Symbol:
Wnt8b
Name:
Wnt family member 8B
RGD ID:
1307644
Description:
Predicted to enable cytokine activity and frizzled binding activity. Predicted to be involved in canonical Wnt signaling pathway; cell fate commitment; and neuron differentiation. Predicted to act upstream of or within negative regulation of gene expression and positive regulation of gene expression. Predicted to be active in extracellular space. Human ortholog(s) of this gene implicated in Hirschsprung's disease. Orthologous to human WNT8B (Wnt family member 8B); PARTICIPATES IN Wnt signaling pathway; Wnt signaling, canonical pathway; basal cell carcinoma pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; bisphenol A.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC293990; protein Wnt-8b; wingless related MMTV integration site 8b; wingless-type MMTV integration site family, member 8B
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
WNT8B (Wnt family member 8B) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Wnt8b (wingless-type MMTV integration site family, member 8B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Wnt8b (Wnt family member 8B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
WNT8B (Wnt family member 8B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
WNT8B (Wnt family member 8B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Wnt8b (Wnt family member 8B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
WNT8B (Wnt family member 8B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
WNT8B (Wnt family member 8B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Wnt8b (Wnt family member 8B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
WNT8B (Wnt family member 8B)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Wnt8b (wingless-type MMTV integration site family, member 8B)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
wnt8b (wingless-type MMTV integration site family, member 8b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
wntD
Alliance
DIOPT (Ensembl Compara|PANTHER)
Xenopus tropicalis (tropical clawed frog):
wnt8b
Alliance
DIOPT (Ensembl Compara|OMA|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 253,303,369 - 253,325,224 (+) NCBI GRCr8 mRatBN7.2 1 243,354,145 - 243,376,000 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 243,354,086 - 243,374,286 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 251,515,855 - 251,519,653 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 258,216,947 - 258,220,745 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 250,866,030 - 250,869,828 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 264,244,150 - 264,266,136 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 264,260,505 - 264,264,302 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 271,686,942 - 271,707,512 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 249,559,236 - 249,563,033 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 249,743,064 - 249,822,688 (+) NCBI Celera 1 239,184,707 - 239,188,504 (+) NCBI Celera Cytogenetic Map 1 q54 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Wnt8b Rat 1,2-dichloroethane increases expression ISO Wnt8b (Mus musculus) 6480464 ethylene dichloride results in increased expression of WNT8B mRNA CTD PMID:28960355 Wnt8b Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Wnt8b (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Wnt8b Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO WNT8B (Homo sapiens) 6480464 2 more ... CTD PMID:31326446 Wnt8b Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Wnt8b (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Wnt8b Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of WNT8B mRNA CTD PMID:33387578 Wnt8b Rat 4,4'-sulfonyldiphenol decreases expression ISO Wnt8b (Mus musculus) 6480464 bisphenol S results in decreased expression of WNT8B mRNA CTD PMID:30951980 Wnt8b Rat 5-aza-2'-deoxycytidine increases expression ISO Wnt8b (Mus musculus) 6480464 Decitabine results in increased expression of WNT8B mRNA CTD PMID:27915011 Wnt8b Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of WNT8B mRNA CTD PMID:33150595 Wnt8b Rat 6-propyl-2-thiouracil increases methylation EXP 6480464 Propylthiouracil results in increased methylation of WNT8B promoter CTD PMID:33150595 Wnt8b Rat acrylamide decreases expression ISO WNT8B (Homo sapiens) 6480464 Acrylamide results in decreased expression of WNT8B mRNA CTD PMID:32763439 Wnt8b Rat aristolochic acid A increases expression ISO WNT8B (Homo sapiens) 6480464 aristolochic acid I results in increased expression of WNT8B mRNA CTD PMID:33212167 Wnt8b Rat benzo[a]pyrene increases methylation ISO WNT8B (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of WNT8B exon and Benzo(a)pyrene results in increased methylation of WNT8B promoter CTD PMID:27901495 Wnt8b Rat bis(2-ethylhexyl) phthalate decreases expression ISO WNT8B (Homo sapiens) 6480464 Diethylhexyl Phthalate results in decreased expression of WNT8B mRNA CTD PMID:31163220 Wnt8b Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of WNT8B mRNA CTD PMID:25181051 Wnt8b Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of WNT8B mRNA CTD PMID:30816183 Wnt8b Rat bisphenol A decreases expression ISO Wnt8b (Mus musculus) 6480464 bisphenol A results in decreased expression of WNT8B mRNA CTD PMID:30951980 Wnt8b Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of WNT8B gene CTD PMID:28505145 Wnt8b Rat bisphenol F decreases expression ISO Wnt8b (Mus musculus) 6480464 bisphenol F results in decreased expression of WNT8B mRNA CTD PMID:30951980 Wnt8b Rat CGP 52608 multiple interactions ISO WNT8B (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to WNT8B gene] CTD PMID:28238834 Wnt8b Rat decabromodiphenyl ether decreases expression ISO WNT8B (Homo sapiens) 6480464 decabromobiphenyl ether results in decreased expression of WNT8B mRNA CTD PMID:31326446 Wnt8b Rat niclosamide increases expression ISO WNT8B (Homo sapiens) 6480464 Niclosamide results in increased expression of WNT8B mRNA CTD PMID:36318118 Wnt8b Rat PCB138 multiple interactions ISO Wnt8b (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Wnt8b Rat resveratrol multiple interactions ISO WNT8B (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of WNT8B mRNA CTD PMID:23557933 Wnt8b Rat sotorasib multiple interactions ISO WNT8B (Homo sapiens) 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in decreased expression of WNT8B mRNA CTD PMID:36139627 Wnt8b Rat Tetrachlorobisphenol A decreases expression ISO WNT8B (Homo sapiens) 6480464 tetrachlorodian results in decreased expression of WNT8B mRNA CTD PMID:31326446 Wnt8b Rat titanium dioxide decreases expression ISO Wnt8b (Mus musculus) 6480464 titanium dioxide results in decreased expression of WNT8B mRNA CTD PMID:35295148 Wnt8b Rat trametinib multiple interactions ISO WNT8B (Homo sapiens) 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in decreased expression of WNT8B mRNA CTD PMID:36139627 Wnt8b Rat triptonide increases expression ISO Wnt8b (Mus musculus) 6480464 triptonide results in increased expression of WNT8B mRNA CTD PMID:33045310 Wnt8b Rat valproic acid decreases expression ISO Wnt8b (Mus musculus) 6480464 Valproic Acid results in decreased expression of WNT8B mRNA CTD PMID:24896083
Imported Annotations - KEGG (archival)
1,2-dichloroethane (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 4,4'-sulfonyldiphenol (ISO) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP) acrylamide (ISO) aristolochic acid A (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) CGP 52608 (ISO) decabromodiphenyl ether (ISO) niclosamide (ISO) PCB138 (ISO) resveratrol (ISO) sotorasib (ISO) Tetrachlorobisphenol A (ISO) titanium dioxide (ISO) trametinib (ISO) triptonide (ISO) valproic acid (ISO)
Wnt8b Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 253,303,369 - 253,325,224 (+) NCBI GRCr8 mRatBN7.2 1 243,354,145 - 243,376,000 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 243,354,086 - 243,374,286 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 251,515,855 - 251,519,653 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 258,216,947 - 258,220,745 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 250,866,030 - 250,869,828 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 264,244,150 - 264,266,136 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 264,260,505 - 264,264,302 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 271,686,942 - 271,707,512 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 249,559,236 - 249,563,033 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 249,743,064 - 249,822,688 (+) NCBI Celera 1 239,184,707 - 239,188,504 (+) NCBI Celera Cytogenetic Map 1 q54 NCBI
WNT8B Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 10 100,463,009 - 100,483,744 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 10 100,463,009 - 100,483,744 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 10 102,222,766 - 102,243,501 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 10 102,212,802 - 102,233,389 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 10 102,212,787 - 102,233,491 NCBI Celera 10 95,960,656 - 95,981,247 (+) NCBI Celera Cytogenetic Map 10 q24.31 NCBI HuRef 10 95,851,649 - 95,872,259 (+) NCBI HuRef CHM1_1 10 102,507,449 - 102,528,036 (+) NCBI CHM1_1 T2T-CHM13v2.0 10 101,346,091 - 101,366,850 (+) NCBI T2T-CHM13v2.0
Wnt8b Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 19 44,481,912 - 44,502,712 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 19 44,481,911 - 44,502,712 (+) Ensembl GRCm39 Ensembl GRCm38 19 44,493,472 - 44,514,273 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 19 44,493,472 - 44,514,273 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 19 44,567,962 - 44,588,763 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 19 44,546,784 - 44,565,828 (+) NCBI MGSCv36 mm8 Celera 19 45,276,759 - 45,282,000 (+) NCBI Celera Cytogenetic Map 19 C3 NCBI cM Map 19 37.98 NCBI
Wnt8b Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955485 9,658,432 - 9,679,385 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955485 9,658,432 - 9,679,371 (-) NCBI ChiLan1.0 ChiLan1.0
WNT8B Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 8 112,347,018 - 112,367,626 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 10 112,352,338 - 112,372,946 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 10 97,079,996 - 97,083,933 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 10 100,550,158 - 100,565,369 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 10 100,544,531 - 100,565,369 (+) Ensembl panpan1.1 panPan2
WNT8B Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 28 13,187,927 - 13,210,398 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 28 13,188,142 - 13,210,398 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 28 13,358,682 - 13,383,539 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 28 13,656,897 - 13,681,768 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 28 13,657,358 - 13,679,572 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 28 13,203,326 - 13,228,261 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 28 13,241,826 - 13,266,719 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 28 13,375,944 - 13,400,875 (+) NCBI UU_Cfam_GSD_1.0
Wnt8b Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 33,560,758 - 33,584,103 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936600 5,163,972 - 5,187,224 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936600 5,163,940 - 5,187,098 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
WNT8B Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 111,562,489 - 111,589,893 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 111,562,278 - 111,589,897 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 63,953,354 - 63,981,516 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
WNT8B Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 9 93,478,569 - 93,504,279 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 9 93,479,392 - 93,501,835 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666048 54,535,855 - 54,544,499 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Wnt8b
.
Predicted Target Of
Count of predictions: 283 Count of miRNA genes: 180 Interacting mature miRNAs: 203 Transcripts: ENSRNOT00000018815 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 631690 Scl5 Serum cholesterol level QTL 5 2.1 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 1 236125214 260522016 Rat 1354652 Kidm20 Kidney mass QTL 20 4.3 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 177227632 256448636 Rat 2293674 Bss39 Bone structure and strength QTL 39 7.1 0.0001 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 1 201554356 246554356 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 61327 Eae7 Experimental allergic encephalomyelitis QTL 7 5.6 body mass (VT:0001259) change in body weight (CMO:0002045) 1 216255568 260522016 Rat 1600392 Bw123 Body weight QTL 123 0.001 body mass (VT:0001259) body weight (CMO:0000012) 1 223201027 260522016 Rat 1578763 Kidm29 Kidney mass QTL 29 3.3 0.0001 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 1 179567751 260522016 Rat 1600395 Niddm69 Non-insulin dependent diabetes mellitus QTL 69 4.14 0.0002 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 195804352 257091168 Rat 1354624 Cm35 Cardiac mass QTL35 5.7 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 177227632 256448636 Rat 1600396 Niddm68 Non-insulin dependent diabetes mellitus QTL 68 4.97 0.0003 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 631837 Niddm35 Non-insulin dependent diabetes mellitus QTL 35 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 238699859 259647894 Rat 1600397 Edcs4 Endometrial carcinoma susceptibility QTL 4 2.2 uterus morphology trait (VT:0001120) percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759) 1 206081677 251081677 Rat 631836 Stl31 Serum triglyceride level QTL 31 4.64 5e-06 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 1 237147813 260522016 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 1600388 Niddm67 Non-insulin dependent diabetes mellitus QTL 67 5.84 0.000004 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 2293694 Bss38 Bone structure and strength QTL 38 7.05 0.0001 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 1 201554356 246554356 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 1300108 Rf8 Renal function QTL 8 3.75 renal blood flow trait (VT:2000006) absolute change in renal vascular resistance (CMO:0001900) 1 228581588 259647894 Rat 8655655 Arrd2 Age-related retinal degeneration QTL 2 7.79 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 183970203 243914901 Rat 734767 Niddm57 Non-insulin dependent diabetes mellitus QTL 57 body mass (VT:0001259) body weight (CMO:0000012) 1 224054293 260122809 Rat 1358898 Bp255 Blood pressure QTL 255 3.6 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 191019702 246062233 Rat 631215 Stl8 Serum triglyceride level QTL 8 9.27 0.0001 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 1 225126575 260522016 Rat 631843 Bw116 Body weight QTL 116 4.1 0.016 abdominal adipose amount (VT:1000220) abdominal fat pad weight (CMO:0000088) 1 224054293 260122809 Rat 2300175 Bmd40 Bone mineral density QTL 40 15.4 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 1 201554356 246554356 Rat 731175 Uae20 Urinary albumin excretion QTL 20 3.5 0.0018 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 221264111 259647894 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 724538 Kidm1 Kidney mass QTL 1 3.2 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 213707201 252085212 Rat 2293655 Bss36 Bone structure and strength QTL 36 10.66 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 201554356 246554356 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 734769 Niddm58 Non-insulin dependent diabetes mellitus QTL 58 body mass (VT:0001259) body weight (CMO:0000012) 1 224569538 260122809 Rat 734768 Niddm59 Non-insulin dependent diabetes mellitus QTL 59 body mass (VT:0001259) body weight (CMO:0000012) 1 213843987 258843987 Rat 1358890 Bp259 Blood pressure QTL 259 3.06 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 210702053 260522016 Rat 724533 Rf51 Renal function QTL 51 5.3 0.0002 kidney plasma flow trait (VT:0005524) renal plasma flow (CMO:0001914) 1 218753816 256448513 Rat 1354580 Scort1 Serum corticosterone level QTL 1 3.4 blood corticosterone amount (VT:0005345) blood corticosterone level (CMO:0001172) 1 156677124 256448636 Rat 634313 Niddm43 Non-insulin dependent diabetes mellitus QTL 43 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 199050459 259647894 Rat 1549910 Bw54 Body weight QTL 54 0.05 body mass (VT:0001259) body weight (CMO:0000012) 1 214647894 259647894 Rat 70211 Niddm24 Non-insulin dependent diabetes mellitus QTL 24 3.79 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 214647894 259647894 Rat 1357399 Bw45 Body weight QTL 45 3.05 body mass (VT:0001259) body mass index (BMI) (CMO:0000105) 1 206329708 251329708 Rat 724552 Glom2 Glomerulus QTL 2 3.3 0.0001 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli directly contacting the kidney surface (CMO:0001001) 1 222363780 260522016 Rat 2316896 Gluco57 Glucose level QTL 57 7.2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 228985440 245907899 Rat 1357404 Bw42 Body weight QTL 42 4.49 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 1 206329708 251329708 Rat 10053715 Scort24 Serum corticosterone level QTL 24 2.13 0.0088 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 221414816 260522016 Rat 61400 Niddm1 Non-insulin dependent diabetes mellitus QTL 1 11 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 218753689 245907899 Rat 10059587 Bw173 Body weight QTL 173 3.23 0.025 body mass (VT:0001259) body weight (CMO:0000012) 1 202069611 247069611 Rat 2292216 Bw80 Body weight QTL 80 3.23 0.0019 body mass (VT:0001259) body weight (CMO:0000012) 1 213533809 243914901 Rat 2292220 Bp306 Blood pressure QTL 306 3.47 0.00087 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 243914901 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 2293700 Bmd27 Bone mineral density QTL 27 6.6 0.0001 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 1 224054293 243747962 Rat 2293701 Bmd34 Bone mineral density QTL 34 8.3 0.0001 femur strength trait (VT:0010010) femoral neck ultimate force (CMO:0001703) 1 224054293 243747962 Rat 7387289 Uae45 Urinary albumin excretion QTL 45 2.86 0.0021 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 223262787 260522016 Rat 8655855 Arrd3 Age-related retinal degeneration QTL 3 3.07 lens clarity trait (VT:0001304) cataract incidence/prevalence measurement (CMO:0001585) 1 183970203 243914901 Rat 1581544 Rf52 Renal function QTL 52 0.05 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 1 232156370 259647894 Rat 1600363 Hc6 Hypercalciuria QTL 6 2.7 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 203995416 244113296 Rat 631536 Lnnr2 Liver neoplastic nodule remodeling QTL 2 2.9 0.0005 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705) 1 233948574 260522016 Rat 738032 Hcas5 Hepatocarcinoma susceptibility QTL 5 3.12 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 176426412 257976495 Rat 1358191 Ept10 Estrogen-induced pituitary tumorigenesis QTL 10 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 192825253 243914732 Rat 2302040 Pia35 Pristane induced arthritis QTL 35 3.8 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 1 216255568 260522016 Rat 631669 Iddm9 Insulin dependent diabetes mellitus QTL 9 2.8 0.039 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 233190394 258625266 Rat 7394701 Uae46 Urinary albumin excretion QTL 46 3.6 0.0056 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 201554356 246554356 Rat 1598821 Rf55 Renal function QTL 55 6.3 renal blood flow trait (VT:2000006) ratio of change in renal blood flow to change in renal perfusion pressure (CMO:0001239) 1 218748008 257976495 Rat
UniSTS:471332
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 243,371,293 - 243,372,283 (+) MAPPER mRatBN7.2 Rnor_6.0 1 264,261,310 - 264,262,299 NCBI Rnor6.0 Rnor_5.0 1 271,704,475 - 271,705,464 UniSTS Rnor5.0 RGSC_v3.4 1 249,560,041 - 249,561,030 UniSTS RGSC3.4 Celera 1 239,185,512 - 239,186,501 UniSTS Cytogenetic Map 1 q54 UniSTS
Wnt8b
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 243,373,286 - 243,373,841 (+) MAPPER mRatBN7.2 Rnor_6.0 1 264,263,303 - 264,263,857 NCBI Rnor6.0 Rnor_5.0 1 271,706,468 - 271,707,022 UniSTS Rnor5.0 RGSC_v3.4 1 249,562,034 - 249,562,588 UniSTS RGSC3.4 Celera 1 239,187,505 - 239,188,059 UniSTS Cytogenetic Map 1 q54 UniSTS
UniSTS:277890
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 243,373,357 - 243,373,488 (+) MAPPER mRatBN7.2 Rnor_6.0 1 264,263,374 - 264,263,504 NCBI Rnor6.0 Rnor_5.0 1 271,706,539 - 271,706,669 UniSTS Rnor5.0 RGSC_v3.4 1 249,562,105 - 249,562,235 UniSTS RGSC3.4 Celera 1 239,187,576 - 239,187,706 UniSTS Cytogenetic Map 1 q54 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
5
7
15
101
39
29
14
9
14
2
98
43
85
31
48
15
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000018815 ⟹ ENSRNOP00000018815
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 243,354,086 - 243,374,286 (+) Ensembl Rnor_6.0 Ensembl 1 264,260,505 - 264,264,302 (+) Ensembl
RefSeq Acc Id:
NM_001106359 ⟹ NP_001099829
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 253,303,369 - 253,325,224 (+) NCBI mRatBN7.2 1 243,354,145 - 243,376,000 (+) NCBI Rnor_6.0 1 264,260,505 - 264,264,302 (+) NCBI Rnor_5.0 1 271,686,942 - 271,707,512 (+) NCBI RGSC_v3.4 1 249,559,236 - 249,563,033 (+) RGD Celera 1 239,184,707 - 239,188,504 (+) RGD
Sequence:
GGTCAGTGAACAATTTCCTGATGACTGGACCAAAGGCTTACCTGGTCTACTCCAGCAGTGTGGCAGCTGGCGCCCAGAGCGGGATTGAAGAATGTAAATACCAGTTTGCTTGGGACCGCTGGAATTGC
hide sequence
RefSeq Acc Id:
NP_001099829 ⟸ NM_001106359
- Peptide Label:
precursor
- UniProtKB:
D3ZND6 (UniProtKB/TrEMBL)
- Sequence:
MTGPKAYLVYSSSVAAGAQSGIEECKYQFAWDRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDAR
hide sequence
Ensembl Acc Id:
ENSRNOP00000018815 ⟸ ENSRNOT00000018815
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2017-03-29
Wnt8b
Wnt family member 8B
Wnt8b
wingless-type MMTV integration site family, member 8B
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-11-14
Wnt8b
wingless-type MMTV integration site family, member 8B
Wnt8b
wingless related MMTV integration site 8b
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Wnt8b
wingless related MMTV integration site 8b
Wnt8b_predicted
wingless related MMTV integration site 8b (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Wnt8b_predicted
wingless related MMTV integration site 8b (predicted)
Symbol and Name status set to approved
70820 APPROVED
