Symbol:
Snx11
Name:
sorting nexin 11
RGD ID:
1307319
Description:
Predicted to enable phosphatidylinositol phosphate binding activity. Predicted to be involved in vesicle organization. Predicted to be located in cytoplasm and plasma membrane. Predicted to be active in endosome. Orthologous to human SNX11 (sorting nexin 11); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC303493; sorting nexin-11
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SNX11 (sorting nexin 11) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Snx11 (sorting nexin 11) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Snx11 (sorting nexin 11) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SNX11 (sorting nexin 11) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SNX11 (sorting nexin 11) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Snx11 (sorting nexin 11) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SNX11 (sorting nexin 11) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SNX11 (sorting nexin 11) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Snx11 (sorting nexin 11) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
SNX11 (sorting nexin 11)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Snx11 (sorting nexin 11)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
snx11 (sorting nexin 11)
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
snx11
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 82,238,475 - 82,249,264 (-) NCBI GRCr8 mRatBN7.2 10 81,742,020 - 81,752,778 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 81,742,024 - 81,752,712 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 86,690,008 - 86,700,458 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 86,188,062 - 86,198,512 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 81,580,662 - 81,591,112 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 84,628,420 - 84,639,125 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 84,628,424 - 84,639,111 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 84,421,491 - 84,432,034 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 85,516,530 - 85,526,895 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 85,530,903 - 85,541,265 (-) NCBI Celera 10 80,504,024 - 80,513,792 (-) NCBI Celera Cytogenetic Map 10 q31 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Snx11 Rat 1,2-dichloroethane decreases expression ISO Snx11 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of SNX11 mRNA CTD PMID:28960355 Snx11 Rat 1,2-dimethylhydrazine multiple interactions ISO Snx11 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of SNX11 mRNA CTD PMID:22206623 Snx11 Rat 17alpha-ethynylestradiol increases expression ISO Snx11 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of SNX11 mRNA CTD PMID:17942748 Snx11 Rat 17alpha-ethynylestradiol multiple interactions ISO Snx11 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of SNX11 mRNA CTD PMID:17942748 Snx11 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of SNX11 mRNA CTD PMID:32145629 Snx11 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Snx11 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of SNX11 mRNA CTD PMID:21570461 Snx11 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of SNX11 mRNA CTD PMID:21215274 Snx11 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Snx11 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of SNX11 mRNA CTD PMID:17942748 Snx11 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of SNX11 mRNA CTD PMID:21346803 Snx11 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Snx11 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of SNX11 mRNA CTD PMID:20188158 Snx11 Rat 4,4'-sulfonyldiphenol increases methylation ISO Snx11 (Mus musculus) 6480464 bisphenol S results in increased methylation of SNX11 exon CTD PMID:33297965 Snx11 Rat 4,4'-sulfonyldiphenol affects methylation ISO Snx11 (Mus musculus) 6480464 bisphenol S affects the methylation of SNX11 gene CTD PMID:31683443 Snx11 Rat aflatoxin B1 increases expression ISO Snx11 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of SNX11 mRNA CTD PMID:19770486 Snx11 Rat aflatoxin B1 decreases expression EXP 6480464 Aflatoxin B1 results in decreased expression of SNX11 mRNA CTD PMID:33354967 Snx11 Rat all-trans-retinoic acid increases expression ISO SNX11 (Homo sapiens) 6480464 Tretinoin results in increased expression of SNX11 mRNA CTD PMID:33167477 Snx11 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of SNX11 mRNA CTD PMID:35163327 Snx11 Rat antirheumatic drug decreases expression ISO SNX11 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of SNX11 mRNA CTD PMID:24449571 Snx11 Rat benzo[a]pyrene increases expression ISO Snx11 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of SNX11 mRNA CTD PMID:22228805 Snx11 Rat bis(2-ethylhexyl) phthalate increases expression ISO Snx11 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of SNX11 mRNA CTD PMID:34319233 Snx11 Rat cadmium atom decreases expression ISO Snx11 (Mus musculus) 6480464 Cadmium results in decreased expression of SNX11 mRNA CTD PMID:24067728 Snx11 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of SNX11 mRNA CTD PMID:33453195 Snx11 Rat carbon nanotube increases expression ISO Snx11 (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of SNX11 mRNA CTD PMID:25620056 Snx11 Rat CGP 52608 multiple interactions ISO SNX11 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to SNX11 gene] CTD PMID:28238834 Snx11 Rat cyclosporin A increases expression ISO SNX11 (Homo sapiens) 6480464 Cyclosporine results in increased expression of SNX11 mRNA CTD PMID:25562108 Snx11 Rat fenthion decreases expression ISO Snx11 (Mus musculus) 6480464 Fenthion results in decreased expression of SNX11 mRNA CTD PMID:34813904 Snx11 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of SNX11 mRNA CTD PMID:24793618 Snx11 Rat folic acid multiple interactions ISO Snx11 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of SNX11 mRNA CTD PMID:22206623 Snx11 Rat FR900359 increases phosphorylation ISO SNX11 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of SNX11 protein CTD PMID:37730182 Snx11 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of SNX11 mRNA CTD PMID:33387578 Snx11 Rat graphite affects expression EXP 6480464 Graphite affects the expression of SNX11 mRNA CTD PMID:29933104 Snx11 Rat methidathion decreases expression ISO Snx11 (Mus musculus) 6480464 methidathion results in decreased expression of SNX11 mRNA CTD PMID:34813904 Snx11 Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of SNX11 gene CTD PMID:33148267 Snx11 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of SNX11 mRNA CTD PMID:33387578 Snx11 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of SNX11 mRNA CTD PMID:35163327 Snx11 Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of SNX11 gene CTD PMID:33148267 Snx11 Rat rotenone decreases expression ISO SNX11 (Homo sapiens) 6480464 Rotenone results in decreased expression of SNX11 mRNA CTD PMID:33512557 Snx11 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of SNX11 mRNA CTD PMID:34492290 Snx11 Rat triphenyl phosphate affects expression EXP 6480464 triphenyl phosphate affects the expression of SNX11 mRNA CTD PMID:30589522 Snx11 Rat triphenyl phosphate affects expression ISO SNX11 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of SNX11 mRNA CTD PMID:37042841 Snx11 Rat Triptolide increases expression ISO Snx11 (Mus musculus) 6480464 triptolide results in increased expression of SNX11 mRNA CTD PMID:32835833 Snx11 Rat triptonide increases expression ISO Snx11 (Mus musculus) 6480464 triptonide results in increased expression of SNX11 mRNA CTD PMID:33045310 Snx11 Rat urethane increases expression ISO SNX11 (Homo sapiens) 6480464 Urethane results in increased expression of SNX11 mRNA CTD PMID:28818685 Snx11 Rat valdecoxib decreases expression EXP 6480464 valdecoxib results in decreased expression of SNX11 mRNA CTD PMID:24136188 Snx11 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of SNX11 mRNA CTD PMID:22615374 Snx11 Rat vincristine increases expression ISO SNX11 (Homo sapiens) 6480464 Vincristine results in increased expression of SNX11 mRNA CTD PMID:23649840
1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-sulfonyldiphenol (ISO) aflatoxin B1 (EXP,ISO) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) antirheumatic drug (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) cadmium atom (ISO) cadmium dichloride (EXP) carbon nanotube (ISO) CGP 52608 (ISO) cyclosporin A (ISO) fenthion (ISO) flutamide (EXP) folic acid (ISO) FR900359 (ISO) gentamycin (EXP) graphite (EXP) methidathion (ISO) N,N-diethyl-m-toluamide (EXP) paracetamol (EXP) perfluorooctanoic acid (EXP) permethrin (EXP) rotenone (ISO) thioacetamide (EXP) triphenyl phosphate (EXP,ISO) Triptolide (ISO) triptonide (ISO) urethane (ISO) valdecoxib (EXP) vinclozolin (EXP) vincristine (ISO)
Snx11 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 82,238,475 - 82,249,264 (-) NCBI GRCr8 mRatBN7.2 10 81,742,020 - 81,752,778 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 81,742,024 - 81,752,712 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 86,690,008 - 86,700,458 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 86,188,062 - 86,198,512 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 81,580,662 - 81,591,112 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 84,628,420 - 84,639,125 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 84,628,424 - 84,639,111 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 84,421,491 - 84,432,034 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 85,516,530 - 85,526,895 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 85,530,903 - 85,541,265 (-) NCBI Celera 10 80,504,024 - 80,513,792 (-) NCBI Celera Cytogenetic Map 10 q31 NCBI
SNX11 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 48,107,523 - 48,123,601 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 48,103,357 - 48,123,601 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 46,185,128 - 46,200,963 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 43,539,919 - 43,555,104 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 17 43,539,918 - 43,555,104 NCBI Celera 17 42,639,285 - 42,654,466 (+) NCBI Celera Cytogenetic Map 17 q21.32 NCBI HuRef 17 41,554,691 - 41,569,833 (+) NCBI HuRef CHM1_1 17 46,249,918 - 46,265,134 (+) NCBI CHM1_1 T2T-CHM13v2.0 17 48,970,884 - 48,986,962 (+) NCBI T2T-CHM13v2.0
Snx11 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 96,658,372 - 96,668,538 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 96,658,381 - 96,668,385 (-) Ensembl GRCm39 Ensembl GRCm38 11 96,767,546 - 96,777,712 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 96,767,555 - 96,777,559 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 96,628,863 - 96,638,869 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 96,583,645 - 96,593,621 (-) NCBI MGSCv36 mm8 Celera 11 106,414,426 - 106,424,430 (-) NCBI Celera Cytogenetic Map 11 D NCBI cM Map 11 60.1 NCBI
Snx11 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955451 13,051,169 - 13,056,628 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955451 13,051,649 - 13,060,479 (-) NCBI ChiLan1.0 ChiLan1.0
SNX11 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 16,978,777 - 16,994,004 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 18,944,407 - 18,959,635 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 9,412,559 - 9,428,114 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 9,595,666 - 9,610,663 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 9,595,666 - 9,610,592 (-) Ensembl panpan1.1 panPan2
SNX11 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 9 24,393,150 - 24,412,850 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 9 24,393,227 - 24,401,851 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 9 23,859,366 - 23,879,891 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 9 25,187,359 - 25,207,891 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 9 25,187,400 - 25,197,077 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 9 23,956,905 - 23,977,639 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 9 24,217,169 - 24,237,712 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 9 24,344,598 - 24,365,117 (+) NCBI UU_Cfam_GSD_1.0
Snx11 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 23,839,492 - 23,850,159 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936490 13,224,053 - 13,235,723 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936490 13,224,977 - 13,235,723 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SNX11 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 12 24,351,390 - 24,360,917 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 12 24,351,280 - 24,360,921 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 12 24,209,912 - 24,219,518 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SNX11 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 16 68,504,236 - 68,527,676 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 16 68,504,640 - 68,529,030 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666077 39,564,977 - 39,579,973 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Snx11
.
Predicted Target Of
Count of predictions: 216 Count of miRNA genes: 148 Interacting mature miRNAs: 183 Transcripts: ENSRNOT00000011474 Prediction methods: Miranda, Targetscan Result types: miRGate_prediction
1549846 Scl47 Serum cholesterol level QTL 47 3.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 50574707 95574707 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 631552 Vetf2 Vascular elastic tissue fragility QTL 2 4.5 0.0002 aorta elastic tissue integrity trait (VT:0010556) artery internal elastic lamina non-tumorous lesion count (CMO:0001913) 10 41142633 86142633 Rat 61449 Ciaa2 CIA Autoantibody QTL 2 7.1 blood autoantibody amount (VT:0003725) calculated serum anti-type 2 collagen antibody titer (CMO:0001279) 10 63221094 107211142 Rat 631555 Bp134 Blood pressure QTL 134 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 80515287 91230079 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1298078 Stresp5 Stress response QTL 5 2.99 0.00025 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 42045676 104670812 Rat 1549831 Bss6 Bone structure and strength QTL 6 4 lumbar vertebra strength trait (VT:0010574) vertebra ultimate force (CMO:0001678) 10 57576521 102576521 Rat 70164 Bw21 Body weight QTL 21 4.36 0.00005 body mass (VT:0001259) body weight (CMO:0000012) 10 53797494 98952626 Rat 61463 Bp12 Blood pressure QTL 12 6.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 41333258 86333258 Rat 2298548 Neuinf7 Neuroinflammation QTL 7 3.4 nervous system integrity trait (VT:0010566) spinal cord RT1-B protein level (CMO:0002132) 10 72224939 107211142 Rat 1579919 Bp281 Blood pressure QTL 281 0.01 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 74372084 94965338 Rat 1302404 Cia27 Collagen induced arthritis QTL 27 2.6 0.0045 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 10 76452683 107211142 Rat 1300107 Rf18 Renal function QTL 18 3.41 urine output (VT:0003620) timed urine volume (CMO:0000260) 10 78775516 98279596 Rat 8694173 Bw149 Body weight QTL 149 4.38 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 10 44441699 89441699 Rat 2300218 Hpcl2 Hepatic cholesterol level QTL 2 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 45029650 95600334 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 70171 Cari1 Carrageenan-induced inflammation QTL 1 4.9 0.0005 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 10 53797385 107211142 Rat 10450495 Bp383 Blood pressure QTL 383 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 76246085 94965338 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2292617 Ept18 Estrogen-induced pituitary tumorigenesis QTL 18 3.9 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 10 73453136 96120911 Rat 2301967 Cm73 Cardiac mass QTL 73 4.55 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 10 14487011 89062041 Rat 2313103 Bss80 Bone structure and strength QTL 80 2 0.0001 tibia strength trait (VT:1000284) tibia midshaft endosteal cross-sectional area (CMO:0001716) 10 62057807 107057807 Rat 2293646 Bss25 Bone structure and strength QTL 25 10.96 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 10 69738412 107211142 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 70188 BpQTLcluster1 Blood pressure QTL cluster 1 4.864 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 42323132 87323132 Rat 2300172 Bmd57 Bone mineral density QTL 57 9.8 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 10 69738412 107211142 Rat 724516 Uae17 Urinary albumin excretion QTL 17 3.6 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 10 78210622 85220348 Rat 70193 Mcs7 Mammary carcinoma susceptibility QTL 7 2.38 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 10 72224939 107211142 Rat 2313105 Bss79 Bone structure and strength QTL 79 1.8 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 62057807 107057807 Rat 9589030 Epfw9 Epididymal fat weight QTL 9 19.24 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 10 44441699 89441699 Rat 1357344 Bp249 Blood pressure QTL 249 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 66743655 98003205 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 70198 BpQTLcluster9 Blood pressure QTL cluster 9 2.94 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 42323132 87323132 Rat 2306970 Anxrr22 Anxiety related response QTL 22 5.95 fear/anxiety-related behavior trait (VT:1000241) number of periods of voluntary immobility (CMO:0001045) 10 61345276 98211570 Rat 1359017 Hrtrt21 Heart rate QTL 21 2.4 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 10 51772940 96772940 Rat 2293663 Bss33 Bone structure and strength QTL 33 9.34 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 10 69738412 107211142 Rat 7387312 Bw125 Body weight QTL 125 3 0.0047 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight (CMO:0000356) 10 64890616 107211142 Rat 2312672 Insul15 Insulin level QTL 15 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 10 57134272 102134272 Rat 6893357 Bw102 Body weight QTL 102 0.5 0.36 body mass (VT:0001259) body weight (CMO:0000012) 10 80515287 101325465 Rat 2317029 Aia19 Adjuvant induced arthritis QTL 19 2.98 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 66978955 107211142 Rat 2303589 Bw87 Body weight QTL 87 2 body mass (VT:0001259) body weight (CMO:0000012) 10 81285008 107211142 Rat 724556 Pur2 Proteinuria QTL 2 5.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 22427500 90627625 Rat 2306793 Ean5 Experimental allergic neuritis QTL 5 4.7 nervous system integrity trait (VT:0010566) IFNG-secreting splenocyte count (CMO:0002122) 10 72552416 93995749 Rat 61387 Bp1 Blood pressure QTL 1 5.1 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 51770177 107211142 Rat 2317039 Aia6 Adjuvant induced arthritis QTL 6 4.31 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 66978955 107211142 Rat 2317043 Aia7 Adjuvant induced arthritis QTL 7 3.82 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 37565079 82565079 Rat 2317042 Aia20 Adjuvant induced arthritis QTL 20 3.38 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 37565079 82565079 Rat 2298481 Eau9 Experimental allergic uveoretinitis QTL 9 0.0169 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 10 65927233 82565079 Rat 61396 Bp9 Blood pressure QTL 9 4.8 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 68420376 107211142 Rat 1358915 Stresp7 Stress response QTL 7 3.52 blood norepinephrine amount (VT:0005663) plasma norepinephrine level (CMO:0001010) 10 78899655 87307728 Rat 61402 Niddm3 Non-insulin dependent diabetes mellitus QTL 3 4.58 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 61345413 82564856 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 70364 Bp72 Blood pressure QTL 72 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 51121100 96121100 Rat 10450498 Bp384 Blood pressure QTL 384 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 67750049 107211142 Rat 4889492 Pancm2 Pancreatic morphology QTL 2 3.2 pancreatic beta cell morphology trait (VT:0005217) ratio of insulin-positive cell area to total area of splenic region of pancreas (CMO:0001814) 10 76748906 107211142 Rat 6893366 Bw106 Body weight QTL 106 0.3 0.47 body mass (VT:0001259) body weight (CMO:0000012) 10 70199100 107211142 Rat 2293698 Bss43 Bone structure and strength QTL 43 5.33 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 10 59209888 104209888 Rat 631530 Tls3 T-lymphoma susceptibility QTL 3 0 0.0001 thymus integrity trait (VT:0010555) percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911) 10 51774612 95600334 Rat 1354608 Cm33 Cardiac mass QTL 33 2.8 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 10 54809292 99809292 Rat 1558643 Cm44 Cardiac mass QTL 44 4.8 0.0000368 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 61345276 99703528 Rat 631535 Cm51 Cardiac mass QTL 51 3 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 10 51786282 91669536 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1576308 Schws1 Schwannoma susceptibility QTL 1 0.0041 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 40035094 102359817 Rat 631269 Cia22 Collagen induced arthritis QTL 22 8.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 631270 Cia23 Collagen induced arthritis QTL 23 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 7411614 Foco18 Food consumption QTL 18 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 44441699 89441699 Rat 2325836 Bp346 Blood pressure QTL 346 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 76246085 84007272 Rat 6893336 Cm75 Cardiac mass QTL 75 0.1 0.87 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 61345276 99703528 Rat 12880053 Cm104 Cardiac mass QTL 104 0.009 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 10 73452992 83463334 Rat 631547 Bp87 Blood pressure QTL 87 4.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 47369470 92369470 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 2292438 Bp311 Blood pressure QTL 311 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 76246085 107211142 Rat 2312662 Slep8 Serum leptin concentration QTL 8 0.05 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 10 57134272 102134272 Rat 12880050 Am10 Aortic mass QTL 10 0.016 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 10 74372084 84007272 Rat 1358188 Ept9 Estrogen-induced pituitary tumorigenesis QTL 9 3.9 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 10 73453136 96120911 Rat 631537 Oia4 Oil induced arthritis QTL 4 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 75631887 87055282 Rat 634354 Rends3 Renal damage susceptibility QTL 3 0.05 kidney blood vessel morphology trait (VT:0000530) organ lesion measurement (CMO:0000677) 10 79813789 85160854 Rat 1642980 Bp300 Blood pressure QTL 300 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 68383129 107211142 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat 2312668 Scl65 Serum cholesterol level QTL 65 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 57134272 102134272 Rat
AI117694
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 81,742,154 - 81,742,261 (+) MAPPER mRatBN7.2 Rnor_6.0 10 84,628,555 - 84,628,661 NCBI Rnor6.0 Rnor_5.0 10 84,421,626 - 84,421,732 UniSTS Rnor5.0 RGSC_v3.4 10 85,516,665 - 85,516,771 UniSTS RGSC3.4 Celera 10 80,504,159 - 80,504,265 UniSTS Cytogenetic Map 10 q31 UniSTS
AW526629
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 81,743,393 - 81,743,572 (+) MAPPER mRatBN7.2 Rnor_6.0 10 84,629,794 - 84,629,972 NCBI Rnor6.0 Rnor_5.0 10 84,422,865 - 84,423,043 UniSTS Rnor5.0 RGSC_v3.4 10 85,517,904 - 85,518,082 UniSTS RGSC3.4 Celera 10 80,505,398 - 80,505,576 UniSTS RH 3.4 Map 10 769.9 UniSTS Cytogenetic Map 10 q31 UniSTS
MARC_23527-23528:1027525177:1
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 10 82,244,468 - 82,244,917 (+) Marker Load Pipeline Rnor_6.0 10 84,634,415 - 84,634,856 NCBI Rnor6.0 Rnor_5.0 10 84,427,324 - 84,427,771 UniSTS Rnor5.0 RGSC_v3.4 10 85,522,199 - 85,522,646 UniSTS RGSC3.4 Celera 10 80,509,095 - 80,509,543 UniSTS Cytogenetic Map 10 q31 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000011474 ⟹ ENSRNOP00000011474
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 81,742,024 - 81,752,712 (-) Ensembl Rnor_6.0 Ensembl 10 84,628,424 - 84,639,105 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000081348 ⟹ ENSRNOP00000070897
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 81,742,024 - 81,751,743 (-) Ensembl Rnor_6.0 Ensembl 10 84,628,424 - 84,639,105 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000089146 ⟹ ENSRNOP00000070277
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 81,747,792 - 81,752,697 (-) Ensembl Rnor_6.0 Ensembl 10 84,629,744 - 84,639,111 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000096544 ⟹ ENSRNOP00000077201
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 81,742,024 - 81,749,624 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000114616 ⟹ ENSRNOP00000092915
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 81,742,024 - 81,750,948 (-) Ensembl
RefSeq Acc Id:
NM_001012012 ⟹ NP_001012012
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 82,238,475 - 82,249,166 (-) NCBI mRatBN7.2 10 81,742,020 - 81,752,712 (-) NCBI Rnor_6.0 10 84,628,420 - 84,639,105 (-) NCBI Rnor_5.0 10 84,421,491 - 84,432,034 (-) NCBI RGSC_v3.4 10 85,516,530 - 85,526,895 (-) RGD Celera 10 80,504,024 - 80,513,792 (-) RGD
Sequence:
CTCACCCGGAAGGAGAAGCCGGAATCTGCATCTGGCTATATGGTTCGGTGCTGGTGGTGTCGCTATAGAGAGCTGCTGCTGCTGCTCTCAGGAGCCAGCCGGGATCGTTTGTTGGCAGTACATATTGG
hide sequence
RefSeq Acc Id:
NM_001199169 ⟹ NP_001186098
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 82,238,475 - 82,249,166 (-) NCBI mRatBN7.2 10 81,742,020 - 81,752,712 (-) NCBI Rnor_6.0 10 84,628,420 - 84,639,105 (-) NCBI Rnor_5.0 10 84,421,491 - 84,432,034 (-) NCBI Celera 10 80,504,024 - 80,513,792 (-) NCBI
Sequence:
CTCACCCGGAAGGAGAAGCCGGAATCTGCATCTGGCTATATGGTTCGGTGCTGGTGGTGTCGCTATAGAGAGCTGCTGCTGCTGCTCTCAGATGTTCTCTTCCGATGGGCTTTTGGTGTAGGATGTTG
hide sequence
RefSeq Acc Id:
XM_006247196 ⟹ XP_006247258
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 82,238,805 - 82,249,226 (-) NCBI mRatBN7.2 10 81,742,020 - 81,752,775 (-) NCBI Rnor_6.0 10 84,628,420 - 84,639,125 (-) NCBI Rnor_5.0 10 84,421,491 - 84,432,034 (-) NCBI
Sequence:
GTGCACTGGGGCGCCGGCGACTCACCCGGAAGGAGAAGCCGGAATCTGCATCTGGCTATATGGT
hide sequence
RefSeq Acc Id:
XM_006247198 ⟹ XP_006247260
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 82,238,805 - 82,249,189 (-) NCBI mRatBN7.2 10 81,742,020 - 81,752,736 (-) NCBI Rnor_6.0 10 84,628,420 - 84,639,125 (-) NCBI Rnor_5.0 10 84,421,491 - 84,432,034 (-) NCBI
Sequence:
GTGCACTGGGGCGCCGGCGACTCACCCGGAAGGAGAAGCCGGAATCTGCATCTGGCTATATGGT
hide sequence
RefSeq Acc Id:
XM_039086077 ⟹ XP_038942005
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 82,241,997 - 82,249,264 (-) NCBI mRatBN7.2 10 81,745,539 - 81,752,778 (-) NCBI
RefSeq Acc Id:
XM_063269114 ⟹ XP_063125184
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 82,238,805 - 82,249,092 (-) NCBI
RefSeq Acc Id:
NP_001012012 ⟸ NM_001012012
- UniProtKB:
D4A3W4 (UniProtKB/TrEMBL), A6HIG1 (UniProtKB/TrEMBL), A0A8I5Y9D6 (UniProtKB/TrEMBL)
- Sequence:
MGFWCRMLENQELEEVITVRVQDPRLQNEGSWNSYVDYKIFLHTNSKAFTAKTSCVRRRYREFVWLRKQLQRNAGLVPVPELPGKSTFFGSSDEFIEKRRQGLQHFLEKVLQSVVLLSDSQLHLFLQS
hide sequence
RefSeq Acc Id:
NP_001186098 ⟸ NM_001199169
- UniProtKB:
D4A3W4 (UniProtKB/TrEMBL), A6HIG1 (UniProtKB/TrEMBL), A0A8I5Y9D6 (UniProtKB/TrEMBL)
- Sequence:
MGFWCRMLENQELEEVITVRVQDPRLQNEGSWNSYVDYKIFLHTNSKAFTAKTSCVRRRYREFV
hide sequence
RefSeq Acc Id:
XP_006247258 ⟸ XM_006247196
- Peptide Label:
isoform X1
- UniProtKB:
D4A3W4 (UniProtKB/TrEMBL), A6HIG1 (UniProtKB/TrEMBL), A0A8I5Y9D6 (UniProtKB/TrEMBL)
- Sequence:
MGFWCRMLENQELEEVITVRVQDPRLQNEGSWNSYVDYKIFLHTNSKAFTAKTSCVRRRYREFVWLRKQLQRNAGLVPVPELPGKSTFFGSSDEFIEKRRQGLQHFLEKVLQSVVLLSDSQLHLFLQS
hide sequence
RefSeq Acc Id:
XP_006247260 ⟸ XM_006247198
- Peptide Label:
isoform X1
- UniProtKB:
D4A3W4 (UniProtKB/TrEMBL), A6HIG1 (UniProtKB/TrEMBL), A0A8I5Y9D6 (UniProtKB/TrEMBL)
- Sequence:
MGFWCRMLENQELEEVITVRVQDPRLQNEGSWNSYVDYKIFLHTNSKAFTAKTSCVRRRYREFV
hide sequence
Ensembl Acc Id:
ENSRNOP00000070277 ⟸ ENSRNOT00000089146
Ensembl Acc Id:
ENSRNOP00000011474 ⟸ ENSRNOT00000011474
Ensembl Acc Id:
ENSRNOP00000070897 ⟸ ENSRNOT00000081348
RefSeq Acc Id:
XP_038942005 ⟸ XM_039086077
- Peptide Label:
isoform X2
- UniProtKB:
Q5RJQ6 (UniProtKB/TrEMBL), A0A0G2JXH9 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000092915 ⟸ ENSRNOT00000114616
Ensembl Acc Id:
ENSRNOP00000077201 ⟸ ENSRNOT00000096544
RefSeq Acc Id:
XP_063125184 ⟸ XM_063269114
- Peptide Label:
isoform X1
- UniProtKB:
A6HIG1 (UniProtKB/TrEMBL), D4A3W4 (UniProtKB/TrEMBL), A0A8I5Y9D6 (UniProtKB/TrEMBL)
RGD ID: 13697633 Promoter ID: EPDNEW_R8158 Type: initiation region Name: Snx11_1 Description: sorting nexin 11 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 84,639,076 - 84,639,136 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2005-12-06
Snx11
sorting nexin 11
Snx11_predicted
sorting nexin 11 (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Snx11_predicted
sorting nexin 11 (predicted)
Symbol and Name status set to approved
70820 APPROVED
