT:0001259) body weight (CMO:0000012) 3 33703347 78196190 Rat 2303593 Gluco46 Glucose level QTL 46 3 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 28468571 73468571 Rat 1354590 Despr11 Despair related QTL 11 0.000031 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 3 28468571 73468571 Rat 634306 Bp140 Blood pressure QTL 140 3.3 0.0013 arterial blood pressure trait (VT:2000000) body weight (CMO:0000012) 3 17374703 35528639 Rat 2313079 Bss73 Bone structure and strength QTL 73 1.5 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 3 27494621 50302886 Rat 631647 Bp122 Blood pressure QTL 122 6.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 30684642 75684642 Rat 2313076 Bss74 Bone structure and strength QTL 74 2 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 3 27494621 50302886 Rat 1300169 Bp177 Blood pressure QTL 177 2.96 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 3 33703347 61017857 Rat 9590136 Scort3 Serum corticosterone level QTL 3 23.37 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 3 28249687 73249687 Rat 10450804 Scl70 Serum cholesterol level QTL 70 4.7 0.001 blood LDL cholesterol amount (VT:0000181) blood low density lipoprotein cholesterol level (CMO:0000053) 3 20714090 65714090 Rat 61419 Cia11 Collagen induced arthritis QTL 11 5.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 3 30356773 98535386 Rat 8552950 Pigfal12 Plasma insulin-like growth factor 1 level QTL 12 7.3 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 3 28249687 73249687 Rat 631676 Cm8 Cardiac mass QTL 8 7.03 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 3 16954708 61954708 Rat 10450794 Scl69 Serum cholesterol level QTL 69 6.3 0.001 blood LDL cholesterol amount (VT:0000181) blood low density lipoprotein cholesterol level (CMO:0000053) 3 20714090 65714090 Rat 8694386 Bw159 Body weight QTL 159 4.52 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 3 28249687 73249687 Rat 1354604 Bw36 Body weight QTL 36 2.9 body mass (VT:0001259) body weight (CMO:0000012) 3 33703347 104104347 Rat 2313049 Bss72 Bone structure and strength QTL 72 2.6 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 3 27494621 50302886 Rat 2312664 Scl62 Serum cholesterol level QTL 62 0.05 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 3 1 38710544 Rat 2301400 Cm68 Cardiac mass QTL 68 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 3 31426403 70668733 Rat
D3Got22
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 3 54,514,719 - 54,514,855 (+) Marker Load Pipeline mRatBN7.2 3 34,105,497 - 34,105,633 (+) MAPPER mRatBN7.2 Rnor_6.0 3 35,176,560 - 35,176,695 NCBI Rnor6.0 Rnor_5.0 3 40,303,203 - 40,303,338 UniSTS Rnor5.0 RGSC_v3.4 3 30,678,696 - 30,678,832 RGD RGSC3.4 RGSC_v3.4 3 30,678,697 - 30,678,832 UniSTS RGSC3.4 RGSC_v3.1 3 30,575,068 - 30,575,204 RGD Celera 3 32,289,943 - 32,290,078 UniSTS Cytogenetic Map 3 q12 UniSTS
RH142774
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 34,182,586 - 34,182,774 (+) MAPPER mRatBN7.2 Rnor_6.0 3 35,254,407 - 35,254,594 NCBI Rnor6.0 Rnor_5.0 3 40,381,063 - 40,381,250 UniSTS Rnor5.0 RGSC_v3.4 3 30,755,656 - 30,755,844 UniSTS RGSC3.4 Celera 3 32,367,024 - 32,367,211 UniSTS RH 3.4 Map 3 411.51 UniSTS Cytogenetic Map 3 q12 UniSTS
BE096005
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 34,168,985 - 34,169,159 (+) MAPPER mRatBN7.2 Rnor_6.0 3 35,240,806 - 35,240,979 NCBI Rnor6.0 Rnor_5.0 3 40,367,462 - 40,367,635 UniSTS Rnor5.0 RGSC_v3.4 3 30,742,055 - 30,742,228 UniSTS RGSC3.4 Celera 3 32,353,423 - 32,353,596 UniSTS RH 3.4 Map 3 413.71 UniSTS Cytogenetic Map 3 q12 UniSTS
PMC133732P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 34,106,821 - 34,107,282 (+) MAPPER mRatBN7.2 Rnor_6.0 3 35,177,884 - 35,178,344 NCBI Rnor6.0 Rnor_5.0 3 40,304,527 - 40,304,987 UniSTS Rnor5.0 RGSC_v3.4 3 30,680,021 - 30,680,481 UniSTS RGSC3.4 Celera 3 32,291,267 - 32,291,727 UniSTS Cytogenetic Map 3 q12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
10
49
113
88
87
56
25
56
6
213
95
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000006341 ⟹ ENSRNOP00000006341
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 34,032,105 - 34,182,413 (+) Ensembl Rnor_6.0 Ensembl 3 35,014,538 - 35,239,888 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000081744 ⟹ ENSRNOP00000071329
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 34,032,105 - 34,182,413 (+) Ensembl Rnor_6.0 Ensembl 3 35,175,313 - 35,257,407 (+) Ensembl
RefSeq Acc Id:
NM_001107730 ⟹ NP_001101200
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 54,441,307 - 54,591,630 (+) NCBI mRatBN7.2 3 34,032,105 - 34,182,413 (+) NCBI Rnor_6.0 3 35,014,187 - 35,254,233 (+) NCBI Rnor_5.0 3 40,150,177 - 40,380,889 (+) NCBI RGSC_v3.4 3 30,602,210 - 30,755,482 (+) RGD Celera 3 32,217,717 - 32,366,850 (+) RGD
Sequence:
GGTGCCGGAGCGAGGTGGTGCTGATGCAGGATGGCTGAGCGCGCCGGAGCCCGGGAGGTCTGAGCCGGGCTGGGATTGCTCCCTAAGCATCGCCTAGTCCGCCCGCCGCTTGGTCGCGGGCAGGTGGA
hide sequence
RefSeq Acc Id:
XM_063283548 ⟹ XP_063139618
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 54,441,266 - 54,582,391 (+) NCBI
RefSeq Acc Id:
XM_063283549 ⟹ XP_063139619
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 54,441,266 - 54,591,138 (+) NCBI
RefSeq Acc Id:
NP_001101200 ⟸ NM_001107730
- UniProtKB:
P56536 (UniProtKB/Swiss-Prot), G3V6L4 (UniProtKB/Swiss-Prot), A0A0G2K070 (UniProtKB/TrEMBL)
- Sequence:
MADPAECSIKVMCRFRPLNEAEILRGDKFIPKFKGEETVVIGQGKPYVFDRVLPPNTTQEQVYNACAKQIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIAHDIFDHIYSMDENLE
hide sequence
Ensembl Acc Id:
ENSRNOP00000006341 ⟸ ENSRNOT00000006341
Ensembl Acc Id:
ENSRNOP00000071329 ⟸ ENSRNOT00000081744
RefSeq Acc Id:
XP_063139619 ⟸ XM_063283549
- Peptide Label:
isoform X1
- UniProtKB:
P56536 (UniProtKB/Swiss-Prot), G3V6L4 (UniProtKB/Swiss-Prot), A0A0G2K070 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063139618 ⟸ XM_063283548
- Peptide Label:
isoform X1
- UniProtKB:
P56536 (UniProtKB/Swiss-Prot), G3V6L4 (UniProtKB/Swiss-Prot), A0A0G2K070 (UniProtKB/TrEMBL)
RGD ID: 13692069 Promoter ID: EPDNEW_R2594 Type: single initiation site Name: Kif5c_1 Description: kinesin family member 5C SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 3 35,014,515 - 35,014,575 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Kif5c
kinesin family member 5C
Kif5c_predicted
kinesin family member 5C (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Kif5c_predicted
kinesin family member 5C (predicted)
Symbol and Name status set to approved
70820 APPROVED
