Symbol:
Nfkb2
Name:
nuclear factor kappa B subunit 2
RGD ID:
1307189
Description:
Predicted to enable DNA-binding transcription activator activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Involved in response to cytokine and response to lipopolysaccharide. Predicted to be located in cytosol and nucleoplasm. Predicted to be part of Bcl3/NF-kappaB2 complex. Used to study Parkinsonism. Human ortholog(s) of this gene implicated in common variable immunodeficiency 10. Orthologous to human NFKB2 (nuclear factor kappa B subunit 2); PARTICIPATES IN adenosine signaling pathway; interleukin-12 signaling pathway; nuclear factor kappa B signaling pathway; INTERACTS WITH (+)-schisandrin B; 1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile; 1-naphthyl isothiocyanate.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC309452; MGC93816; nuclear factor NF-kappa-B p100 subunit; nuclear factor of kappa light polypeptide gene enhancer in B-cells 2; nuclear factor of kappa light polypeptide gene enhancer in B-cells 2, p49/p100; RGD1307189; similar to nuclear factor kappa B subunit p100
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
NFKB2 (nuclear factor kappa B subunit 2) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Nfkb2 (nuclear factor of kappa light polypeptide gene enhancer in B cells 2, p49/p100) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Nfkb2 (nuclear factor kappa B subunit 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
NFKB2 (nuclear factor kappa B subunit 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
NFKB2 (nuclear factor kappa B subunit 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Nfkb2 (nuclear factor kappa B subunit 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
NFKB2 (nuclear factor kappa B subunit 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
NFKB2 (nuclear factor kappa B subunit 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Nfkb2 (nuclear factor kappa B subunit 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
SEPTIN8 (septin 8) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
NFKB2 (nuclear factor kappa B subunit 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Nfkb2 (nuclear factor of kappa light polypeptide gene enhancer in B cells 2, p49/p100)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
nfkb2 (nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Rel
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
nfkb2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 255,106,010 - 255,114,649 (+) NCBI GRCr8 mRatBN7.2 1 245,164,586 - 245,173,225 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 245,165,950 - 245,173,213 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 253,288,361 - 253,294,615 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 259,983,048 - 259,989,300 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 252,634,805 - 252,641,057 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 266,050,634 - 266,059,277 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 266,053,002 - 266,059,256 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 273,481,574 - 273,490,218 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 251,521,559 - 251,527,815 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 251,784,632 - 251,790,888 (+) NCBI Celera 1 240,949,824 - 240,956,078 (+) NCBI Celera Cytogenetic Map 1 q54 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Nfkb2 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of NFKB2 mRNA] CTD PMID:31150632 Nfkb2 Rat (1->4)-beta-D-glucan multiple interactions ISO Nfkb2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of NFKB2 mRNA CTD PMID:36331819 Nfkb2 Rat (S)-nicotine multiple interactions ISO NFKB2 (Homo sapiens) 6480464 [Aerosols co-treated with Nicotine] results in increased expression of NFKB2 mRNA CTD PMID:33469865 Nfkb2 Rat 1,2-dimethylhydrazine multiple interactions ISO Nfkb2 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of NFKB2 mRNA] CTD PMID:22206623 Nfkb2 Rat 1,2-dimethylhydrazine increases expression ISO Nfkb2 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of NFKB2 mRNA CTD PMID:22206623 Nfkb2 Rat 1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile increases expression EXP 6480464 Citalopram results in increased expression of NFKB2 mRNA CTD PMID:28467792 Nfkb2 Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of NFKB2 mRNA CTD PMID:30723492 Nfkb2 Rat 17alpha-ethynylestradiol affects expression ISO Nfkb2 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of NFKB2 mRNA CTD PMID:17555576 Nfkb2 Rat 17beta-estradiol increases expression ISO NFKB2 (Homo sapiens) 6480464 Estradiol results in increased expression of NFKB2 mRNA CTD PMID:20106945 and PMID:31614463 Nfkb2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Nfkb2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of NFKB2 mRNA CTD PMID:21570461 more ... Nfkb2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of NFKB2 mRNA CTD PMID:33387578 Nfkb2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of NFKB2 mRNA CTD PMID:22298810 Nfkb2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Nfkb2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin promotes the reaction [[Lipopolysaccharides binds to and results in increased activity of TLR4 protein] which results in increased activity of NFKB2 protein] and Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to NFKB2 promoter] CTD PMID:19654925 and PMID:21097750 Nfkb2 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of NFKB2 mRNA CTD PMID:21346803 Nfkb2 Rat 3,5-diethoxycarbonyl-1,4-dihydrocollidine increases expression ISO Nfkb2 (Mus musculus) 6480464 3 more ... CTD PMID:37544346 Nfkb2 Rat 3,5-diethoxycarbonyl-1,4-dihydrocollidine multiple interactions ISO Nfkb2 (Mus musculus) 6480464 fuzheng huayu inhibits the reaction [3 more ... CTD PMID:37544346 Nfkb2 Rat 4,4'-sulfonyldiphenol affects methylation ISO Nfkb2 (Mus musculus) 6480464 bisphenol S affects the methylation of NFKB2 gene CTD PMID:31683443 Nfkb2 Rat 4-hydroxyphenyl retinamide increases expression ISO Nfkb2 (Mus musculus) 6480464 Fenretinide results in increased expression of NFKB2 mRNA CTD PMID:28973697 Nfkb2 Rat 5-aza-2'-deoxycytidine increases expression ISO Nfkb2 (Mus musculus) 6480464 Decitabine results in increased expression of NFKB2 mRNA CTD PMID:27915011 Nfkb2 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of NFKB2 mRNA CTD PMID:30047161 Nfkb2 Rat 9-cis,11-trans-octadecadienoic acid affects activity ISO Nfkb2 (Mus musculus) 6480464 cis-9 and trans-11-conjugated linoleic acid affects the activity of NFKB2 protein CTD PMID:17327424 Nfkb2 Rat acetaldehyde multiple interactions ISO NFKB2 (Homo sapiens) 6480464 Acetaldehyde results in increased activity of [NFKBIA protein binds to NFKB2 protein] CTD PMID:10799556 Nfkb2 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of NFKB2 mRNA CTD PMID:31881176 Nfkb2 Rat acrylamide increases expression ISO Nfkb2 (Mus musculus) 6480464 Acrylamide results in increased expression of NFKB2 mRNA CTD PMID:38152866 Nfkb2 Rat aflatoxin B1 increases expression ISO Nfkb2 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of NFKB2 mRNA CTD PMID:28789997 Nfkb2 Rat all-trans-retinoic acid increases expression ISO NFKB2 (Homo sapiens) 6480464 Tretinoin results in increased expression of NFKB2 mRNA CTD PMID:33167477 Nfkb2 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of NFKB2 mRNA CTD PMID:30047161 Nfkb2 Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of NFKB2 mRNA CTD PMID:30779732 Nfkb2 Rat anthracene multiple interactions ISO NFKB2 (Homo sapiens) 6480464 [naphthalene co-treated with phenanthrene co-treated with anthracene co-treated with fluoranthene co-treated with pyrene] results in increased expression of NFKB2 protein CTD PMID:30980910 Nfkb2 Rat antimonite multiple interactions ISO NFKB2 (Homo sapiens) 6480464 [Antimony Potassium Tartrate results in increased abundance of antimonite] which results in increased expression of NFKB2 mRNA CTD PMID:32076005 Nfkb2 Rat antirheumatic drug decreases expression ISO NFKB2 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of NFKB2 mRNA CTD PMID:24449571 Nfkb2 Rat apigenin multiple interactions EXP 6480464 Apigenin inhibits the reaction [Lipopolysaccharides results in increased expression of NFKB2 protein] CTD PMID:25557508 Nfkb2 Rat aripiprazole multiple interactions ISO NFKB2 (Homo sapiens) 6480464 Aripiprazole promotes the reaction [Ozone results in increased expression of NFKB2 mRNA] CTD PMID:31476115 Nfkb2 Rat aristolochic acid A increases expression ISO NFKB2 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of NFKB2 mRNA CTD PMID:33212167 Nfkb2 Rat arsane multiple interactions ISO NFKB2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of NFKB2 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of NFKB2 mRNA CTD PMID:39836092 Nfkb2 Rat arsenic atom multiple interactions ISO NFKB2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of NFKB2 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of NFKB2 mRNA CTD PMID:39836092 Nfkb2 Rat arsenite(3-) increases expression ISO Nfkb2 (Mus musculus) 6480464 arsenite results in increased expression of NFKB2 protein CTD PMID:37955338 Nfkb2 Rat arsenous acid increases expression ISO NFKB2 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of NFKB2 mRNA CTD PMID:29633893 Nfkb2 Rat arsenous acid multiple interactions ISO NFKB2 (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [Homoharringtonine results in increased expression of NFKB2 protein] CTD PMID:31307525 Nfkb2 Rat arsenous acid decreases expression ISO NFKB2 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of NFKB2 protein CTD PMID:18349030 and PMID:33634982 Nfkb2 Rat asbestos increases expression ISO NFKB2 (Homo sapiens) 6480464 Asbestos results in increased expression of NFKB2 mRNA CTD PMID:22398240 Nfkb2 Rat benzo[a]pyrene decreases expression ISO Nfkb2 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of NFKB2 mRNA CTD PMID:19770486 Nfkb2 Rat benzo[a]pyrene increases expression ISO NFKB2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of NFKB2 mRNA CTD PMID:32234424 Nfkb2 Rat benzo[a]pyrene affects methylation ISO NFKB2 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of NFKB2 intron CTD PMID:30157460 Nfkb2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of NFKB2 mRNA CTD PMID:25181051 Nfkb2 Rat bisphenol A increases expression ISO Nfkb2 (Mus musculus) 6480464 bisphenol A results in increased expression of NFKB2 mRNA CTD PMID:33221593 Nfkb2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of NFKB2 mRNA CTD PMID:30816183 more ... Nfkb2 Rat bisphenol A decreases expression ISO NFKB2 (Homo sapiens) 6480464 bisphenol A results in decreased expression of NFKB2 mRNA CTD PMID:29275510 Nfkb2 Rat bisphenol A affects methylation ISO Nfkb2 (Mus musculus) 6480464 bisphenol A affects the methylation of NFKB2 promoter CTD PMID:27334623 Nfkb2 Rat bortezomib decreases cleavage ISO NFKB2 (Homo sapiens) 6480464 Bortezomib results in decreased cleavage of NFKB2 protein CTD PMID:18223231 Nfkb2 Rat bortezomib decreases expression ISO NFKB2 (Homo sapiens) 6480464 Bortezomib results in decreased expression of NFKB2 mRNA and Bortezomib results in decreased expression of NFKB2 protein CTD PMID:17626072 and PMID:25913414 Nfkb2 Rat butanal increases expression ISO NFKB2 (Homo sapiens) 6480464 butyraldehyde results in increased expression of NFKB2 mRNA CTD PMID:26079696 Nfkb2 Rat cadmium atom multiple interactions ISO NFKB2 (Homo sapiens) 6480464 [Cadmium analog co-treated with Selenium analog co-treated with zinc sulfide analog] results in decreased expression of NFKB2 mRNA CTD PMID:21481475 Nfkb2 Rat cadmium selenide multiple interactions ISO NFKB2 (Homo sapiens) 6480464 [cadmium selenide co-treated with zinc sulfide] results in increased expression of NFKB2 mRNA CTD PMID:22342292 Nfkb2 Rat caffeine decreases phosphorylation ISO NFKB2 (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of NFKB2 protein CTD PMID:35688186 Nfkb2 Rat calciol multiple interactions EXP 6480464 Cholecalciferol inhibits the reaction [lead acetate results in increased expression of NFKB2 mRNA] CTD PMID:34051273 Nfkb2 Rat cannabidiol multiple interactions ISO NFKB2 (Homo sapiens) 6480464 [Oxygen co-treated with Ozone co-treated with Cannabidiol] results in decreased expression of NFKB2 mRNA CTD PMID:32992648 Nfkb2 Rat cannabidiol decreases expression ISO NFKB2 (Homo sapiens) 6480464 Cannabidiol results in decreased expression of NFKB2 mRNA CTD PMID:27932991 Nfkb2 Rat carbon nanotube decreases expression ISO NFKB2 (Homo sapiens) 6480464 Nanotubes more ... CTD PMID:23634900 Nfkb2 Rat carbon nanotube increases expression ISO Nfkb2 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Nfkb2 Rat casticin decreases expression ISO NFKB2 (Homo sapiens) 6480464 casticin results in decreased expression of NFKB2 mRNA CTD PMID:27862857 Nfkb2 Rat cerium trichloride increases expression ISO Nfkb2 (Mus musculus) 6480464 cerous chloride results in increased expression of NFKB2 mRNA and cerous chloride results in increased expression of NFKB2 protein CTD PMID:21656643 Nfkb2 Rat cisplatin increases expression ISO NFKB2 (Homo sapiens) 6480464 Cisplatin results in increased expression of NFKB2 mRNA CTD PMID:27594783 Nfkb2 Rat cisplatin multiple interactions ISO NFKB2 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of NFKB2 mRNA CTD PMID:27392435 Nfkb2 Rat cisplatin increases expression ISO Nfkb2 (Mus musculus) 6480464 Cisplatin results in increased expression of NFKB2 mRNA CTD PMID:26546572 Nfkb2 Rat citalopram increases expression EXP 6480464 Citalopram results in increased expression of NFKB2 mRNA CTD PMID:28467792 Nfkb2 Rat cocaine affects expression EXP 6480464 Cocaine affects the expression of NFKB2 mRNA CTD PMID:20187946 Nfkb2 Rat copper atom multiple interactions ISO NFKB2 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which affects the expression of NFKB2 mRNA CTD PMID:30911355 Nfkb2 Rat copper(0) multiple interactions ISO NFKB2 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which affects the expression of NFKB2 mRNA CTD PMID:30911355 Nfkb2 Rat copper(II) chloride increases expression ISO NFKB2 (Homo sapiens) 6480464 cupric chloride results in increased expression of NFKB2 mRNA CTD PMID:38568856 Nfkb2 Rat crocidolite asbestos decreases expression ISO NFKB2 (Homo sapiens) 6480464 Asbestos and Crocidolite results in decreased expression of NFKB2 protein CTD PMID:23634900 Nfkb2 Rat crocidolite asbestos affects expression ISO NFKB2 (Homo sapiens) 6480464 Asbestos and Crocidolite affects the expression of NFKB2 mRNA CTD PMID:24160326 Nfkb2 Rat crocidolite asbestos increases expression ISO NFKB2 (Homo sapiens) 6480464 Asbestos and Crocidolite results in increased expression of NFKB2 mRNA CTD PMID:25757056 Nfkb2 Rat CU-O LINKAGE increases expression ISO NFKB2 (Homo sapiens) 6480464 cupric oxide results in increased expression of NFKB2 mRNA CTD PMID:32285662 Nfkb2 Rat curcumin decreases activity ISO NFKB2 (Homo sapiens) 6480464 Curcumin results in decreased activity of NFKB2 protein CTD PMID:16173963 Nfkb2 Rat cyclosporin A increases expression ISO Nfkb2 (Mus musculus) 6480464 Cyclosporine results in increased expression of NFKB2 mRNA CTD PMID:23958496 Nfkb2 Rat cyclosporin A increases expression ISO NFKB2 (Homo sapiens) 6480464 Cyclosporine results in increased expression of NFKB2 mRNA CTD PMID:20106945 and PMID:25562108 Nfkb2 Rat cylindrospermopsin increases expression ISO NFKB2 (Homo sapiens) 6480464 cylindrospermopsin results in increased expression of NFKB2 mRNA CTD PMID:24921660 Nfkb2 Rat DDE decreases expression ISO NFKB2 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of NFKB2 mRNA CTD PMID:38568856 Nfkb2 Rat Deoxycorticosterone acetate increases expression EXP 6480464 Desoxycorticosterone Acetate results in increased expression of NFKB2 protein CTD PMID:23089228 Nfkb2 Rat Deoxycorticosterone acetate multiple interactions EXP 6480464 heme arginate inhibits the reaction [Desoxycorticosterone Acetate results in increased expression of NFKB2 protein] CTD PMID:23089228 Nfkb2 Rat deoxynivalenol increases expression ISO NFKB2 (Homo sapiens) 6480464 deoxynivalenol results in increased expression of NFKB2 mRNA CTD PMID:22846391 Nfkb2 Rat deoxynivalenol multiple interactions ISO NFKB2 (Homo sapiens) 6480464 deoxynivalenol inhibits the reaction [NFKB2 protein binds to CXCL8 promoter] CTD PMID:17636245 Nfkb2 Rat dexamethasone increases expression ISO NFKB2 (Homo sapiens) 6480464 Dexamethasone results in increased expression of NFKB2 mRNA CTD PMID:19022236 Nfkb2 Rat diarsenic trioxide increases expression ISO NFKB2 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of NFKB2 mRNA CTD PMID:29633893 Nfkb2 Rat diarsenic trioxide multiple interactions ISO NFKB2 (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [Homoharringtonine results in increased expression of NFKB2 protein] CTD PMID:31307525 Nfkb2 Rat diarsenic trioxide decreases expression ISO NFKB2 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of NFKB2 protein CTD PMID:18349030 and PMID:33634982 Nfkb2 Rat diazinon increases methylation ISO NFKB2 (Homo sapiens) 6480464 Diazinon results in increased methylation of NFKB2 gene CTD PMID:22964155 Nfkb2 Rat Dibutyl phosphate affects expression ISO NFKB2 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of NFKB2 mRNA CTD PMID:37042841 Nfkb2 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of NFKB2 mRNA CTD PMID:21266533 Nfkb2 Rat dibutyl phthalate increases expression ISO Nfkb2 (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of NFKB2 mRNA CTD PMID:17361019 and PMID:21266533 Nfkb2 Rat dimethyl sulfoxide multiple interactions ISO NFKB2 (Homo sapiens) 6480464 Dimethyl Sulfoxide inhibits the reaction [IL1B protein results in increased expression of NFKB2 mRNA] CTD PMID:21878375 Nfkb2 Rat dioxygen multiple interactions ISO NFKB2 (Homo sapiens) 6480464 [Oxygen co-treated with Ozone co-treated with Cannabidiol] results in decreased expression of NFKB2 mRNA and [Oxygen co-treated with Ozone] results in decreased expression of NFKB2 mRNA CTD PMID:32992648 Nfkb2 Rat dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate multiple interactions ISO NFKB2 (Homo sapiens) 6480464 [Antimony Potassium Tartrate results in increased abundance of antimonite] which results in increased expression of NFKB2 mRNA CTD PMID:32076005 Nfkb2 Rat doxorubicin affects response to substance ISO NFKB2 (Homo sapiens) 6480464 NFKB2 protein affects the susceptibility to Doxorubicin CTD PMID:17890907 Nfkb2 Rat elemental selenium multiple interactions ISO NFKB2 (Homo sapiens) 6480464 [Cadmium analog co-treated with Selenium analog co-treated with zinc sulfide analog] results in decreased expression of NFKB2 mRNA CTD PMID:21481475 Nfkb2 Rat ellagic acid decreases expression ISO NFKB2 (Homo sapiens) 6480464 Ellagic Acid results in decreased expression of NFKB2 mRNA CTD PMID:12002526 and PMID:35179410 Nfkb2 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of NFKB2 mRNA CTD PMID:29391264 Nfkb2 Rat ethanol multiple interactions ISO NFKB2 (Homo sapiens) 6480464 Ethanol results in increased activity of [NFKB2 protein binds to NFKB1 protein] CTD PMID:10573527 Nfkb2 Rat ethanol increases expression ISO Nfkb2 (Mus musculus) 6480464 Ethanol results in increased expression of NFKB2 mRNA CTD PMID:30319688 Nfkb2 Rat famotidine multiple interactions ISO Nfkb2 (Mus musculus) 6480464 Famotidine inhibits the reaction [Indomethacin results in increased expression of NFKB2 mRNA] CTD PMID:38447874 Nfkb2 Rat fenamidone increases expression ISO Nfkb2 (Mus musculus) 6480464 fenamidone results in increased expression of NFKB2 mRNA CTD PMID:27029645 Nfkb2 Rat flumequine multiple interactions ISO Nfkb2 (Mus musculus) 6480464 [flumequine co-treated with 2-amino-3 more ... CTD PMID:23681119 Nfkb2 Rat fluoranthene multiple interactions ISO Nfkb2 (Mus musculus) 6480464 [1-methylanthracene co-treated with fluoranthene] results in increased expression of NFKB2 mRNA CTD PMID:28329830 Nfkb2 Rat fluoranthene multiple interactions ISO NFKB2 (Homo sapiens) 6480464 [naphthalene co-treated with phenanthrene co-treated with anthracene co-treated with fluoranthene co-treated with pyrene] results in increased expression of NFKB2 protein CTD PMID:30980910 Nfkb2 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of NFKB2 mRNA CTD PMID:24793618 Nfkb2 Rat folic acid multiple interactions ISO NFKB2 (Homo sapiens) 6480464 [Folic Acid deficiency co-treated with Methotrexate] results in increased expression of NFKB2 mRNA CTD PMID:24657277 Nfkb2 Rat folic acid multiple interactions ISO Nfkb2 (Mus musculus) 6480464 [Folic Acid co-treated with Sodium Bicarbonate] results in increased expression of NFKB2 mRNA more ... CTD PMID:22206623 and PMID:25559736 Nfkb2 Rat FR900359 increases phosphorylation ISO NFKB2 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of NFKB2 protein CTD PMID:37730182 Nfkb2 Rat gemcitabine affects expression ISO NFKB2 (Homo sapiens) 6480464 Gemcitabine affects the expression of NFKB2 mRNA CTD PMID:17039268 Nfkb2 Rat genistein multiple interactions ISO NFKB2 (Homo sapiens) 6480464 ESR2 promotes the reaction [Genistein results in decreased expression of NFKB2 protein] CTD PMID:20884965 Nfkb2 Rat genistein decreases expression ISO NFKB2 (Homo sapiens) 6480464 Genistein results in decreased expression of NFKB2 protein CTD PMID:20884965 Nfkb2 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of NFKB2 mRNA CTD PMID:33387578 Nfkb2 Rat glyphosate increases expression ISO NFKB2 (Homo sapiens) 6480464 Glyphosate results in increased expression of NFKB2 mRNA CTD PMID:31295307 Nfkb2 Rat hydroquinone decreases expression ISO NFKB2 (Homo sapiens) 6480464 hydroquinone results in decreased expression of NFKB2 mRNA CTD PMID:30090394 Nfkb2 Rat indometacin increases expression ISO Nfkb2 (Mus musculus) 6480464 Indomethacin results in increased expression of NFKB2 mRNA CTD PMID:38447874 Nfkb2 Rat indometacin multiple interactions ISO Nfkb2 (Mus musculus) 6480464 Famotidine inhibits the reaction [Indomethacin results in increased expression of NFKB2 mRNA] more ... CTD PMID:38447874 Nfkb2 Rat ivermectin decreases expression ISO NFKB2 (Homo sapiens) 6480464 Ivermectin results in decreased expression of NFKB2 protein CTD PMID:32959892 Nfkb2 Rat lead diacetate decreases expression ISO Nfkb2 (Mus musculus) 6480464 lead acetate results in decreased expression of NFKB2 mRNA CTD PMID:24260418 Nfkb2 Rat lead diacetate increases expression EXP 6480464 lead acetate results in increased expression of NFKB2 mRNA CTD PMID:34051273 Nfkb2 Rat lead diacetate multiple interactions EXP 6480464 Cholecalciferol inhibits the reaction [lead acetate results in increased expression of NFKB2 mRNA] CTD PMID:34051273 Nfkb2 Rat lipopolysaccharide multiple interactions ISO NFKB2 (Homo sapiens) 6480464 [Lipopolysaccharides co-treated with IL1B protein co-treated with TNF protein co-treated with IFNG protein] results in increased expression of NFKB2 mRNA more ... CTD PMID:21878375 more ... Nfkb2 Rat lipopolysaccharide increases expression EXP 6480464 Lipopolysaccharides results in increased expression of NFKB2 protein CTD PMID:25557508 Nfkb2 Rat lipopolysaccharide multiple interactions EXP 6480464 Apigenin inhibits the reaction [Lipopolysaccharides results in increased expression of NFKB2 protein] CTD PMID:25557508 Nfkb2 Rat lipopolysaccharide increases expression ISO Nfkb2 (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of NFKB2 mRNA CTD PMID:20423518 more ... Nfkb2 Rat lipopolysaccharide multiple interactions ISO Nfkb2 (Mus musculus) 6480464 [Eicosapentaenoic Acid co-treated with procyanidin B3] inhibits the reaction [Lipopolysaccharides results in increased expression of NFKB2 mRNA] more ... CTD PMID:20423518 more ... Nfkb2 Rat lipopolysaccharide increases expression ISO NFKB2 (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of NFKB2 mRNA CTD PMID:22241084 and PMID:35811015 Nfkb2 Rat manganese atom multiple interactions ISO NFKB2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of NFKB2 mRNA CTD PMID:39836092 Nfkb2 Rat manganese(0) multiple interactions ISO NFKB2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of NFKB2 mRNA CTD PMID:39836092 Nfkb2 Rat manganese(II) chloride multiple interactions ISO NFKB2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of NFKB2 mRNA CTD PMID:39836092 Nfkb2 Rat MeIQx multiple interactions ISO Nfkb2 (Mus musculus) 6480464 [flumequine co-treated with 2-amino-3 more ... CTD PMID:23681119 Nfkb2 Rat metformin multiple interactions ISO NFKB2 (Homo sapiens) 6480464 [Paclitaxel co-treated with Metformin] results in decreased expression of NFKB2 mRNA CTD PMID:29309887 Nfkb2 Rat methapyrilene increases expression EXP 6480464 Methapyrilene results in increased expression of NFKB2 mRNA CTD PMID:25242409 Nfkb2 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of NFKB2 mRNA CTD PMID:30047161 Nfkb2 Rat methotrexate affects response to substance ISO NFKB2 (Homo sapiens) 6480464 NFKB2 protein affects the susceptibility to Methotrexate CTD PMID:16217747 Nfkb2 Rat methotrexate increases expression ISO NFKB2 (Homo sapiens) 6480464 Methotrexate results in increased expression of NFKB2 mRNA CTD PMID:21678067 and PMID:24657277 Nfkb2 Rat methotrexate multiple interactions ISO NFKB2 (Homo sapiens) 6480464 [Folic Acid deficiency co-treated with Methotrexate] results in increased expression of NFKB2 mRNA CTD PMID:24657277 Nfkb2 Rat methoxychlor affects expression ISO Nfkb2 (Mus musculus) 6480464 Methoxychlor affects the expression of NFKB2 mRNA CTD PMID:20829426 Nfkb2 Rat Methylazoxymethanol acetate increases expression EXP 6480464 Methylazoxymethanol Acetate results in increased expression of NFKB2 mRNA CTD PMID:28349193 Nfkb2 Rat mono(2-ethylhexyl) phthalate increases expression EXP 6480464 mono-(2-ethylhexyl)phthalate results in increased expression of NFKB2 mRNA CTD PMID:16809437 Nfkb2 Rat Muraglitazar decreases expression EXP 6480464 muraglitazar results in decreased expression of NFKB2 mRNA CTD PMID:21515302 Nfkb2 Rat N-acetyl-L-cysteine multiple interactions ISO Nfkb2 (Mus musculus) 6480464 Acetylcysteine inhibits the reaction [Drugs more ... CTD PMID:19642688 Nfkb2 Rat N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of NFKB2 mRNA CTD PMID:25242409 Nfkb2 Rat naphthalene multiple interactions ISO NFKB2 (Homo sapiens) 6480464 [naphthalene co-treated with phenanthrene co-treated with anthracene co-treated with fluoranthene co-treated with pyrene] results in increased expression of NFKB2 protein CTD PMID:30980910 Nfkb2 Rat nickel atom increases expression ISO NFKB2 (Homo sapiens) 6480464 Nickel results in increased expression of NFKB2 mRNA CTD PMID:24768652 and PMID:25583101 Nfkb2 Rat nickel dichloride increases expression ISO NFKB2 (Homo sapiens) 6480464 nickel chloride results in increased expression of NFKB2 mRNA CTD PMID:17312168 Nfkb2 Rat nickel subsulfide affects expression EXP 6480464 nickel subsulfide affects the expression of NFKB2 mRNA CTD PMID:24952340 Nfkb2 Rat niclosamide increases expression ISO NFKB2 (Homo sapiens) 6480464 Niclosamide results in increased expression of NFKB2 mRNA CTD PMID:36318118 Nfkb2 Rat nicotine multiple interactions ISO NFKB2 (Homo sapiens) 6480464 [Aerosols co-treated with Nicotine] results in increased expression of NFKB2 mRNA CTD PMID:33469865 Nfkb2 Rat nitrates multiple interactions ISO Nfkb2 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of NFKB2 mRNA CTD PMID:35964746 Nfkb2 Rat NMS-873 decreases metabolic processing ISO NFKB2 (Homo sapiens) 6480464 NMS-873 results in decreased metabolism of NFKB2 protein CTD PMID:28190248 Nfkb2 Rat o-anisidine affects expression ISO NFKB2 (Homo sapiens) 6480464 2-anisidine affects the expression of NFKB2 mRNA CTD PMID:28089782 Nfkb2 Rat obeticholic acid decreases expression ISO NFKB2 (Homo sapiens) 6480464 obeticholic acid results in decreased expression of NFKB2 mRNA CTD PMID:27939613 Nfkb2 Rat omacetaxine mepesuccinate increases expression ISO NFKB2 (Homo sapiens) 6480464 Homoharringtonine results in increased expression of NFKB2 protein CTD PMID:31307525 Nfkb2 Rat omacetaxine mepesuccinate multiple interactions ISO NFKB2 (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [Homoharringtonine results in increased expression of NFKB2 protein] CTD PMID:31307525 Nfkb2 Rat ozone multiple interactions ISO NFKB2 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of NFKB2 mRNA more ... CTD PMID:31476115 more ... Nfkb2 Rat ozone affects expression EXP 6480464 Ozone affects the expression of NFKB2 mRNA CTD PMID:35112007 Nfkb2 Rat ozone increases expression ISO NFKB2 (Homo sapiens) 6480464 Ozone results in increased expression of NFKB2 mRNA CTD PMID:31476115 Nfkb2 Rat paclitaxel multiple interactions ISO NFKB2 (Homo sapiens) 6480464 [Paclitaxel co-treated with Metformin] results in decreased expression of NFKB2 mRNA CTD PMID:29309887 Nfkb2 Rat paracetamol affects expression ISO Nfkb2 (Mus musculus) 6480464 Acetaminophen affects the expression of NFKB2 mRNA CTD PMID:17562736 Nfkb2 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of NFKB2 mRNA CTD PMID:33387578 Nfkb2 Rat paracetamol increases expression ISO NFKB2 (Homo sapiens) 6480464 Acetaminophen results in increased expression of NFKB2 mRNA CTD PMID:29067470 Nfkb2 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of NFKB2 mRNA CTD PMID:32680482 Nfkb2 Rat pentanal increases expression ISO NFKB2 (Homo sapiens) 6480464 pentanal results in increased expression of NFKB2 mRNA CTD PMID:26079696 Nfkb2 Rat perfluorohexanesulfonic acid increases expression ISO Nfkb2 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of NFKB2 mRNA CTD PMID:37995155 Nfkb2 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Nfkb2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of NFKB2 mRNA CTD PMID:36331819 Nfkb2 Rat phenanthrene multiple interactions ISO NFKB2 (Homo sapiens) 6480464 [naphthalene co-treated with phenanthrene co-treated with anthracene co-treated with fluoranthene co-treated with pyrene] results in increased expression of NFKB2 protein CTD PMID:30980910 Nfkb2 Rat phenethyl caffeate multiple interactions ISO NFKB2 (Homo sapiens) 6480464 caffeic acid phenethyl ester inhibits the reaction [sodium arsenite results in increased expression of NFKB2 protein] CTD PMID:20420878 Nfkb2 Rat phenethyl isothiocyanate multiple interactions ISO Nfkb2 (Mus musculus) 6480464 phenethyl isothiocyanate inhibits the reaction [Lipopolysaccharides results in increased expression of NFKB2 mRNA] CTD PMID:20423518 Nfkb2 Rat phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of NFKB2 mRNA CTD PMID:22037397 Nfkb2 Rat pirinixic acid decreases expression ISO Nfkb2 (Mus musculus) 6480464 pirinixic acid results in decreased expression of NFKB2 mRNA CTD PMID:17426115 and PMID:18249437 Nfkb2 Rat procyanidin B3 multiple interactions ISO Nfkb2 (Mus musculus) 6480464 [Eicosapentaenoic Acid co-treated with procyanidin B3] inhibits the reaction [Lipopolysaccharides results in increased expression of NFKB2 mRNA] CTD PMID:22169119 Nfkb2 Rat progesterone increases expression ISO Nfkb2 (Mus musculus) 6480464 Progesterone results in increased expression of NFKB2 mRNA CTD PMID:21549006 Nfkb2 Rat pyrene multiple interactions ISO NFKB2 (Homo sapiens) 6480464 [naphthalene co-treated with phenanthrene co-treated with anthracene co-treated with fluoranthene co-treated with pyrene] results in increased expression of NFKB2 protein CTD PMID:30980910 Nfkb2 Rat pyrrolidine dithiocarbamate multiple interactions ISO Nfkb2 (Mus musculus) 6480464 pyrrolidine dithiocarbamic acid inhibits the reaction [[Folic Acid co-treated with Sodium Bicarbonate] results in increased expression of NFKB2 mRNA] CTD PMID:25559736 Nfkb2 Rat quercetin increases expression ISO NFKB2 (Homo sapiens) 6480464 Quercetin results in increased expression of NFKB2 mRNA CTD PMID:21632981 Nfkb2 Rat quercetin multiple interactions ISO Nfkb2 (Mus musculus) 6480464 Quercetin analog inhibits the reaction [Indomethacin results in increased expression of NFKB2 mRNA] and Quercetin inhibits the reaction [Indomethacin results in increased expression of NFKB2 mRNA] CTD PMID:38447874 Nfkb2 Rat resveratrol multiple interactions ISO NFKB2 (Homo sapiens) 6480464 [resveratrol co-treated with beta-1 and 3-glucan] results in increased expression of NFKB2 mRNA CTD PMID:17690738 Nfkb2 Rat resveratrol decreases expression ISO NFKB2 (Homo sapiens) 6480464 resveratrol results in decreased expression of NFKB2 mRNA CTD PMID:12002526 Nfkb2 Rat ruxolitinib multiple interactions ISO NFKB2 (Homo sapiens) 6480464 ruxolitinib inhibits the reaction [TNF protein affects the localization of NFKB2 protein] CTD PMID:22941906 Nfkb2 Rat S-(1,2-dichlorovinyl)-L-cysteine increases expression ISO NFKB2 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine results in increased expression of NFKB2 mRNA CTD PMID:33725128 Nfkb2 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO NFKB2 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Nfkb2 Rat selenium atom multiple interactions ISO NFKB2 (Homo sapiens) 6480464 [Cadmium analog co-treated with Selenium analog co-treated with zinc sulfide analog] results in decreased expression of NFKB2 mRNA CTD PMID:21481475 Nfkb2 Rat serpentine asbestos affects expression ISO NFKB2 (Homo sapiens) 6480464 Asbestos and Serpentine affects the expression of NFKB2 mRNA CTD PMID:24160326 Nfkb2 Rat sertraline increases expression ISO NFKB2 (Homo sapiens) 6480464 Sertraline results in increased expression of NFKB2 mRNA CTD PMID:24865413 Nfkb2 Rat silicon dioxide increases expression ISO NFKB2 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of NFKB2 mRNA and Silicon Dioxide results in increased expression of NFKB2 mRNA CTD PMID:25351596 more ... Nfkb2 Rat silicon dioxide increases expression ISO Nfkb2 (Mus musculus) 6480464 Silicon Dioxide results in increased expression of NFKB2 mRNA CTD PMID:23221170 Nfkb2 Rat silver atom decreases expression ISO NFKB2 (Homo sapiens) 6480464 Silver results in decreased expression of NFKB2 mRNA CTD PMID:22342292 Nfkb2 Rat silver(0) decreases expression ISO NFKB2 (Homo sapiens) 6480464 Silver results in decreased expression of NFKB2 mRNA CTD PMID:22342292 Nfkb2 Rat SM-164 increases metabolic processing ISO NFKB2 (Homo sapiens) 6480464 SM 164 results in increased metabolism of NFKB2 protein CTD PMID:22241084 Nfkb2 Rat sodium arsenite multiple interactions ISO NFKB2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of NFKB2 mRNA more ... CTD PMID:20420878 and PMID:39836092 Nfkb2 Rat sodium arsenite increases expression ISO NFKB2 (Homo sapiens) 6480464 sodium arsenite results in increased expression of NFKB2 mRNA CTD PMID:12760830 more ... Nfkb2 Rat sodium arsenite affects localization ISO NFKB2 (Homo sapiens) 6480464 sodium arsenite affects the localization of NFKB2 protein CTD PMID:20420878 Nfkb2 Rat sodium hydrogencarbonate multiple interactions ISO Nfkb2 (Mus musculus) 6480464 [Folic Acid co-treated with Sodium Bicarbonate] results in increased expression of NFKB2 mRNA and pyrrolidine dithiocarbamic acid inhibits the reaction [[Folic Acid co-treated with Sodium Bicarbonate] results in increased expression of NFKB2 mRNA] CTD PMID:25559736 Nfkb2 Rat Soman increases expression EXP 6480464 Soman results in increased expression of NFKB2 mRNA CTD PMID:19281266 Nfkb2 Rat succimer multiple interactions ISO Nfkb2 (Mus musculus) 6480464 [Succimer binds to Magnetite Nanoparticles] which results in increased expression of NFKB2 mRNA CTD PMID:21641980 Nfkb2 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of NFKB2 mRNA CTD PMID:30047161 Nfkb2 Rat tacrolimus hydrate increases expression ISO Nfkb2 (Mus musculus) 6480464 Tacrolimus results in increased expression of NFKB2 mRNA CTD PMID:23958496 Nfkb2 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of NFKB2 mRNA] CTD PMID:31150632 Nfkb2 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of NFKB2 mRNA CTD PMID:31150632 Nfkb2 Rat thapsigargin increases expression ISO Nfkb2 (Mus musculus) 6480464 Thapsigargin results in increased expression of NFKB2 protein CTD PMID:24648495 Nfkb2 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of NFKB2 mRNA CTD PMID:34492290 Nfkb2 Rat thiram increases expression ISO NFKB2 (Homo sapiens) 6480464 Thiram results in increased expression of NFKB2 mRNA CTD PMID:38568856 Nfkb2 Rat titanium dioxide increases expression ISO NFKB2 (Homo sapiens) 6480464 titanium dioxide results in increased expression of NFKB2 mRNA CTD PMID:22342292 Nfkb2 Rat titanium dioxide decreases methylation ISO Nfkb2 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of NFKB2 gene and titanium dioxide results in decreased methylation of NFKB2 promoter CTD PMID:35295148 Nfkb2 Rat titanium dioxide increases expression ISO Nfkb2 (Mus musculus) 6480464 titanium dioxide results in increased expression of NFKB2 mRNA CTD PMID:23557971 Nfkb2 Rat tofacitinib multiple interactions ISO NFKB2 (Homo sapiens) 6480464 tofacitinib inhibits the reaction [TNF protein affects the localization of NFKB2 protein] CTD PMID:22941906 Nfkb2 Rat trichloroethene increases expression ISO Nfkb2 (Mus musculus) 6480464 Trichloroethylene results in increased expression of NFKB2 mRNA and Trichloroethylene results in increased expression of NFKB2 protein CTD PMID:18565563 and PMID:20709644 Nfkb2 Rat triphenyl phosphate affects expression ISO NFKB2 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of NFKB2 mRNA CTD PMID:37042841 Nfkb2 Rat triptonide affects expression ISO Nfkb2 (Mus musculus) 6480464 triptonide affects the expression of NFKB2 mRNA CTD PMID:33045310 Nfkb2 Rat troglitazone decreases expression EXP 6480464 troglitazone results in decreased expression of NFKB2 mRNA CTD PMID:21515302 Nfkb2 Rat valproic acid increases expression ISO NFKB2 (Homo sapiens) 6480464 Valproic Acid results in increased expression of NFKB2 protein CTD PMID:29501571 Nfkb2 Rat valproic acid decreases methylation ISO NFKB2 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of NFKB2 gene CTD PMID:29501571 Nfkb2 Rat zinc atom increases expression ISO NFKB2 (Homo sapiens) 6480464 Zinc deficiency results in increased expression of NFKB2 mRNA CTD PMID:22171008 Nfkb2 Rat zinc atom decreases expression ISO NFKB2 (Homo sapiens) 6480464 Zinc deficiency results in decreased expression of NFKB2 mRNA CTD PMID:18356318 Nfkb2 Rat zinc oxide multiple interactions ISO Nfkb2 (Mus musculus) 6480464 Zinc Oxide affects the splicing of and results in decreased expression of NFKB2 mRNA CTD PMID:30500950 Nfkb2 Rat zinc(0) increases expression ISO NFKB2 (Homo sapiens) 6480464 Zinc deficiency results in increased expression of NFKB2 mRNA CTD PMID:22171008 Nfkb2 Rat zinc(0) decreases expression ISO NFKB2 (Homo sapiens) 6480464 Zinc deficiency results in decreased expression of NFKB2 mRNA CTD PMID:18356318 Nfkb2 Rat zoledronic acid increases expression ISO NFKB2 (Homo sapiens) 6480464 zoledronic acid results in increased expression of NFKB2 mRNA CTD PMID:24714768
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(+)-schisandrin B (EXP) (1->4)-beta-D-glucan (ISO) (S)-nicotine (ISO) 1,2-dimethylhydrazine (ISO) 1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile (EXP) 1-naphthyl isothiocyanate (EXP) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 3,5-diethoxycarbonyl-1,4-dihydrocollidine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP) 9-cis,11-trans-octadecadienoic acid (ISO) acetaldehyde (ISO) acetamide (EXP) acrylamide (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) amitrole (EXP) amphetamine (EXP) anthracene (ISO) antimonite (ISO) antirheumatic drug (ISO) apigenin (EXP) aripiprazole (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) asbestos (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) bortezomib (ISO) butanal (ISO) cadmium atom (ISO) cadmium selenide (ISO) caffeine (ISO) calciol (EXP) cannabidiol (ISO) carbon nanotube (ISO) casticin (ISO) cerium trichloride (ISO) cisplatin (ISO) citalopram (EXP) cocaine (EXP) copper atom (ISO) copper(0) (ISO) copper(II) chloride (ISO) crocidolite asbestos (ISO) CU-O LINKAGE (ISO) curcumin (ISO) cyclosporin A (ISO) cylindrospermopsin (ISO) DDE (ISO) Deoxycorticosterone acetate (EXP) deoxynivalenol (ISO) dexamethasone (ISO) diarsenic trioxide (ISO) diazinon (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) dimethyl sulfoxide (ISO) dioxygen (ISO) dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate (ISO) doxorubicin (ISO) elemental selenium (ISO) ellagic acid (ISO) endosulfan (EXP) ethanol (ISO) famotidine (ISO) fenamidone (ISO) flumequine (ISO) fluoranthene (ISO) flutamide (EXP) folic acid (ISO) FR900359 (ISO) gemcitabine (ISO) genistein (ISO) gentamycin (EXP) glyphosate (ISO) hydroquinone (ISO) indometacin (ISO) ivermectin (ISO) lead diacetate (EXP,ISO) lipopolysaccharide (EXP,ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) MeIQx (ISO) metformin (ISO) methapyrilene (EXP) methimazole (EXP) methotrexate (ISO) methoxychlor (ISO) Methylazoxymethanol acetate (EXP) mono(2-ethylhexyl) phthalate (EXP) Muraglitazar (EXP) N-acetyl-L-cysteine (ISO) N-nitrosodiethylamine (EXP) naphthalene (ISO) nickel atom (ISO) nickel dichloride (ISO) nickel subsulfide (EXP) niclosamide (ISO) nicotine (ISO) nitrates (ISO) NMS-873 (ISO) o-anisidine (ISO) obeticholic acid (ISO) omacetaxine mepesuccinate (ISO) ozone (EXP,ISO) paclitaxel (ISO) paracetamol (EXP,ISO) paraquat (EXP) pentanal (ISO) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) phenanthrene (ISO) phenethyl caffeate (ISO) phenethyl isothiocyanate (ISO) phenobarbital (EXP) pirinixic acid (ISO) procyanidin B3 (ISO) progesterone (ISO) pyrene (ISO) pyrrolidine dithiocarbamate (ISO) quercetin (ISO) resveratrol (ISO) ruxolitinib (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) selenium atom (ISO) serpentine asbestos (ISO) sertraline (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) SM-164 (ISO) sodium arsenite (ISO) sodium hydrogencarbonate (ISO) Soman (EXP) succimer (ISO) sulfadimethoxine (EXP) tacrolimus hydrate (ISO) tetrachloromethane (EXP) thapsigargin (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) tofacitinib (ISO) trichloroethene (ISO) triphenyl phosphate (ISO) triptonide (ISO) troglitazone (EXP) valproic acid (ISO) zinc atom (ISO) zinc oxide (ISO) zinc(0) (ISO) zoledronic acid (ISO)
1.
Differential requirement for NF-kappa B family members in control of helminth infection and intestinal inflammation.
Artis D, etal., J Immunol. 2002 Oct 15;169(8):4481-7. doi: 10.4049/jimmunol.169.8.4481.
2.
Alteration of NF-kappaB activity leads to mitochondrial apoptosis after infection with pathological prion protein.
Bourteele S, etal., Cell Microbiol. 2007 Sep;9(9):2202-17. doi: 10.1111/j.1462-5822.2007.00950.x. Epub 2007 Jun 15.
3.
Signaling mediated by the NF-κB sub-units NF-κB1, NF-κB2 and c-Rel differentially regulate Helicobacter felis-induced gastric carcinogenesis in C57BL/6 mice.
Burkitt MD, etal., Oncogene. 2013 Dec 12;32(50):5563-73. doi: 10.1038/onc.2013.334. Epub 2013 Aug 26.
4.
The involvement of NF-kappaB p65/p52 in the effects of GDNF on DA neurons in early PD rats.
Cao JP, etal., Brain Res Bull. 2008 Jul 30;76(5):505-11. Epub 2008 Apr 9.
5.
The alternative NF-kappaB signalling pathway is a prerequisite for an appropriate immune response against lymphocytic choriomeningitis virus infection.
Droebner K, etal., Viral Immunol. 2010 Jun;23(3):295-308. doi: 10.1089/vim.2009.0101.
6.
Diabetes-induced atrophy is associated with a muscle-specific alteration in NF-kappaB activation and expression.
Frier BC, etal., Cell Stress Chaperones. 2008 Jul 17.
7.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
8.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
9.
Shared principles in NF-kappaB signaling.
Hayden MS and Ghosh S, Cell. 2008 Feb 8;132(3):344-62.
10.
The regulation of inducible nitric oxide synthase gene expression induced by lipopolysaccharide and tumor necrosis factor-alpha in C6 cells: involvement of AP-1 and NFkappaB.
Lee JK, etal., Life Sci. 2003 Jun 20;73(5):595-609.
11.
Age-dependent modulation of NF-kappaB expression in rat adrenal gland.
Medicherla R, etal., Mech Ageing Dev. 2002 May;123(9):1211-27.
12.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
13.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
14.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
15.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
16.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
17.
GOA pipeline
RGD automated data pipeline
18.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
19.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
20.
Distinct patterns of intracerebral hemorrhage-induced alterations in NF-kappaB subunit, iNOS, and COX-2 expression.
Zhao X, etal., J Neurochem. 2007 May;101(3):652-63. Epub 2007 Jan 23.
Nfkb2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 255,106,010 - 255,114,649 (+) NCBI GRCr8 mRatBN7.2 1 245,164,586 - 245,173,225 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 245,165,950 - 245,173,213 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 253,288,361 - 253,294,615 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 259,983,048 - 259,989,300 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 252,634,805 - 252,641,057 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 266,050,634 - 266,059,277 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 266,053,002 - 266,059,256 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 273,481,574 - 273,490,218 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 251,521,559 - 251,527,815 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 251,784,632 - 251,790,888 (+) NCBI Celera 1 240,949,824 - 240,956,078 (+) NCBI Celera Cytogenetic Map 1 q54 NCBI
NFKB2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 10 102,394,110 - 102,402,529 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 10 102,394,110 - 102,402,524 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 10 104,153,867 - 104,162,286 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 10 104,144,219 - 104,152,271 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 10 104,145,452 - 104,152,257 NCBI Celera 10 97,895,118 - 97,903,169 (+) NCBI Celera Cytogenetic Map 10 q24.32 NCBI HuRef 10 97,787,077 - 97,795,460 (+) NCBI HuRef CHM1_1 10 104,437,286 - 104,445,707 (+) NCBI CHM1_1 T2T-CHM13v2.0 10 103,279,058 - 103,287,478 (+) NCBI T2T-CHM13v2.0
Nfkb2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 19 46,285,478 - 46,300,839 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 19 46,292,759 - 46,300,824 (+) Ensembl GRCm39 Ensembl GRCm38 19 46,300,994 - 46,312,400 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 19 46,304,320 - 46,312,385 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 19 46,379,227 - 46,386,580 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 19 46,358,929 - 46,365,401 (+) NCBI MGSCv36 mm8 Celera 19 47,067,972 - 47,075,305 (+) NCBI Celera Cytogenetic Map 19 C3 NCBI cM Map 19 38.8 NCBI
Nfkb2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955485 7,994,874 - 8,000,444 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955485 7,994,730 - 8,001,776 (-) NCBI ChiLan1.0 ChiLan1.0
NFKB2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 8 114,278,824 - 114,290,026 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 10 114,284,119 - 114,295,805 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 10 98,997,604 - 99,006,407 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 10 102,463,503 - 102,471,907 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 10 102,463,503 - 102,471,907 (+) Ensembl panpan1.1 panPan2
NFKB2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 28 14,902,212 - 14,910,437 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 28 14,902,706 - 14,910,395 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 28 15,075,041 - 15,082,885 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 28 15,376,710 - 15,384,554 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 28 15,376,790 - 15,384,554 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 28 14,921,754 - 14,929,597 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 28 14,960,852 - 14,968,695 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 28 15,093,467 - 15,101,311 (+) NCBI UU_Cfam_GSD_1.0
Nfkb2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 31,861,791 - 31,868,033 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936600 3,465,162 - 3,471,205 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936600 3,465,016 - 3,471,258 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
NFKB2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 113,406,004 - 113,414,169 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 113,406,412 - 113,414,177 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 14 123,260,742 - 123,270,847 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
NFKB2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 9 95,426,193 - 95,434,560 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 9 95,427,785 - 95,434,570 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666048 56,531,952 - 56,540,324 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Nfkb2
.
Predicted Target Of
Count of predictions: 77 Count of miRNA genes: 68 Interacting mature miRNAs: 72 Transcripts: ENSRNOT00000026235 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 631690 Scl5 Serum cholesterol level QTL 5 2.1 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 1 236125214 260522016 Rat 1354652 Kidm20 Kidney mass QTL 20 4.3 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 177227632 256448636 Rat 2293674 Bss39 Bone structure and strength QTL 39 7.1 0.0001 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 1 201554356 246554356 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 61327 Eae7 Experimental allergic encephalomyelitis QTL 7 5.6 body mass (VT:0001259) change in body weight (CMO:0002045) 1 216255568 260522016 Rat 1600392 Bw123 Body weight QTL 123 0.001 body mass (VT:0001259) body weight (CMO:0000012) 1 223201027 260522016 Rat 1578763 Kidm29 Kidney mass QTL 29 3.3 0.0001 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 1 179567751 260522016 Rat 1600395 Niddm69 Non-insulin dependent diabetes mellitus QTL 69 4.14 0.0002 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 195804352 257091168 Rat 1354624 Cm35 Cardiac mass QTL35 5.7 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 177227632 256448636 Rat 1600396 Niddm68 Non-insulin dependent diabetes mellitus QTL 68 4.97 0.0003 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 631837 Niddm35 Non-insulin dependent diabetes mellitus QTL 35 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 238699859 259647894 Rat 1600397 Edcs4 Endometrial carcinoma susceptibility QTL 4 2.2 uterus morphology trait (VT:0001120) percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759) 1 206081677 251081677 Rat 631836 Stl31 Serum triglyceride level QTL 31 4.64 5e-06 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 1 237147813 260522016 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 1600388 Niddm67 Non-insulin dependent diabetes mellitus QTL 67 5.84 0.000004 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 2293694 Bss38 Bone structure and strength QTL 38 7.05 0.0001 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 1 201554356 246554356 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 1300108 Rf8 Renal function QTL 8 3.75 renal blood flow trait (VT:2000006) absolute change in renal vascular resistance (CMO:0001900) 1 228581588 259647894 Rat 734767 Niddm57 Non-insulin dependent diabetes mellitus QTL 57 body mass (VT:0001259) body weight (CMO:0000012) 1 224054293 260122809 Rat 1358898 Bp255 Blood pressure QTL 255 3.6 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 191019702 246062233 Rat 631215 Stl8 Serum triglyceride level QTL 8 9.27 0.0001 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 1 225126575 260522016 Rat 631843 Bw116 Body weight QTL 116 4.1 0.016 abdominal adipose amount (VT:1000220) abdominal fat pad weight (CMO:0000088) 1 224054293 260122809 Rat 2300175 Bmd40 Bone mineral density QTL 40 15.4 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 1 201554356 246554356 Rat 731175 Uae20 Urinary albumin excretion QTL 20 3.5 0.0018 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 221264111 259647894 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 724538 Kidm1 Kidney mass QTL 1 3.2 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 213707201 252085212 Rat 2293655 Bss36 Bone structure and strength QTL 36 10.66 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 201554356 246554356 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 734769 Niddm58 Non-insulin dependent diabetes mellitus QTL 58 body mass (VT:0001259) body weight (CMO:0000012) 1 224569538 260122809 Rat 734768 Niddm59 Non-insulin dependent diabetes mellitus QTL 59 body mass (VT:0001259) body weight (CMO:0000012) 1 213843987 258843987 Rat 1358890 Bp259 Blood pressure QTL 259 3.06 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 210702053 260522016 Rat 724533 Rf51 Renal function QTL 51 5.3 0.0002 kidney plasma flow trait (VT:0005524) renal plasma flow (CMO:0001914) 1 218753816 256448513 Rat 1354580 Scort1 Serum corticosterone level QTL 1 3.4 blood corticosterone amount (VT:0005345) blood corticosterone level (CMO:0001172) 1 156677124 256448636 Rat 634313 Niddm43 Non-insulin dependent diabetes mellitus QTL 43 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 199050459 259647894 Rat 1549910 Bw54 Body weight QTL 54 0.05 body mass (VT:0001259) body weight (CMO:0000012) 1 214647894 259647894 Rat 70211 Niddm24 Non-insulin dependent diabetes mellitus QTL 24 3.79 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 214647894 259647894 Rat 1357399 Bw45 Body weight QTL 45 3.05 body mass (VT:0001259) body mass index (BMI) (CMO:0000105) 1 206329708 251329708 Rat 724552 Glom2 Glomerulus QTL 2 3.3 0.0001 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli directly contacting the kidney surface (CMO:0001001) 1 222363780 260522016 Rat 2316896 Gluco57 Glucose level QTL 57 7.2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 228985440 245907899 Rat 1357404 Bw42 Body weight QTL 42 4.49 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 1 206329708 251329708 Rat 10053715 Scort24 Serum corticosterone level QTL 24 2.13 0.0088 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 221414816 260522016 Rat 61400 Niddm1 Non-insulin dependent diabetes mellitus QTL 1 11 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 218753689 245907899 Rat 10059587 Bw173 Body weight QTL 173 3.23 0.025 body mass (VT:0001259) body weight (CMO:0000012) 1 202069611 247069611 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 7387289 Uae45 Urinary albumin excretion QTL 45 2.86 0.0021 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 223262787 260522016 Rat 1581544 Rf52 Renal function QTL 52 0.05 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 1 232156370 259647894 Rat 631536 Lnnr2 Liver neoplastic nodule remodeling QTL 2 2.9 0.0005 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705) 1 233948574 260522016 Rat 738032 Hcas5 Hepatocarcinoma susceptibility QTL 5 3.12 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 176426412 257976495 Rat 2302040 Pia35 Pristane induced arthritis QTL 35 3.8 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 1 216255568 260522016 Rat 631669 Iddm9 Insulin dependent diabetes mellitus QTL 9 2.8 0.039 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 233190394 258625266 Rat 7394701 Uae46 Urinary albumin excretion QTL 46 3.6 0.0056 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 201554356 246554356 Rat 1598821 Rf55 Renal function QTL 55 6.3 renal blood flow trait (VT:2000006) ratio of change in renal blood flow to change in renal perfusion pressure (CMO:0001239) 1 218748008 257976495 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000026235 ⟹ ENSRNOP00000026235
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 245,165,950 - 245,173,213 (+) Ensembl Rnor_6.0 Ensembl 1 266,053,002 - 266,059,256 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000103016 ⟹ ENSRNOP00000080319
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 245,165,950 - 245,173,213 (+) Ensembl
RefSeq Acc Id:
NM_001008349 ⟹ NP_001008350
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 255,108,374 - 255,114,628 (+) NCBI mRatBN7.2 1 245,166,950 - 245,173,204 (+) NCBI Rnor_6.0 1 266,053,002 - 266,059,256 (+) NCBI Rnor_5.0 1 273,481,574 - 273,490,218 (+) NCBI RGSC_v3.4 1 251,521,559 - 251,527,815 (+) RGD Celera 1 240,949,824 - 240,956,078 (+) RGD
Sequence:
AACTTTCTGCCCCTTCCCCGGCCCAGCCCCGATCCGGATCTCGACCTCCACCGGATCTTTCCCGCCACGCCCGGACGGGCGGCTGGAGGAGATCAGACCCTCCCCCAGATCTGAACCCCCCTCTCCTG
hide sequence
RefSeq Acc Id:
XM_006231503 ⟹ XP_006231565
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 255,106,010 - 255,114,649 (+) NCBI mRatBN7.2 1 245,164,586 - 245,173,225 (+) NCBI Rnor_6.0 1 266,050,634 - 266,059,277 (+) NCBI Rnor_5.0 1 273,481,574 - 273,490,218 (+) NCBI
Sequence:
TGGTGCCAGTACAAGTCTATGATCAGCTGCTAAGCAACAGGGCCAGCTGTAGGAGAGCCCTGAA
hide sequence
RefSeq Acc Id:
NP_001008350 ⟸ NM_001008349
- UniProtKB:
Q5U2Z4 (UniProtKB/TrEMBL), A6JHL8 (UniProtKB/TrEMBL), A0A8I6G6F3 (UniProtKB/TrEMBL), A6JHL7 (UniProtKB/TrEMBL)
- Sequence:
MDRCYDPGLDGIPEYDDFEFSPSIVEPKDPAPETADGPYLVIVEQPKQRGFRFRYGCEGPSHGGLPGASSEKGRKTYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGVCAVSVGPKD
hide sequence
RefSeq Acc Id:
XP_006231565 ⟸ XM_006231503
- Peptide Label:
isoform X1
- UniProtKB:
Q5U2Z4 (UniProtKB/TrEMBL), A6JHL8 (UniProtKB/TrEMBL), A0A8I6G6F3 (UniProtKB/TrEMBL), A6JHL7 (UniProtKB/TrEMBL)
- Sequence:
MDRCYDPGLDGIPEYDDFEFSPSIVEPKDPAPETADGPYLVIVEQPKQRGFRFRYGCEGPSHGG
hide sequence
Ensembl Acc Id:
ENSRNOP00000026235 ⟸ ENSRNOT00000026235
Ensembl Acc Id:
ENSRNOP00000080319 ⟸ ENSRNOT00000103016
RGD ID: 13690960 Promoter ID: EPDNEW_R1485 Type: initiation region Name: Nfkb2_1 Description: nuclear factor kappa B subunit 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 266,053,002 - 266,053,062 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-05-04
Nfkb2
nuclear factor kappa B subunit 2
Nfkb2
nuclear factor of kappa light polypeptide gene enhancer in B-cells 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2016-03-01
Nfkb2
nuclear factor of kappa light polypeptide gene enhancer in B-cells 2
Nfkb2
nuclear factor of kappa light polypeptide gene enhancer in B-cells 2, p49/p100
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-30
Nfkb2
nuclear factor of kappa light polypeptide gene enhancer in B-cells 2, p49/p100
RGD1307189
similar to nuclear factor kappa B subunit p100
Symbol and Name updated
1299863 APPROVED
2005-12-06
RGD1307189
similar to nuclear factor kappa B subunit p100
RGD1307189_predicted
similar to nuclear factor kappa B subunit p100 (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-20
RGD1307189_predicted
similar to nuclear factor kappa B subunit p100 (predicted)
LOC309452_predicted
Symbol and Name status set to approved
1331353 APPROVED
2005-01-12
LOC309452_predicted
similar to nuclear factor kappa B subunit p100 (predicted)
Symbol and Name status set to provisional
70820 PROVISIONAL
