Symbol:
Erlin1
Name:
ER lipid raft associated 1
RGD ID:
1307058
Description:
Predicted to enable cholesterol binding activity. Predicted to be involved in ERAD pathway; SREBP signaling pathway; and negative regulation of lipid biosynthetic process. Predicted to be located in endoplasmic reticulum. Predicted to be part of protein-containing complex. Predicted to be active in endoplasmic reticulum membrane. Human ortholog(s) of this gene implicated in hereditary spastic paraplegia 62. Orthologous to human ERLIN1 (ER lipid raft associated 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; amitrole.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
erlin-1; LOC293939; RGD1307058; similar to band 7 protein (35.3 kD) (4N53); SPFH domain family, member 1; Spfh1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 252,870,356 - 252,905,681 (-) NCBI GRCr8 mRatBN7.2 1 242,921,147 - 242,956,472 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 242,921,152 - 242,956,394 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 251,071,489 - 251,106,785 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 257,768,244 - 257,803,553 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 250,421,641 - 250,456,935 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 263,810,439 - 263,845,762 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 263,810,439 - 263,845,762 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 271,255,433 - 271,290,754 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 249,161,437 - 249,196,760 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 249,420,178 - 249,453,615 (+) NCBI Celera 1 238,738,636 - 238,773,959 (-) NCBI Celera Cytogenetic Map 1 q54 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Erlin1 Rat (1->4)-beta-D-glucan multiple interactions ISO RGD:1551377 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of ERLIN1 mRNA CTD PMID:36331819 Erlin1 Rat 1,2-dimethylhydrazine decreases expression ISO RGD:1551377 6480464 1,2-Dimethylhydrazine results in decreased expression of ERLIN1 mRNA CTD PMID:22206623 Erlin1 Rat 17alpha-ethynylestradiol increases expression ISO RGD:1551377 6480464 Ethinyl Estradiol results in increased expression of ERLIN1 mRNA CTD PMID:17555576 Erlin1 Rat 17alpha-ethynylestradiol multiple interactions ISO RGD:1551377 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of ERLIN1 mRNA CTD PMID:17942748 Erlin1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1551377 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of ERLIN1 mRNA CTD PMID:17942748 Erlin1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1551377 6480464 Tetrachlorodibenzodioxin results in increased expression of ERLIN1 mRNA CTD PMID:28922406 Erlin1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1551377 6480464 Tetrachlorodibenzodioxin affects the expression of ERLIN1 mRNA CTD PMID:21570461 Erlin1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of ERLIN1 mRNA CTD PMID:21215274 Erlin1 Rat 4,4'-sulfonyldiphenol increases methylation ISO RGD:1551377 6480464 bisphenol S results in increased methylation of ERLIN1 exon CTD PMID:33297965 Erlin1 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:1344396 6480464 bisphenol S results in increased expression of ERLIN1 protein CTD PMID:34186270 Erlin1 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:1551377 6480464 bisphenol S results in increased expression of ERLIN1 mRNA CTD PMID:39298647 Erlin1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of ERLIN1 mRNA CTD PMID:30047161 Erlin1 Rat aflatoxin B1 decreases expression ISO RGD:1344396 6480464 Aflatoxin B1 results in decreased expression of ERLIN1 mRNA CTD PMID:21632981 Erlin1 Rat all-trans-retinoic acid increases expression ISO RGD:1344396 6480464 Tretinoin results in increased expression of ERLIN1 mRNA CTD PMID:33167477 Erlin1 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of ERLIN1 mRNA CTD PMID:30047161 Erlin1 Rat aristolochic acid A decreases expression ISO RGD:1344396 6480464 aristolochic acid I results in decreased expression of ERLIN1 mRNA CTD PMID:33212167 Erlin1 Rat arsane multiple interactions ISO RGD:1344396 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ERLIN1 more ... CTD PMID:39836092 Erlin1 Rat arsenic atom multiple interactions ISO RGD:1344396 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ERLIN1 more ... CTD PMID:39836092 Erlin1 Rat arsenite(3-) increases expression ISO RGD:1551377 6480464 arsenite results in increased expression of ERLIN1 protein CTD PMID:37955338 Erlin1 Rat benzo[a]pyrene increases mutagenesis ISO RGD:1344396 6480464 Benzo(a)pyrene results in increased mutagenesis of ERLIN1 gene CTD PMID:25435355 Erlin1 Rat benzo[a]pyrene decreases methylation ISO RGD:1344396 6480464 Benzo(a)pyrene results in decreased methylation of ERLIN1 3' UTR CTD PMID:27901495 Erlin1 Rat benzo[a]pyrene decreases expression ISO RGD:1344396 6480464 Benzo(a)pyrene results in decreased expression of ERLIN1 mRNA CTD PMID:21632981 Erlin1 Rat benzo[a]pyrene multiple interactions ISO RGD:1551377 6480464 AHR protein affects the reaction [Benzo(a)pyrene affects the expression of ERLIN1 mRNA] CTD PMID:22228805 Erlin1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of ERLIN1 mRNA CTD PMID:25181051 Erlin1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ERLIN1 mRNA CTD PMID:34947998 Erlin1 Rat bisphenol A decreases expression ISO RGD:1344396 6480464 bisphenol A results in decreased expression of ERLIN1 mRNA; bisphenol A results in decreased expression more ... CTD PMID:29275510|PMID:34186270 Erlin1 Rat bisphenol AF increases expression ISO RGD:1344396 6480464 bisphenol AF results in increased expression of ERLIN1 protein CTD PMID:34186270 Erlin1 Rat Bisphenol B increases expression ISO RGD:1344396 6480464 bisphenol B results in increased expression of ERLIN1 protein CTD PMID:34186270 Erlin1 Rat bisphenol F increases expression ISO RGD:1344396 6480464 bisphenol F results in increased expression of ERLIN1 protein CTD PMID:34186270 Erlin1 Rat cadmium dichloride decreases expression ISO RGD:1344396 6480464 Cadmium Chloride results in decreased expression of ERLIN1 mRNA CTD PMID:38568856 Erlin1 Rat carbon nanotube decreases expression ISO RGD:1551377 6480464 Nanotubes, Carbon results in decreased expression of ERLIN1 mRNA CTD PMID:25620056 Erlin1 Rat CGP 52608 multiple interactions ISO RGD:1344396 6480464 CGP 52608 promotes the reaction [RORA protein binds to ERLIN1 gene] CTD PMID:28238834 Erlin1 Rat ciguatoxin CTX1B affects expression ISO RGD:1551377 6480464 Ciguatoxins affects the expression of ERLIN1 mRNA CTD PMID:18353800 Erlin1 Rat clofibrate increases expression ISO RGD:1551377 6480464 Clofibrate results in increased expression of ERLIN1 mRNA CTD PMID:17585979 Erlin1 Rat copper(II) sulfate decreases expression ISO RGD:1344396 6480464 Copper Sulfate results in decreased expression of ERLIN1 mRNA CTD PMID:19549813 Erlin1 Rat diethylstilbestrol decreases expression ISO RGD:1344396 6480464 Diethylstilbestrol results in decreased expression of ERLIN1 mRNA CTD PMID:36621641 Erlin1 Rat disodium selenite increases expression ISO RGD:1344396 6480464 Sodium Selenite results in increased expression of ERLIN1 mRNA CTD PMID:18175754 Erlin1 Rat diuron increases expression EXP 6480464 Diuron results in increased expression of ERLIN1 mRNA CTD PMID:21551480 Erlin1 Rat doxorubicin decreases expression ISO RGD:1344396 6480464 Doxorubicin results in decreased expression of ERLIN1 mRNA CTD PMID:29803840 Erlin1 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of ERLIN1 mRNA CTD PMID:29391264 Erlin1 Rat epoxiconazole decreases expression ISO RGD:1551377 6480464 epoxiconazole results in decreased expression of ERLIN1 mRNA CTD PMID:35436446 Erlin1 Rat ethanol affects splicing ISO RGD:1551377 6480464 Ethanol affects the splicing of ERLIN1 mRNA CTD PMID:30319688 Erlin1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of ERLIN1 mRNA CTD PMID:24136188 Erlin1 Rat furan decreases expression EXP 6480464 furan results in decreased expression of ERLIN1 mRNA CTD PMID:27387713 Erlin1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of ERLIN1 mRNA CTD PMID:33387578 Erlin1 Rat hexadecanoic acid multiple interactions ISO RGD:1344396 6480464 [Palmitic Acid co-treated with Oleic Acid co-treated with TNF protein] affects the expression of ERLIN1 more ... CTD PMID:30547786 Erlin1 Rat hydrogen peroxide multiple interactions ISO RGD:1344396 6480464 [Hydrogen Peroxide co-treated with Theophylline] results in increased expression of ERLIN1 protein CTD PMID:18951874 Erlin1 Rat ivermectin decreases expression ISO RGD:1344396 6480464 Ivermectin results in decreased expression of ERLIN1 protein CTD PMID:32959892 Erlin1 Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of ERLIN1 mRNA CTD PMID:30467583 Erlin1 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of ERLIN1 mRNA CTD PMID:30047161 Erlin1 Rat monosodium L-glutamate multiple interactions ISO RGD:1551377 6480464 [Trans Fatty Acids co-treated with Sodium Glutamate] results in increased expression of ERLIN1 mRNA CTD PMID:22078008 Erlin1 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of ERLIN1 mRNA CTD PMID:24136188 Erlin1 Rat nickel atom decreases expression ISO RGD:1344396 6480464 Nickel results in decreased expression of ERLIN1 mRNA CTD PMID:23195993 Erlin1 Rat oleic acid multiple interactions ISO RGD:1344396 6480464 [Palmitic Acid co-treated with Oleic Acid co-treated with TNF protein] affects the expression of ERLIN1 more ... CTD PMID:30547786 Erlin1 Rat paracetamol affects expression ISO RGD:1551377 6480464 Acetaminophen affects the expression of ERLIN1 mRNA CTD PMID:17562736 Erlin1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:1551377 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of ERLIN1 mRNA; [perfluorooctane sulfonic more ... CTD PMID:36331819 Erlin1 Rat silicon dioxide decreases expression ISO RGD:1344396 6480464 Silicon Dioxide results in decreased expression of ERLIN1 mRNA CTD PMID:25351596 Erlin1 Rat sodium arsenite decreases expression ISO RGD:1344396 6480464 sodium arsenite results in decreased expression of ERLIN1 mRNA CTD PMID:38568856 Erlin1 Rat sodium arsenite multiple interactions ISO RGD:1344396 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ERLIN1 more ... CTD PMID:39836092 Erlin1 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of ERLIN1 mRNA CTD PMID:30047161 Erlin1 Rat tetrachloromethane decreases expression ISO RGD:1551377 6480464 Carbon Tetrachloride results in decreased expression of ERLIN1 mRNA CTD PMID:31919559 Erlin1 Rat theophylline multiple interactions ISO RGD:1344396 6480464 [Hydrogen Peroxide co-treated with Theophylline] results in increased expression of ERLIN1 protein CTD PMID:18951874 Erlin1 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of ERLIN1 mRNA CTD PMID:34492290 Erlin1 Rat thiram decreases expression ISO RGD:1344396 6480464 Thiram results in decreased expression of ERLIN1 mRNA CTD PMID:38568856 Erlin1 Rat titanium dioxide decreases methylation ISO RGD:1551377 6480464 titanium dioxide results in decreased methylation of ERLIN1 gene CTD PMID:35295148 Erlin1 Rat trichostatin A decreases expression ISO RGD:1344396 6480464 trichostatin A results in decreased expression of ERLIN1 mRNA CTD PMID:24935251 Erlin1 Rat Triptolide increases expression EXP 6480464 triptolide results in increased expression of ERLIN1 protein CTD PMID:32519852 Erlin1 Rat triptonide decreases expression ISO RGD:1551377 6480464 triptonide results in decreased expression of ERLIN1 mRNA CTD PMID:33045310 Erlin1 Rat urethane decreases expression ISO RGD:1344396 6480464 Urethane results in decreased expression of ERLIN1 mRNA CTD PMID:28818685 Erlin1 Rat valproic acid affects expression ISO RGD:1551377 6480464 Valproic Acid affects the expression of ERLIN1 mRNA CTD PMID:17963808 Erlin1 Rat valproic acid affects expression ISO RGD:1344396 6480464 Valproic Acid affects the expression of ERLIN1 mRNA CTD PMID:25979313 Erlin1 Rat zoledronic acid increases expression ISO RGD:1344396 6480464 zoledronic acid results in increased expression of ERLIN1 mRNA CTD PMID:20977926
Erlin1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 252,870,356 - 252,905,681 (-) NCBI GRCr8 mRatBN7.2 1 242,921,147 - 242,956,472 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 242,921,152 - 242,956,394 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 251,071,489 - 251,106,785 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 257,768,244 - 257,803,553 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 250,421,641 - 250,456,935 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 263,810,439 - 263,845,762 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 263,810,439 - 263,845,762 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 271,255,433 - 271,290,754 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 249,161,437 - 249,196,760 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 249,420,178 - 249,453,615 (+) NCBI Celera 1 238,738,636 - 238,773,959 (-) NCBI Celera Cytogenetic Map 1 q54 NCBI
ERLIN1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 10 100,150,094 - 100,186,029 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 10 100,150,094 - 100,186,033 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 10 101,909,851 - 101,945,786 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 10 101,899,837 - 101,935,804 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 10 101,899,841 - 101,935,393 NCBI Celera 10 95,647,790 - 95,683,757 (-) NCBI Celera Cytogenetic Map 10 q24.31 NCBI HuRef 10 95,538,784 - 95,574,746 (-) NCBI HuRef CHM1_1 10 102,194,537 - 102,230,501 (-) NCBI CHM1_1 T2T-CHM13v2.0 10 101,034,336 - 101,070,271 (-) NCBI T2T-CHM13v2.0
Erlin1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 19 44,023,382 - 44,058,580 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 19 44,023,383 - 44,058,224 (-) Ensembl GRCm39 Ensembl GRCm38 19 44,034,943 - 44,070,164 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 19 44,034,944 - 44,069,785 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 19 44,109,433 - 44,144,275 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 19 44,088,258 - 44,122,836 (-) NCBI MGSCv36 mm8 Celera 19 44,820,444 - 44,855,267 (-) NCBI Celera Cytogenetic Map 19 C3 NCBI cM Map 19 36.7 NCBI
Erlin1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955507 6,028,324 - 6,063,689 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955507 6,029,247 - 6,062,946 (-) NCBI ChiLan1.0 ChiLan1.0
ERLIN1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 8 112,039,719 - 112,075,365 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 10 112,045,038 - 112,080,263 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 10 96,756,261 - 96,791,925 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 10 100,238,320 - 100,273,971 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 10 100,238,320 - 100,273,942 (-) Ensembl panpan1.1 panPan2
ERLIN1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 28 12,924,942 - 12,962,016 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 28 12,927,018 - 12,961,983 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 28 13,108,086 - 13,145,157 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 28 13,393,298 - 13,430,578 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 28 13,393,304 - 13,430,564 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 28 12,940,139 - 12,977,413 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 28 12,978,226 - 13,015,269 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 28 13,112,507 - 13,149,560 (-) NCBI UU_Cfam_GSD_1.0
Erlin1
ERLIN1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 9 93,181,320 - 93,217,967 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 9 93,181,319 - 93,217,034 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666048 54,182,581 - 54,218,350 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Erlin1
.
Predicted Target Of
Count of predictions: 337 Count of miRNA genes: 206 Interacting mature miRNAs: 260 Transcripts: ENSRNOT00000017268 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 631690 Scl5 Serum cholesterol level QTL 5 2.1 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 1 236125214 260522016 Rat 1354652 Kidm20 Kidney mass QTL 20 4.3 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 177227632 256448636 Rat 2293674 Bss39 Bone structure and strength QTL 39 7.1 0.0001 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 1 201554356 246554356 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 61327 Eae7 Experimental allergic encephalomyelitis QTL 7 5.6 body mass (VT:0001259) change in body weight (CMO:0002045) 1 216255568 260522016 Rat 1600392 Bw123 Body weight QTL 123 0.001 body mass (VT:0001259) body weight (CMO:0000012) 1 223201027 260522016 Rat 1578763 Kidm29 Kidney mass QTL 29 3.3 0.0001 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 1 179567751 260522016 Rat 1600395 Niddm69 Non-insulin dependent diabetes mellitus QTL 69 4.14 0.0002 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 195804352 257091168 Rat 1354624 Cm35 Cardiac mass QTL35 5.7 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 177227632 256448636 Rat 1600396 Niddm68 Non-insulin dependent diabetes mellitus QTL 68 4.97 0.0003 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 631837 Niddm35 Non-insulin dependent diabetes mellitus QTL 35 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 238699859 259647894 Rat 1600397 Edcs4 Endometrial carcinoma susceptibility QTL 4 2.2 uterus morphology trait (VT:0001120) percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759) 1 206081677 251081677 Rat 631836 Stl31 Serum triglyceride level QTL 31 4.64 5e-06 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 1 237147813 260522016 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 1600388 Niddm67 Non-insulin dependent diabetes mellitus QTL 67 5.84 0.000004 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 2293694 Bss38 Bone structure and strength QTL 38 7.05 0.0001 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 1 201554356 246554356 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 1300108 Rf8 Renal function QTL 8 3.75 renal blood flow trait (VT:2000006) absolute change in renal vascular resistance (CMO:0001900) 1 228581588 259647894 Rat 8655655 Arrd2 Age-related retinal degeneration QTL 2 7.79 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 183970203 243914901 Rat 734767 Niddm57 Non-insulin dependent diabetes mellitus QTL 57 body mass (VT:0001259) body weight (CMO:0000012) 1 224054293 260122809 Rat 1358898 Bp255 Blood pressure QTL 255 3.6 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 191019702 246062233 Rat 631215 Stl8 Serum triglyceride level QTL 8 9.27 0.0001 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 1 225126575 260522016 Rat 631843 Bw116 Body weight QTL 116 4.1 0.016 abdominal adipose amount (VT:1000220) abdominal fat pad weight (CMO:0000088) 1 224054293 260122809 Rat 2300175 Bmd40 Bone mineral density QTL 40 15.4 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 1 201554356 246554356 Rat 731175 Uae20 Urinary albumin excretion QTL 20 3.5 0.0018 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 221264111 259647894 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 724538 Kidm1 Kidney mass QTL 1 3.2 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 213707201 252085212 Rat 2293655 Bss36 Bone structure and strength QTL 36 10.66 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 201554356 246554356 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 734769 Niddm58 Non-insulin dependent diabetes mellitus QTL 58 body mass (VT:0001259) body weight (CMO:0000012) 1 224569538 260122809 Rat 734768 Niddm59 Non-insulin dependent diabetes mellitus QTL 59 body mass (VT:0001259) body weight (CMO:0000012) 1 213843987 258843987 Rat 1358890 Bp259 Blood pressure QTL 259 3.06 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 210702053 260522016 Rat 724533 Rf51 Renal function QTL 51 5.3 0.0002 kidney plasma flow trait (VT:0005524) renal plasma flow (CMO:0001914) 1 218753816 256448513 Rat 1354580 Scort1 Serum corticosterone level QTL 1 3.4 blood corticosterone amount (VT:0005345) blood corticosterone level (CMO:0001172) 1 156677124 256448636 Rat 634313 Niddm43 Non-insulin dependent diabetes mellitus QTL 43 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 199050459 259647894 Rat 1549910 Bw54 Body weight QTL 54 0.05 body mass (VT:0001259) body weight (CMO:0000012) 1 214647894 259647894 Rat 70211 Niddm24 Non-insulin dependent diabetes mellitus QTL 24 3.79 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 214647894 259647894 Rat 1357399 Bw45 Body weight QTL 45 3.05 body mass (VT:0001259) body mass index (BMI) (CMO:0000105) 1 206329708 251329708 Rat 724552 Glom2 Glomerulus QTL 2 3.3 0.0001 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli directly contacting the kidney surface (CMO:0001001) 1 222363780 260522016 Rat 2316896 Gluco57 Glucose level QTL 57 7.2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 228985440 245907899 Rat 1357404 Bw42 Body weight QTL 42 4.49 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 1 206329708 251329708 Rat 10053715 Scort24 Serum corticosterone level QTL 24 2.13 0.0088 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 221414816 260522016 Rat 61400 Niddm1 Non-insulin dependent diabetes mellitus QTL 1 11 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 218753689 245907899 Rat 10059587 Bw173 Body weight QTL 173 3.23 0.025 body mass (VT:0001259) body weight (CMO:0000012) 1 202069611 247069611 Rat 2292216 Bw80 Body weight QTL 80 3.23 0.0019 body mass (VT:0001259) body weight (CMO:0000012) 1 213533809 243914901 Rat 2292220 Bp306 Blood pressure QTL 306 3.47 0.00087 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 243914901 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 2293700 Bmd27 Bone mineral density QTL 27 6.6 0.0001 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 1 224054293 243747962 Rat 2293701 Bmd34 Bone mineral density QTL 34 8.3 0.0001 femur strength trait (VT:0010010) femoral neck ultimate force (CMO:0001703) 1 224054293 243747962 Rat 7387289 Uae45 Urinary albumin excretion QTL 45 2.86 0.0021 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 223262787 260522016 Rat 8655855 Arrd3 Age-related retinal degeneration QTL 3 3.07 lens clarity trait (VT:0001304) cataract incidence/prevalence measurement (CMO:0001585) 1 183970203 243914901 Rat 1581544 Rf52 Renal function QTL 52 0.05 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 1 232156370 259647894 Rat 1600363 Hc6 Hypercalciuria QTL 6 2.7 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 203995416 244113296 Rat 631536 Lnnr2 Liver neoplastic nodule remodeling QTL 2 2.9 0.0005 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705) 1 233948574 260522016 Rat 738032 Hcas5 Hepatocarcinoma susceptibility QTL 5 3.12 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 176426412 257976495 Rat 1358191 Ept10 Estrogen-induced pituitary tumorigenesis QTL 10 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 192825253 243914732 Rat 2302040 Pia35 Pristane induced arthritis QTL 35 3.8 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 1 216255568 260522016 Rat 631669 Iddm9 Insulin dependent diabetes mellitus QTL 9 2.8 0.039 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 233190394 258625266 Rat 7394701 Uae46 Urinary albumin excretion QTL 46 3.6 0.0056 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 201554356 246554356 Rat 1598821 Rf55 Renal function QTL 55 6.3 renal blood flow trait (VT:2000006) ratio of change in renal blood flow to change in renal perfusion pressure (CMO:0001239) 1 218748008 257976495 Rat
RH127626
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 242,921,330 - 242,921,521 (+) MAPPER mRatBN7.2 Rnor_6.0 1 263,810,623 - 263,810,813 NCBI Rnor6.0 Rnor_5.0 1 271,255,617 - 271,255,807 UniSTS Rnor5.0 RGSC_v3.4 1 249,196,386 - 249,196,576 UniSTS RGSC3.4 Celera 1 238,738,820 - 238,739,010 UniSTS RH 3.4 Map 1 1621.42 UniSTS Cytogenetic Map 1 q54 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000017268 ⟹ ENSRNOP00000017268
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 242,921,152 - 242,956,390 (-) Ensembl Rnor_6.0 Ensembl 1 263,810,439 - 263,845,762 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000103941 ⟹ ENSRNOP00000097939
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 242,921,165 - 242,956,394 (-) Ensembl
RefSeq Acc Id:
NM_001106353 ⟹ NP_001099823
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 252,870,356 - 252,905,681 (-) NCBI mRatBN7.2 1 242,921,147 - 242,956,472 (-) NCBI Rnor_6.0 1 263,810,439 - 263,845,762 (-) NCBI Rnor_5.0 1 271,255,433 - 271,290,754 (-) NCBI RGSC_v3.4 1 249,161,437 - 249,196,760 (+) RGD Celera 1 238,738,636 - 238,773,959 (-) RGD
Sequence:
GGACAGGTGGGCGGGGCCGGCTGTTGGCAGCAGTTGGCGGGGCCGGGTGGCGGCTGCACGTGCGGGCGGGGGCGATGCGTCACTGACCGGAGGAACAAGGATGAATATGACTCAAGCCCGGCTTCTGG
hide sequence
RefSeq Acc Id:
XM_006231441 ⟹ XP_006231503
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 252,870,360 - 252,905,594 (-) NCBI mRatBN7.2 1 242,921,149 - 242,956,370 (-) NCBI Rnor_6.0 1 263,810,439 - 263,845,651 (-) NCBI Rnor_5.0 1 271,255,433 - 271,290,754 (-) NCBI
Sequence:
CGGTTCTCCGGGTGCCTGAGACCAAGGCGGTTCTCAGTCGGGACCTTCTACTTGGGGAGCCAGG
hide sequence
RefSeq Acc Id:
NP_001099823 ⟸ NM_001106353
- UniProtKB:
B1WBY7 (UniProtKB/TrEMBL), F7ERV0 (UniProtKB/TrEMBL), A0A8I6B6J2 (UniProtKB/TrEMBL)
- Sequence:
MNMTQARLLVAAVVGLVAILLYASIHKIEEGHLAVYYRGGALLTSPSGPGYHIMLPFITTFRSVQTTLQTDEVKNVPCGTSGGVMIYIDRIEVVNMLAPYAVFDIVRNYTADYDKTLIFNKIHHELNQ
hide sequence
RefSeq Acc Id:
XP_006231503 ⟸ XM_006231441
- Peptide Label:
isoform X1
- UniProtKB:
B1WBY7 (UniProtKB/TrEMBL), F7ERV0 (UniProtKB/TrEMBL), A0A8I6B6J2 (UniProtKB/TrEMBL)
- Sequence:
MNMTQARLLVAAVVGLVAILLYASIHKIEEGHLAVYYRGGALLTSPSGPGYHIMLPFITTFRSVQTTLQTDEVKNVPCGTSGGVMIYIDRIEVVNMLAPYAVFDIVRNYTADYDKTLIFNKIHHELNQ
hide sequence
Ensembl Acc Id:
ENSRNOP00000017268 ⟸ ENSRNOT00000017268
Ensembl Acc Id:
ENSRNOP00000097939 ⟸ ENSRNOT00000103941
RGD ID: 13690933 Promoter ID: EPDNEW_R1458 Type: multiple initiation site Name: Erlin1_1 Description: ER lipid raft associated 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 263,845,734 - 263,845,794 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-03-07
Erlin1
ER lipid raft associated 1
Spfh1_predicted
SPFH domain family, member 1 (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-30
Spfh1_predicted
SPFH domain family, member 1 (predicted)
RGD1307058_predicted
similar to band 7 protein (35.3 kD) (4N53) (predicted)
Symbol and Name updated
1299863 APPROVED
2005-01-20
RGD1307058_predicted
similar to band 7 protein (35.3 kD) (4N53) (predicted)
LOC293939_predicted
Symbol and Name status set to approved
1331353 APPROVED
2005-01-12
LOC293939_predicted
similar to band 7 protein (35.3 kD) (4N53) (predicted)
Symbol and Name status set to provisional
70820 PROVISIONAL
