Symbol:
Abr
Name:
ABR activator of RhoGEF and GTPase
RGD ID:
1306279
Description:
Predicted to enable GTPase activator activity and guanyl-nucleotide exchange factor activity. Predicted to be involved in several processes, including activation of GTPase activity; negative regulation of blood vessel remodeling; and negative regulation of cellular extravasation. Predicted to act upstream of or within several processes, including negative regulation of macrophage migration; regulation of vesicle-mediated transport; and response to lipopolysaccharide. Is active in glutamatergic synapse and postsynaptic density, intracellular component. Orthologous to human ABR (ABR activator of RhoGEF and GTPase); INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 3-chloropropane-1,2-diol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
ABR, RhoGEF and GTPase activating protein; active BCR-related; active BCR-related gene; active breakpoint cluster region-related protein; breakpoint cluster region protein-like; LOC103693389; LOC287537; LOC687983; similar to Breakpoint cluster region protein
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 61,760,743 - 61,959,526 (-) NCBI GRCr8 mRatBN7.2 10 61,262,516 - 61,461,331 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 61,262,516 - 61,461,505 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 65,908,046 - 66,051,300 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 65,413,502 - 65,556,758 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 60,883,717 - 61,026,573 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 64,565,121 - 64,657,079 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 64,567,268 - 64,657,089 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 63,250,866 - 63,449,251 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 67,617,776 - 67,760,961 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 67,631,103 - 67,774,585 (+) NCBI Celera 10 60,277,504 - 60,420,210 (-) NCBI Celera Cytogenetic Map 10 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Abr Rat (-)-epigallocatechin 3-gallate multiple interactions ISO ABR (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of ABR mRNA CTD PMID:22079256 Abr Rat (1->4)-beta-D-glucan multiple interactions ISO Abr (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of ABR mRNA CTD PMID:36331819 Abr Rat 1,2-dimethylhydrazine multiple interactions ISO Abr (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of ABR mRNA CTD PMID:22206623 Abr Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of ABR mRNA CTD PMID:29097150 Abr Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Abr (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Abr Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Abr (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Abr Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Abr (Mus musculus) 6480464 Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to ABR gene] CTD PMID:20819909 Abr Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of ABR mRNA CTD PMID:32109520 Abr Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Abr (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of ABR mRNA CTD PMID:21570461 Abr Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Abr (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of ABR mRNA CTD PMID:20819909 Abr Rat 2-methylcholine affects expression ISO ABR (Homo sapiens) 6480464 beta-methylcholine affects the expression of ABR mRNA CTD PMID:21179406 Abr Rat 2-palmitoylglycerol increases expression ISO ABR (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of ABR mRNA CTD PMID:37199045 Abr Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Abr (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of ABR mRNA CTD PMID:26251327 Abr Rat 3,4-methylenedioxymethamphetamine increases methylation ISO Abr (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased methylation of ABR promoter CTD PMID:26251327 Abr Rat 3-chloropropane-1,2-diol decreases expression EXP 6480464 alpha-Chlorohydrin results in decreased expression of ABR mRNA CTD PMID:28522335 Abr Rat 4,4'-sulfonyldiphenol decreases methylation ISO ABR (Homo sapiens) 6480464 bisphenol S results in decreased methylation of ABR gene CTD PMID:31601247 Abr Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of ABR mRNA CTD PMID:24780913 Abr Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of ABR mRNA CTD PMID:31881176 Abr Rat aflatoxin B1 increases methylation ISO ABR (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of ABR promoter CTD PMID:30157460 Abr Rat aflatoxin B1 affects methylation ISO ABR (Homo sapiens) 6480464 Aflatoxin B1 affects the methylation of ABR intron CTD PMID:30157460 Abr Rat Aflatoxin B2 alpha affects methylation ISO ABR (Homo sapiens) 6480464 aflatoxin B2 affects the methylation of ABR intron CTD PMID:30157460 Abr Rat Aflatoxin B2 alpha increases methylation ISO ABR (Homo sapiens) 6480464 aflatoxin B2 results in increased methylation of ABR promoter CTD PMID:30157460 Abr Rat amosite asbestos decreases methylation ISO ABR (Homo sapiens) 6480464 Asbestos and Amosite results in decreased methylation of ABR promoter CTD PMID:29626692 Abr Rat antirheumatic drug decreases expression ISO ABR (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of ABR mRNA CTD PMID:24449571 Abr Rat arsane affects methylation ISO ABR (Homo sapiens) 6480464 Arsenic affects the methylation of ABR gene CTD PMID:25304211 Abr Rat arsane multiple interactions ISO ABR (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ABR mRNA CTD PMID:39836092 Abr Rat arsane decreases methylation ISO ABR (Homo sapiens) 6480464 Arsenic results in decreased methylation of ABR gene CTD PMID:31135185 Abr Rat arsenic atom affects methylation ISO ABR (Homo sapiens) 6480464 Arsenic affects the methylation of ABR gene CTD PMID:25304211 Abr Rat arsenic atom multiple interactions ISO ABR (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ABR mRNA CTD PMID:39836092 Abr Rat arsenic atom decreases methylation ISO ABR (Homo sapiens) 6480464 Arsenic results in decreased methylation of ABR gene CTD PMID:31135185 Abr Rat atrazine decreases expression ISO ABR (Homo sapiens) 6480464 Atrazine results in decreased expression of ABR mRNA CTD PMID:22378314 Abr Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of ABR gene CTD PMID:35440735 Abr Rat benzo[a]pyrene decreases expression ISO ABR (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of ABR mRNA CTD PMID:20064835 more ... Abr Rat benzo[a]pyrene affects methylation ISO ABR (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of ABR 5' UTR more ... CTD PMID:27901495 and PMID:30157460 Abr Rat benzo[a]pyrene increases methylation ISO Abr (Mus musculus) 6480464 Benzo(a)pyrene results in increased methylation of ABR intron CTD PMID:27901495 Abr Rat benzo[a]pyrene diol epoxide I decreases expression ISO ABR (Homo sapiens) 6480464 7 more ... CTD PMID:26238291 Abr Rat benzo[e]pyrene affects methylation ISO ABR (Homo sapiens) 6480464 benzo(e)pyrene affects the methylation of ABR intron CTD PMID:30157460 Abr Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of ABR mRNA CTD PMID:25181051 Abr Rat bisphenol A decreases methylation ISO ABR (Homo sapiens) 6480464 bisphenol A results in decreased methylation of ABR gene CTD PMID:31601247 Abr Rat bisphenol A multiple interactions ISO ABR (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of ABR gene CTD PMID:31601247 Abr Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of ABR gene CTD PMID:28505145 Abr Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ABR mRNA CTD PMID:29097150 and PMID:34947998 Abr Rat bisphenol A increases expression ISO ABR (Homo sapiens) 6480464 bisphenol A results in increased expression of ABR mRNA CTD PMID:27685785 Abr Rat cadmium dichloride decreases expression ISO ABR (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of ABR mRNA CTD PMID:38568856 Abr Rat choline multiple interactions ISO Abr (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of ABR mRNA CTD PMID:20938992 Abr Rat cisplatin affects response to substance ISO ABR (Homo sapiens) 6480464 ABR protein affects the susceptibility to Cisplatin CTD PMID:16217747 Abr Rat cisplatin decreases expression ISO ABR (Homo sapiens) 6480464 Cisplatin results in decreased expression of ABR mRNA CTD PMID:19561079 and PMID:27594783 Abr Rat cobalt dichloride decreases expression ISO ABR (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of ABR mRNA CTD PMID:19320972 and PMID:19376846 Abr Rat copper(II) chloride increases expression ISO ABR (Homo sapiens) 6480464 cupric chloride results in increased expression of ABR mRNA CTD PMID:38568856 Abr Rat copper(II) sulfate increases expression ISO ABR (Homo sapiens) 6480464 Copper Sulfate results in increased expression of ABR mRNA CTD PMID:19549813 Abr Rat crocidolite asbestos decreases methylation ISO ABR (Homo sapiens) 6480464 Asbestos and Crocidolite results in decreased methylation of ABR promoter CTD PMID:29626692 Abr Rat cyclosporin A increases expression ISO ABR (Homo sapiens) 6480464 Cyclosporine results in increased expression of ABR mRNA CTD PMID:25562108 Abr Rat dibutyl phthalate decreases expression ISO Abr (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of ABR mRNA CTD PMID:21266533 Abr Rat doxorubicin decreases expression ISO ABR (Homo sapiens) 6480464 Doxorubicin results in decreased expression of ABR mRNA CTD PMID:29803840 Abr Rat elemental selenium increases expression ISO ABR (Homo sapiens) 6480464 Selenium results in increased expression of ABR mRNA CTD PMID:19244175 Abr Rat ethanol multiple interactions ISO Abr (Mus musculus) 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in increased expression of ABR mRNA CTD PMID:30517762 Abr Rat ethanol affects splicing ISO Abr (Mus musculus) 6480464 Ethanol affects the splicing of ABR mRNA CTD PMID:30319688 Abr Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of ABR mRNA CTD PMID:30307764 Abr Rat folic acid multiple interactions ISO Abr (Mus musculus) 6480464 [1 more ... CTD PMID:20938992 and PMID:22206623 Abr Rat fulvestrant multiple interactions ISO ABR (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of ABR gene CTD PMID:31601247 Abr Rat hydrogen peroxide affects expression ISO ABR (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of ABR mRNA CTD PMID:21179406 Abr Rat ivermectin decreases expression ISO ABR (Homo sapiens) 6480464 Ivermectin results in decreased expression of ABR protein CTD PMID:32959892 Abr Rat L-methionine multiple interactions ISO Abr (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of ABR mRNA CTD PMID:20938992 Abr Rat lead(0) affects methylation ISO ABR (Homo sapiens) 6480464 Lead affects the methylation of ABR gene CTD PMID:31636367 Abr Rat menadione affects expression ISO ABR (Homo sapiens) 6480464 Vitamin K 3 affects the expression of ABR mRNA CTD PMID:20044591 Abr Rat methapyrilene affects methylation ISO ABR (Homo sapiens) 6480464 Methapyrilene affects the methylation of ABR intron CTD PMID:30157460 Abr Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of ABR gene CTD PMID:35440735 Abr Rat methylmercury chloride affects expression EXP 6480464 methylmercuric chloride affects the expression of ABR mRNA CTD PMID:20864626 Abr Rat N-methyl-4-phenylpyridinium increases expression ISO ABR (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of ABR mRNA CTD PMID:24810058 Abr Rat N-nitrosodiethylamine multiple interactions ISO Abr (Mus musculus) 6480464 [Piperonyl Butoxide co-treated with Diethylnitrosamine] affects the methylation of ABR gene CTD PMID:23968726 Abr Rat ozone multiple interactions ISO ABR (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of ABR mRNA CTD PMID:35430440 Abr Rat PCB138 multiple interactions ISO Abr (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Abr Rat perfluorohexanesulfonic acid increases expression ISO Abr (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of ABR mRNA CTD PMID:37995155 Abr Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Abr (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of ABR mRNA CTD PMID:36331819 Abr Rat piperonyl butoxide multiple interactions ISO Abr (Mus musculus) 6480464 [Piperonyl Butoxide co-treated with Diethylnitrosamine] affects the methylation of ABR gene CTD PMID:23968726 Abr Rat potassium chromate multiple interactions ISO ABR (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of ABR mRNA CTD PMID:22079256 Abr Rat potassium chromate decreases expression ISO ABR (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of ABR mRNA CTD PMID:22079256 Abr Rat selenium atom increases expression ISO ABR (Homo sapiens) 6480464 Selenium results in increased expression of ABR mRNA CTD PMID:19244175 Abr Rat serpentine asbestos decreases methylation ISO ABR (Homo sapiens) 6480464 Asbestos and Serpentine results in decreased methylation of ABR promoter CTD PMID:29626692 Abr Rat sodium arsenite increases expression ISO ABR (Homo sapiens) 6480464 sodium arsenite results in increased expression of ABR mRNA CTD PMID:17879257 more ... Abr Rat sodium arsenite multiple interactions ISO ABR (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ABR mRNA CTD PMID:39836092 Abr Rat sodium arsenite decreases expression ISO ABR (Homo sapiens) 6480464 sodium arsenite results in decreased expression of ABR mRNA CTD PMID:34032870 Abr Rat sunitinib increases expression ISO ABR (Homo sapiens) 6480464 Sunitinib results in increased expression of ABR mRNA CTD PMID:31533062 Abr Rat tert-butyl hydroperoxide increases expression ISO Abr (Mus musculus) 6480464 tert-Butylhydroperoxide results in increased expression of ABR mRNA CTD PMID:15003993 Abr Rat tetrachloromethane multiple interactions ISO Abr (Mus musculus) 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in increased expression of ABR mRNA CTD PMID:30517762 Abr Rat thapsigargin increases expression EXP 6480464 Thapsigargin results in increased expression of ABR protein CTD PMID:35544339 Abr Rat titanium dioxide increases methylation ISO Abr (Mus musculus) 6480464 titanium dioxide results in increased methylation of ABR gene CTD PMID:35295148 Abr Rat titanium dioxide decreases methylation ISO Abr (Mus musculus) 6480464 titanium dioxide results in decreased methylation of ABR gene CTD PMID:35295148 Abr Rat toluene decreases expression ISO ABR (Homo sapiens) 6480464 Toluene results in decreased expression of ABR mRNA CTD PMID:26717081 Abr Rat toluene increases methylation ISO ABR (Homo sapiens) 6480464 Toluene results in increased methylation of ABR gene CTD PMID:26717081 Abr Rat triphenyl phosphate affects expression ISO ABR (Homo sapiens) 6480464 triphenyl phosphate affects the expression of ABR mRNA CTD PMID:37042841 Abr Rat triptonide increases expression ISO Abr (Mus musculus) 6480464 triptonide results in increased expression of ABR mRNA CTD PMID:33045310 Abr Rat tungsten decreases expression ISO Abr (Mus musculus) 6480464 Tungsten results in decreased expression of ABR mRNA CTD PMID:30912803 Abr Rat urethane decreases expression ISO ABR (Homo sapiens) 6480464 Urethane results in decreased expression of ABR mRNA CTD PMID:28818685 Abr Rat valproic acid increases expression ISO ABR (Homo sapiens) 6480464 Valproic Acid results in increased expression of ABR mRNA CTD PMID:23179753 Abr Rat valproic acid affects expression ISO ABR (Homo sapiens) 6480464 Valproic Acid affects the expression of ABR mRNA CTD PMID:25979313 Abr Rat valproic acid increases methylation ISO ABR (Homo sapiens) 6480464 Valproic Acid results in increased methylation of ABR gene CTD PMID:29154799
(-)-epigallocatechin 3-gallate (ISO) (1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (EXP) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-methylcholine (ISO) 2-palmitoylglycerol (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-chloropropane-1,2-diol (EXP) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) amosite asbestos (ISO) antirheumatic drug (ISO) arsane (ISO) arsenic atom (ISO) atrazine (EXP,ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) benzo[e]pyrene (ISO) bisphenol A (EXP,ISO) cadmium dichloride (ISO) choline (ISO) cisplatin (ISO) cobalt dichloride (ISO) copper(II) chloride (ISO) copper(II) sulfate (ISO) crocidolite asbestos (ISO) cyclosporin A (ISO) dibutyl phthalate (ISO) doxorubicin (ISO) elemental selenium (ISO) ethanol (ISO) fenvalerate (EXP) folic acid (ISO) fulvestrant (ISO) hydrogen peroxide (ISO) ivermectin (ISO) L-methionine (ISO) lead(0) (ISO) menadione (ISO) methapyrilene (ISO) methoxychlor (EXP) methylmercury chloride (EXP) N-methyl-4-phenylpyridinium (ISO) N-nitrosodiethylamine (ISO) ozone (ISO) PCB138 (ISO) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) piperonyl butoxide (ISO) potassium chromate (ISO) selenium atom (ISO) serpentine asbestos (ISO) sodium arsenite (ISO) sunitinib (ISO) tert-butyl hydroperoxide (ISO) tetrachloromethane (ISO) thapsigargin (EXP) titanium dioxide (ISO) toluene (ISO) triphenyl phosphate (ISO) triptonide (ISO) tungsten (ISO) urethane (ISO) valproic acid (ISO)
Abr Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 61,760,743 - 61,959,526 (-) NCBI GRCr8 mRatBN7.2 10 61,262,516 - 61,461,331 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 61,262,516 - 61,461,505 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 65,908,046 - 66,051,300 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 65,413,502 - 65,556,758 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 60,883,717 - 61,026,573 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 64,565,121 - 64,657,079 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 64,567,268 - 64,657,089 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 63,250,866 - 63,449,251 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 67,617,776 - 67,760,961 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 67,631,103 - 67,774,585 (+) NCBI Celera 10 60,277,504 - 60,420,210 (-) NCBI Celera Cytogenetic Map 10 q24 NCBI
ABR Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 1,003,519 - 1,229,722 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 1,003,519 - 1,229,738 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 906,759 - 1,133,016 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 853,509 - 1,029,881 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 17 853,509 - 1,029,881 NCBI Celera 17 918,106 - 1,102,463 (-) NCBI Celera Cytogenetic Map 17 p13.3 NCBI HuRef 17 813,353 - 993,409 (-) NCBI HuRef CHM1_1 17 914,146 - 1,097,251 (-) NCBI CHM1_1 T2T-CHM13v2.0 17 890,209 - 1,120,740 (-) NCBI T2T-CHM13v2.0
Abr Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 76,307,560 - 76,468,515 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 76,307,560 - 76,514,384 (-) Ensembl GRCm39 Ensembl GRCm38 11 76,416,732 - 76,623,324 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 76,416,734 - 76,623,558 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 76,230,236 - 76,391,229 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 76,232,929 - 76,393,922 (-) NCBI MGSCv36 mm8 Celera 11 83,928,368 - 84,081,980 (-) NCBI Celera Cytogenetic Map 11 B5 NCBI cM Map 11 45.92 NCBI
Abr Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955481 2,503,315 - 2,654,244 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955481 2,503,309 - 2,710,667 (-) NCBI ChiLan1.0 ChiLan1.0
ABR Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 8,556,006 - 8,755,510 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 10,527,138 - 10,731,505 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 972,009 - 1,174,953 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 893,413 - 1,116,064 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 895,013 - 1,069,973 (-) Ensembl panpan1.1 panPan2
ABR Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 9 44,634,117 - 44,821,454 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 9 44,681,411 - 44,819,249 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 9 43,785,466 - 43,972,043 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 9 45,451,750 - 45,638,302 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 9 45,451,864 - 45,638,282 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 9 44,278,129 - 44,417,777 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 9 44,517,664 - 44,703,775 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 9 44,604,307 - 44,790,569 (+) NCBI UU_Cfam_GSD_1.0
Abr Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 43,750,170 - 43,941,125 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936538 6,674,907 - 6,816,674 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936538 6,674,595 - 6,819,511 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ABR Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 12 46,709,880 - 46,895,808 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 12 46,709,840 - 46,895,819 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 12 48,950,856 - 49,028,680 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ABR
Abr
.
Predicted Target Of
Count of predictions: 372 Count of miRNA genes: 198 Interacting mature miRNAs: 264 Transcripts: ENSRNOT00000032861 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
61441 Btemp1 Thermal response to stress QTL 1 4 body temperature trait (VT:0005535) core body temperature (CMO:0001036) 10 35392457 63642539 Rat 1549846 Scl47 Serum cholesterol level QTL 47 3.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 50574707 95574707 Rat 152025229 Scl83 Serum cholesterol level QTL 83 4.33 blood cholesterol amount (VT:0000180) 10 35710580 68663659 Rat 1578779 Tcas10 Tongue tumor susceptibility QTL 10 3.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 10 31297439 76297439 Rat 152025227 Bw195 Body weight QTL 195 5.73 body mass (VT:0001259) 10 46989699 68663659 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 2293669 Bmd33 Bone mineral density QTL 33 4.5 0.0001 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 10 49444551 81709989 Rat 152025224 Bw193 Body weight QTL 193 6.47 body mass (VT:0001259) 10 51663405 75085664 Rat 631552 Vetf2 Vascular elastic tissue fragility QTL 2 4.5 0.0002 aorta elastic tissue integrity trait (VT:0010556) artery internal elastic lamina non-tumorous lesion count (CMO:0001913) 10 41142633 86142633 Rat 631554 Bp133 Blood pressure QTL 133 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 743364 63851208 Rat 631557 Bp136 Blood pressure QTL 136 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 30632053 75632053 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1298078 Stresp5 Stress response QTL 5 2.99 0.00025 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 42045676 104670812 Rat 2293679 Bmd30 Bone mineral density QTL 30 3.5 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 1549831 Bss6 Bone structure and strength QTL 6 4 lumbar vertebra strength trait (VT:0010574) vertebra ultimate force (CMO:0001678) 10 57576521 102576521 Rat 2298544 Neuinf9 Neuroinflammation QTL 9 4.6 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 10 5801990 62146030 Rat 70164 Bw21 Body weight QTL 21 4.36 0.00005 body mass (VT:0001259) body weight (CMO:0000012) 10 53797494 98952626 Rat 61463 Bp12 Blood pressure QTL 12 6.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 41333258 86333258 Rat 8694173 Bw149 Body weight QTL 149 4.38 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 10 44441699 89441699 Rat 2300218 Hpcl2 Hepatic cholesterol level QTL 2 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 45029650 95600334 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 70171 Cari1 Carrageenan-induced inflammation QTL 1 4.9 0.0005 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 10 53797385 107211142 Rat 1598852 Anxrr19 Anxiety related response QTL 19 5.07 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 10 18167841 63167841 Rat 1581497 Esta1 Estrogen-induced thymic atrophy QTL 1 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 21329805 61345413 Rat 724527 Bp148 Blood pressure QTL 148 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 28453136 73453136 Rat 1358897 Stresp6 Stress response QTL 6 4.17 0.022 blood norepinephrine amount (VT:0005663) plasma norepinephrine level (CMO:0001010) 10 35392267 64155584 Rat 1331762 Rf40 Renal function QTL 40 3.873 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 10 29299504 64155584 Rat 2300171 Bmd58 Bone mineral density QTL 58 4.9 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 26944628 71944628 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2301967 Cm73 Cardiac mass QTL 73 4.55 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 10 14487011 89062041 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 70188 BpQTLcluster1 Blood pressure QTL cluster 1 4.864 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 42323132 87323132 Rat 9589030 Epfw9 Epididymal fat weight QTL 9 19.24 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 10 44441699 89441699 Rat 10402859 Bp381 Blood pressure QTL 381 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 2293652 Bmd22 Bone mineral density QTL 22 4.9 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 70198 BpQTLcluster9 Blood pressure QTL cluster 9 2.94 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 42323132 87323132 Rat 2306970 Anxrr22 Anxiety related response QTL 22 5.95 fear/anxiety-related behavior trait (VT:1000241) number of periods of voluntary immobility (CMO:0001045) 10 61345276 98211570 Rat 1359017 Hrtrt21 Heart rate QTL 21 2.4 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 10 51772940 96772940 Rat 2306787 Ean3 Experimental allergic neuritis QTL 3 3.1 nervous system integrity trait (VT:0010566) body weight loss (CMO:0001399) 10 53797385 66979128 Rat 2312672 Insul15 Insulin level QTL 15 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 10 57134272 102134272 Rat 724556 Pur2 Proteinuria QTL 2 5.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 22427500 90627625 Rat 8662860 Vetf10 Vascular elastic tissue fragility QTL 10 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 10 6154182 73453136 Rat 61387 Bp1 Blood pressure QTL 1 5.1 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 51770177 107211142 Rat 70223 Bp57 Blood pressure QTL 57 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 1 80676123 Rat 2317043 Aia7 Adjuvant induced arthritis QTL 7 3.82 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 37565079 82565079 Rat 70224 Eae3 Experimental allergic encephalomyelitis QTL 3 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 10 26521957 61345413 Rat 2317042 Aia20 Adjuvant induced arthritis QTL 20 3.38 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 37565079 82565079 Rat 70363 Bp71 Blood pressure QTL 71 0.04 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 61345276 81714865 Rat 61402 Niddm3 Non-insulin dependent diabetes mellitus QTL 3 4.58 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 61345413 82564856 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 2313087 Bmd80 Bone mineral density QTL 80 3.2 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 10 19606483 64606483 Rat 70364 Bp72 Blood pressure QTL 72 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 51121100 96121100 Rat 2293698 Bss43 Bone structure and strength QTL 43 5.33 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 10 59209888 104209888 Rat 631530 Tls3 T-lymphoma susceptibility QTL 3 0 0.0001 thymus integrity trait (VT:0010555) percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911) 10 51774612 95600334 Rat 1354608 Cm33 Cardiac mass QTL 33 2.8 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 10 54809292 99809292 Rat 1558643 Cm44 Cardiac mass QTL 44 4.8 0.0000368 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 61345276 99703528 Rat 631535 Cm51 Cardiac mass QTL 51 3 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 10 51786282 91669536 Rat 1576319 Cia29 Collagen induced arthritis QTL 29 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 33973921 78973921 Rat 8552805 Bw145 Body weight QTL 145 2.2 body mass (VT:0001259) change in body weight to body weight ratio (CMO:0002216) 10 41944526 78307017 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2293705 Bmd25 Bone mineral density QTL 25 7.1 0.0001 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 10 49444551 81709989 Rat 1331839 Eae18b Experimental allergic encephalomyelitis QTL 18b 5.8 0.03 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis severity score (CMO:0001419) 10 61248303 67785171 Rat 1576308 Schws1 Schwannoma susceptibility QTL 1 0.0041 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 40035094 102359817 Rat 631269 Cia22 Collagen induced arthritis QTL 22 8.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 7207811 Bmd90 Bone mineral density QTL 90 5.2 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 10 49444551 81709989 Rat 1576311 Pia26 Pristane induced arthritis QTL 26 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 31224026 75632053 Rat 631270 Cia23 Collagen induced arthritis QTL 23 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 7411614 Foco18 Food consumption QTL 18 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 44441699 89441699 Rat 631526 Bp76 Blood pressure QTL 76 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 61345413 66743655 Rat 6893336 Cm75 Cardiac mass QTL 75 0.1 0.87 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 61345276 99703528 Rat 631547 Bp87 Blood pressure QTL 87 4.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 47369470 92369470 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 2312662 Slep8 Serum leptin concentration QTL 8 0.05 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 10 57134272 102134272 Rat 6893342 Cm78 Cardiac mass QTL 78 0.1 0.88 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 42876766 79813922 Rat 2292441 Bp308 Blood pressure QTL 308 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2313055 Bw96 Body weight QTL 96 3.6 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 10 19606483 64606483 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat 2312668 Scl65 Serum cholesterol level QTL 65 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 57134272 102134272 Rat
D10Mgh6
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 10 61,843,496 - 61,843,633 (+) Marker Load Pipeline mRatBN7.2 10 61,345,276 - 61,345,413 (+) MAPPER mRatBN7.2 Rnor_6.0 10 64,648,175 - 64,648,311 NCBI Rnor6.0 Rnor_5.0 10 63,366,082 - 63,366,218 UniSTS Rnor5.0 RGSC_v3.4 10 67,677,924 - 67,678,060 UniSTS RGSC3.4 Celera 10 60,360,352 - 60,360,488 UniSTS RH 2.0 Map 10 641.2 RGD SHRSP x BN Map 10 45.5399 RGD Cytogenetic Map 10 q26 UniSTS
AU042359
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 10 61,760,947 - 61,761,059 (+) Marker Load Pipeline mRatBN7.2 10 61,262,719 - 61,262,832 (+) MAPPER mRatBN7.2 Rnor_6.0 10 64,565,325 - 64,565,437 NCBI Rnor6.0 Rnor_5.0 10 63,448,935 - 63,449,047 UniSTS Rnor5.0 RGSC_v3.4 10 67,760,646 - 67,760,758 UniSTS RGSC3.4 Celera 10 60,277,708 - 60,277,820 UniSTS Cytogenetic Map 10 q26 UniSTS
BE104553
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 61,287,604 - 61,287,756 (+) MAPPER mRatBN7.2 Rnor_6.0 10 64,590,209 - 64,590,360 NCBI Rnor6.0 Rnor_5.0 10 63,424,012 - 63,424,163 UniSTS Rnor5.0 RGSC_v3.4 10 67,735,722 - 67,735,873 UniSTS RGSC3.4 Celera 10 60,302,593 - 60,302,744 UniSTS Cytogenetic Map 10 q26 UniSTS
Abr
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 61,262,558 - 61,262,725 (+) MAPPER mRatBN7.2 Rnor_6.0 10 64,565,164 - 64,565,330 NCBI Rnor6.0 Rnor_5.0 10 63,449,042 - 63,449,208 UniSTS Rnor5.0 RGSC_v3.4 10 67,760,753 - 67,760,919 UniSTS RGSC3.4 Celera 10 60,277,547 - 60,277,713 UniSTS Cytogenetic Map 10 q26 UniSTS
d10mgh6
Rat Assembly Chr Position (strand) Source JBrowse Rnor_5.0 10 63,366,082 - 63,366,219 UniSTS Rnor5.0 RGSC_v3.4 10 67,677,924 - 67,678,061 UniSTS RGSC3.4 Cytogenetic Map 10 q26 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000080703 ⟹ ENSRNOP00000068811
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 61,262,516 - 61,376,496 (-) Ensembl Rnor_6.0 Ensembl 10 64,567,466 - 64,657,089 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000084670 ⟹ ENSRNOP00000071246
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 61,264,810 - 61,339,976 (-) Ensembl Rnor_6.0 Ensembl 10 64,567,268 - 64,642,292 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000098977 ⟹ ENSRNOP00000085893
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 61,262,516 - 61,406,014 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000105253 ⟹ ENSRNOP00000090388
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 61,262,516 - 61,313,583 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000109843 ⟹ ENSRNOP00000085287
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 61,262,516 - 61,461,505 (-) Ensembl
RefSeq Acc Id:
NM_001105814 ⟹ NP_001099284
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 61,760,743 - 61,903,937 (-) NCBI mRatBN7.2 10 61,262,516 - 61,405,721 (-) NCBI Rnor_6.0 10 64,565,121 - 64,657,079 (-) NCBI Rnor_5.0 10 63,250,866 - 63,449,251 (+) NCBI RGSC_v3.4 10 67,617,776 - 67,760,961 (+) RGD Celera 10 60,277,504 - 60,420,210 (-) NCBI
Sequence:
TATCTGACCAAGGAGCCTCTGCCGCACGGAGCCGCGGGCATGGAGCCGCTTAGCCACCGGGGCCTGCCGCGCCTCTCTTGGATCGACACCCTCTACAGCAACTTCAGCTACGGTGCAGAGGACTACGA
hide sequence
RefSeq Acc Id:
XM_039085523 ⟹ XP_038941451
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 61,760,743 - 61,959,526 (-) NCBI mRatBN7.2 10 61,262,516 - 61,461,331 (-) NCBI
RefSeq Acc Id:
XM_039085524 ⟹ XP_038941452
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 61,760,743 - 61,958,441 (-) NCBI mRatBN7.2 10 61,264,726 - 61,460,247 (-) NCBI
RefSeq Acc Id:
XM_039085527 ⟹ XP_038941455
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 61,760,743 - 61,910,652 (-) NCBI mRatBN7.2 10 61,264,726 - 61,412,400 (-) NCBI
RefSeq Acc Id:
XM_039085528 ⟹ XP_038941456
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 61,760,743 - 61,957,513 (-) NCBI mRatBN7.2 10 61,264,726 - 61,459,311 (-) NCBI
RefSeq Acc Id:
XM_039085529 ⟹ XP_038941457
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 61,760,743 - 61,838,920 (-) NCBI mRatBN7.2 10 61,264,861 - 61,339,626 (-) NCBI
RefSeq Acc Id:
XM_039085530 ⟹ XP_038941458
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 61,760,743 - 61,910,627 (-) NCBI mRatBN7.2 10 61,264,861 - 61,412,343 (-) NCBI
RefSeq Acc Id:
XM_039085531 ⟹ XP_038941459
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 61,760,743 - 61,957,511 (-) NCBI mRatBN7.2 10 61,264,861 - 61,459,311 (-) NCBI
RefSeq Acc Id:
XM_039085532 ⟹ XP_038941460
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 61,760,743 - 61,812,110 (-) NCBI mRatBN7.2 10 61,264,861 - 61,313,879 (-) NCBI
RefSeq Acc Id:
XM_039085533 ⟹ XP_038941461
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 61,760,743 - 61,789,509 (-) NCBI mRatBN7.2 10 61,264,861 - 61,283,114 (-) NCBI
RefSeq Acc Id:
NP_001099284 ⟸ NM_001105814
- UniProtKB:
A0A0G2JTR4 (UniProtKB/Swiss-Prot), A6HGV7 (UniProtKB/TrEMBL), A0A4X0W8E9 (UniProtKB/TrEMBL)
- Sequence:
MEPLSHRGLPRLSWIDTLYSNFSYGAEDYDAEGHEEQKGPPEGSETMPYIDESPTMSPQLSARSQGGGESISPTPPEGLAPGVEAGKGLEMRKLVLSGFLASEEIYINQLEALLLPMKPLKATATTSQ
hide sequence
Ensembl Acc Id:
ENSRNOP00000068811 ⟸ ENSRNOT00000080703
Ensembl Acc Id:
ENSRNOP00000071246 ⟸ ENSRNOT00000084670
RefSeq Acc Id:
XP_038941451 ⟸ XM_039085523
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6A3Q6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038941452 ⟸ XM_039085524
- Peptide Label:
isoform X2
- UniProtKB:
A0A4X0W8E9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038941456 ⟸ XM_039085528
- Peptide Label:
isoform X3
- UniProtKB:
A0A8I6A171 (UniProtKB/TrEMBL), A0A4X0W8E9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038941455 ⟸ XM_039085527
- Peptide Label:
isoform X3
- UniProtKB:
A0A8I6A171 (UniProtKB/TrEMBL), A0A4X0W8E9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038941459 ⟸ XM_039085531
- Peptide Label:
isoform X5
- UniProtKB:
A0A4X0W8E9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038941458 ⟸ XM_039085530
- Peptide Label:
isoform X5
- UniProtKB:
A0A4X0W8E9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038941457 ⟸ XM_039085529
- Peptide Label:
isoform X4
- UniProtKB:
A0A0G2JZZ7 (UniProtKB/TrEMBL), A0A4X0W8E9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038941460 ⟸ XM_039085532
- Peptide Label:
isoform X6
- UniProtKB:
A0A8I6GI56 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038941461 ⟸ XM_039085533
- Peptide Label:
isoform X7
Ensembl Acc Id:
ENSRNOP00000085893 ⟸ ENSRNOT00000098977
Ensembl Acc Id:
ENSRNOP00000090388 ⟸ ENSRNOT00000105253
Ensembl Acc Id:
ENSRNOP00000085287 ⟸ ENSRNOT00000109843
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2021-03-09
Abr
ABR activator of RhoGEF and GTPase
LOC103693389
breakpoint cluster region protein-like
Data merged from RGD:9174117
737654 PROVISIONAL
2019-03-25
Abr
ABR activator of RhoGEF and GTPase
Abr
ABR, RhoGEF and GTPase activating protein
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2018-02-23
Abr
ABR, RhoGEF and GTPase activating protein
Abr
active BCR-related
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2015-07-29
LOC103693389
breakpoint cluster region protein-like
LOC687983
similar to Breakpoint cluster region protein
Data merged from RGD:1594868
737654 PROVISIONAL
2014-08-25
LOC103693389
breakpoint cluster region protein-like
Symbol and Name status set to provisional
70820 PROVISIONAL
2012-07-13
Abr
active BCR-related
Abr
active BCR-related gene
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Abr
active BCR-related gene
Abr_predicted
active BCR-related gene (predicted)
'predicted' is removed
2292626 APPROVED
2006-11-20
LOC687983
similar to Breakpoint cluster region protein
Symbol and Name status set to provisional
70820 PROVISIONAL
2005-01-12
Abr_predicted
active BCR-related gene (predicted)
Symbol and Name status set to approved
70820 APPROVED
