Symbol:
Cyfip2
Name:
cytoplasmic FMR1 interacting protein 2
RGD ID:
1305048
Description:
Predicted to enable small GTPase binding activity. Predicted to be involved in several processes, including neuron projection morphogenesis; positive regulation of neurotrophin TRK receptor signaling pathway; and regulation of postsynapse assembly. Predicted to be located in perinuclear region of cytoplasm. Predicted to be part of SCAR complex. Predicted to be active in neuron projection and synapse. Human ortholog(s) of this gene implicated in developmental and epileptic encephalopathy 65. Orthologous to human CYFIP2 (cytoplasmic FMR1 interacting protein 2); PARTICIPATES IN E-cadherin signaling pathway; platelet-derived growth factor signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene; 3,3',4,4',5-pentachlorobiphenyl.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC303073
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 31,122,653 - 31,242,440 (-) NCBI GRCr8 mRatBN7.2 10 30,621,318 - 30,741,113 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 30,621,318 - 30,741,113 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 35,348,673 - 35,468,277 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 3,887,117 - 4,006,729 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 30,323,472 - 30,442,925 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 31,278,746 - 31,419,235 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 31,278,746 - 31,419,235 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 31,097,979 - 31,198,028 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 31,321,000 - 31,443,480 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 31,324,310 - 31,444,535 (-) NCBI Celera 10 30,074,331 - 30,193,168 (-) NCBI Celera Cytogenetic Map 10 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Cyfip2 Rat (-)-alpha-phellandrene increases expression ISO CYFIP2 (Homo sapiens) 6480464 alpha phellandrene results in increased expression of CYFIP2 mRNA CTD PMID:25075043 Cyfip2 Rat 1,1-dichloroethene decreases expression ISO Cyfip2 (Mus musculus) 6480464 vinylidene chloride results in decreased expression of CYFIP2 mRNA CTD PMID:26682919 Cyfip2 Rat 1,2-dimethylhydrazine increases expression ISO Cyfip2 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of CYFIP2 mRNA CTD PMID:22206623 Cyfip2 Rat 17beta-estradiol multiple interactions ISO CYFIP2 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in decreased expression of CYFIP2 mRNA and [Estradiol co-treated with TGFB1 protein] results in decreased expression of CYFIP2 mRNA CTD PMID:20660070 and PMID:30165855 Cyfip2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Cyfip2 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin binds to AHR protein] which results in increased expression of CYFIP2 mRNA more ... CTD PMID:16214954 more ... Cyfip2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of CYFIP2 mRNA CTD PMID:34747641 Cyfip2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Cyfip2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of CYFIP2 mRNA CTD PMID:19759094 more ... Cyfip2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Cyfip2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of CYFIP2 mRNA CTD PMID:26377647 Cyfip2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of CYFIP2 mRNA CTD PMID:20959002 more ... Cyfip2 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of CYFIP2 mRNA CTD PMID:21346803 Cyfip2 Rat 2-butoxyethanol decreases expression ISO Cyfip2 (Mus musculus) 6480464 n-butoxyethanol results in decreased expression of CYFIP2 mRNA CTD PMID:19812364 Cyfip2 Rat 2-methylcholine affects expression ISO CYFIP2 (Homo sapiens) 6480464 beta-methylcholine affects the expression of CYFIP2 mRNA CTD PMID:21179406 Cyfip2 Rat 3,3',4,4',5-pentachlorobiphenyl increases expression EXP 6480464 3 more ... CTD PMID:20959002 Cyfip2 Rat 3-chloropropane-1,2-diol decreases expression EXP 6480464 alpha-Chlorohydrin results in decreased expression of CYFIP2 mRNA CTD PMID:28522335 Cyfip2 Rat 5-fluorouracil affects response to substance ISO CYFIP2 (Homo sapiens) 6480464 CYFIP2 protein affects the susceptibility to Fluorouracil CTD PMID:16217747 Cyfip2 Rat 5-fluorouracil multiple interactions ISO CYFIP2 (Homo sapiens) 6480464 TP53 protein affects the reaction [Fluorouracil results in increased expression of CYFIP2 mRNA] and TP53 protein promotes the reaction [Fluorouracil results in increased expression of CYFIP2 mRNA] CTD PMID:15016801 and PMID:17982676 Cyfip2 Rat 5-fluorouracil increases expression ISO CYFIP2 (Homo sapiens) 6480464 Fluorouracil results in increased expression of CYFIP2 mRNA CTD PMID:17039268 and PMID:17982676 Cyfip2 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of CYFIP2 mRNA CTD PMID:24780913 Cyfip2 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of CYFIP2 mRNA CTD PMID:31881176 Cyfip2 Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of CYFIP2 mRNA CTD PMID:28959563 Cyfip2 Rat acrylamide decreases expression ISO Cyfip2 (Mus musculus) 6480464 Acrylamide results in decreased expression of CYFIP2 mRNA CTD PMID:29261810 Cyfip2 Rat actinomycin D multiple interactions ISO CYFIP2 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of CYFIP2 protein CTD PMID:38460933 Cyfip2 Rat aflatoxin B1 affects expression ISO CYFIP2 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of CYFIP2 protein CTD PMID:20106945 Cyfip2 Rat aflatoxin B1 increases methylation ISO CYFIP2 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of CYFIP2 gene and Aflatoxin B1 results in increased methylation of CYFIP2 intron CTD PMID:27153756 and PMID:30157460 Cyfip2 Rat aflatoxin B1 increases expression ISO CYFIP2 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of CYFIP2 mRNA CTD PMID:21632981 and PMID:21641981 Cyfip2 Rat Aflatoxin B2 alpha decreases methylation ISO CYFIP2 (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of CYFIP2 intron CTD PMID:30157460 Cyfip2 Rat all-trans-retinoic acid multiple interactions ISO CYFIP2 (Homo sapiens) 6480464 [Tretinoin co-treated with arsenic trioxide] results in increased expression of CYFIP2 mRNA CTD PMID:15894607 Cyfip2 Rat all-trans-retinoic acid increases expression ISO CYFIP2 (Homo sapiens) 6480464 Tretinoin results in increased expression of CYFIP2 mRNA CTD PMID:15894607 more ... Cyfip2 Rat alpha-phellandrene increases expression ISO CYFIP2 (Homo sapiens) 6480464 alpha phellandrene results in increased expression of CYFIP2 mRNA CTD PMID:25075043 Cyfip2 Rat alpha-Zearalanol increases expression EXP 6480464 Zeranol results in increased expression of CYFIP2 mRNA CTD PMID:35163327 Cyfip2 Rat Ampullosporin multiple interactions EXP 6480464 [ampullosporin co-treated with Ketamine] results in decreased expression of CYFIP2 mRNA CTD PMID:16635253 Cyfip2 Rat antirheumatic drug decreases expression ISO CYFIP2 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of CYFIP2 mRNA CTD PMID:24449571 Cyfip2 Rat aristolochic acid A decreases expression ISO CYFIP2 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of CYFIP2 mRNA CTD PMID:33212167 Cyfip2 Rat Aroclor 1254 increases expression ISO Cyfip2 (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in increased expression of CYFIP2 mRNA CTD PMID:25270620 Cyfip2 Rat arsane multiple interactions ISO CYFIP2 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of CYFIP2 mRNA CTD PMID:32525701 Cyfip2 Rat arsenic atom multiple interactions ISO CYFIP2 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of CYFIP2 mRNA CTD PMID:32525701 Cyfip2 Rat arsenous acid multiple interactions ISO CYFIP2 (Homo sapiens) 6480464 [Tretinoin co-treated with Arsenic Trioxide] results in increased expression of CYFIP2 mRNA CTD PMID:15894607 Cyfip2 Rat atrazine decreases expression ISO CYFIP2 (Homo sapiens) 6480464 Atrazine results in decreased expression of CYFIP2 mRNA CTD PMID:22378314 Cyfip2 Rat Azoxymethane multiple interactions ISO Cyfip2 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of CYFIP2 mRNA CTD PMID:29950665 Cyfip2 Rat benzo[a]pyrene increases expression ISO CYFIP2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of CYFIP2 mRNA CTD PMID:20106945 more ... Cyfip2 Rat benzo[a]pyrene decreases methylation ISO CYFIP2 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of CYFIP2 exon CTD PMID:27901495 Cyfip2 Rat benzo[a]pyrene affects methylation ISO CYFIP2 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of CYFIP2 5' UTR and Benzo(a)pyrene affects the methylation of CYFIP2 promoter CTD PMID:27901495 Cyfip2 Rat benzo[a]pyrene increases expression ISO Cyfip2 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of CYFIP2 mRNA CTD PMID:19770486 more ... Cyfip2 Rat benzo[a]pyrene diol epoxide I increases expression ISO CYFIP2 (Homo sapiens) 6480464 7 more ... CTD PMID:20382639 Cyfip2 Rat benzo[e]pyrene affects methylation ISO CYFIP2 (Homo sapiens) 6480464 benzo(e)pyrene affects the methylation of CYFIP2 intron CTD PMID:30157460 Cyfip2 Rat beta-lapachone decreases expression ISO CYFIP2 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of CYFIP2 mRNA CTD PMID:38218311 Cyfip2 Rat beta-naphthoflavone decreases expression ISO CYFIP2 (Homo sapiens) 6480464 beta-Naphthoflavone results in decreased expression of CYFIP2 mRNA CTD PMID:32858204 Cyfip2 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of CYFIP2 mRNA CTD PMID:25181051 Cyfip2 Rat bisphenol A decreases methylation ISO CYFIP2 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of CYFIP2 gene CTD PMID:31601247 Cyfip2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of CYFIP2 mRNA CTD PMID:32145629 Cyfip2 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of CYFIP2 gene CTD PMID:28505145 Cyfip2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CYFIP2 mRNA and bisphenol A results in decreased expression of CYFIP2 protein CTD PMID:24552547 and PMID:35192832 Cyfip2 Rat buta-1,3-diene decreases expression ISO Cyfip2 (Mus musculus) 6480464 1 and 3-butadiene results in decreased expression of CYFIP2 mRNA CTD PMID:29038090 Cyfip2 Rat cadmium dichloride decreases expression ISO CYFIP2 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of CYFIP2 mRNA CTD PMID:38568856 Cyfip2 Rat carbamazepine affects expression ISO CYFIP2 (Homo sapiens) 6480464 Carbamazepine affects the expression of CYFIP2 mRNA CTD PMID:25979313 Cyfip2 Rat carbon nanotube decreases expression ISO Cyfip2 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Cyfip2 Rat CGP 52608 multiple interactions ISO CYFIP2 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to CYFIP2 gene] CTD PMID:28238834 Cyfip2 Rat chlordecone decreases expression ISO Cyfip2 (Mus musculus) 6480464 Chlordecone results in decreased expression of CYFIP2 mRNA CTD PMID:33711761 Cyfip2 Rat choline multiple interactions ISO Cyfip2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of CYFIP2 mRNA CTD PMID:20938992 Cyfip2 Rat cisplatin multiple interactions ISO CYFIP2 (Homo sapiens) 6480464 [Piroxicam co-treated with Cisplatin] results in decreased expression of CYFIP2 mRNA CTD PMID:21858171 Cyfip2 Rat cisplatin increases expression ISO CYFIP2 (Homo sapiens) 6480464 Cisplatin results in increased expression of CYFIP2 mRNA CTD PMID:27392435 Cyfip2 Rat cisplatin decreases expression ISO CYFIP2 (Homo sapiens) 6480464 Cisplatin results in decreased expression of CYFIP2 mRNA CTD PMID:27594783 Cyfip2 Rat cobalt dichloride decreases expression ISO CYFIP2 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of CYFIP2 mRNA CTD PMID:19320972 Cyfip2 Rat copper(II) chloride decreases expression ISO CYFIP2 (Homo sapiens) 6480464 cupric chloride results in decreased expression of CYFIP2 mRNA CTD PMID:17211630 and PMID:38568856 Cyfip2 Rat coumestrol decreases expression ISO CYFIP2 (Homo sapiens) 6480464 Coumestrol results in decreased expression of CYFIP2 mRNA CTD PMID:19167446 Cyfip2 Rat cyclosporin A increases expression ISO CYFIP2 (Homo sapiens) 6480464 Cyclosporine results in increased expression of CYFIP2 mRNA CTD PMID:19159671 and PMID:22147139 Cyfip2 Rat cyclosporin A decreases expression ISO CYFIP2 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of CYFIP2 mRNA CTD PMID:25562108 and PMID:27989131 Cyfip2 Rat DDE decreases expression ISO CYFIP2 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of CYFIP2 mRNA CTD PMID:38568856 Cyfip2 Rat dextran sulfate multiple interactions ISO Cyfip2 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of CYFIP2 mRNA CTD PMID:29950665 Cyfip2 Rat diarsenic trioxide multiple interactions ISO CYFIP2 (Homo sapiens) 6480464 [Tretinoin co-treated with Arsenic Trioxide] results in increased expression of CYFIP2 mRNA CTD PMID:15894607 Cyfip2 Rat dibenzofurans increases expression ISO Cyfip2 (Mus musculus) 6480464 Dibenzofurans results in increased expression of CYFIP2 mRNA CTD PMID:34254344 Cyfip2 Rat dimethylarsinic acid decreases expression EXP 6480464 Cacodylic Acid results in decreased expression of CYFIP2 mRNA CTD PMID:37567419 Cyfip2 Rat dorsomorphin multiple interactions ISO CYFIP2 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of CYFIP2 mRNA CTD PMID:27188386 Cyfip2 Rat doxorubicin increases expression ISO CYFIP2 (Homo sapiens) 6480464 Doxorubicin results in increased expression of CYFIP2 mRNA CTD PMID:29803840 Cyfip2 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of CYFIP2 mRNA CTD PMID:29391264 Cyfip2 Rat epoxiconazole decreases expression ISO Cyfip2 (Mus musculus) 6480464 epoxiconazole results in decreased expression of CYFIP2 mRNA CTD PMID:35436446 Cyfip2 Rat ethanol multiple interactions ISO Cyfip2 (Mus musculus) 6480464 Ethanol affects the expression of and affects the splicing of CYFIP2 mRNA CTD PMID:30319688 Cyfip2 Rat ethyl methanesulfonate increases expression ISO CYFIP2 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased expression of CYFIP2 mRNA CTD PMID:23649840 Cyfip2 Rat folic acid multiple interactions ISO Cyfip2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of CYFIP2 mRNA CTD PMID:20938992 Cyfip2 Rat formaldehyde increases expression ISO CYFIP2 (Homo sapiens) 6480464 Formaldehyde results in increased expression of CYFIP2 mRNA CTD PMID:23649840 Cyfip2 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of CYFIP2 mRNA CTD PMID:22061828 Cyfip2 Rat hydralazine multiple interactions ISO CYFIP2 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of CYFIP2 mRNA CTD PMID:17183730 Cyfip2 Rat indole-3-methanol multiple interactions EXP 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine] results in increased expression of CYFIP2 mRNA CTD PMID:22129741 Cyfip2 Rat ivermectin decreases expression ISO CYFIP2 (Homo sapiens) 6480464 Ivermectin results in decreased expression of CYFIP2 protein CTD PMID:32959892 Cyfip2 Rat ketamine multiple interactions EXP 6480464 [ampullosporin co-treated with Ketamine] results in decreased expression of CYFIP2 mRNA CTD PMID:16635253 Cyfip2 Rat L-methionine multiple interactions ISO Cyfip2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of CYFIP2 mRNA CTD PMID:20938992 Cyfip2 Rat lead diacetate decreases expression ISO CYFIP2 (Homo sapiens) 6480464 lead acetate results in decreased expression of CYFIP2 mRNA CTD PMID:38568856 Cyfip2 Rat leflunomide increases expression EXP 6480464 leflunomide results in increased expression of CYFIP2 mRNA CTD PMID:24136188 Cyfip2 Rat methapyrilene affects methylation ISO CYFIP2 (Homo sapiens) 6480464 Methapyrilene affects the methylation of CYFIP2 intron CTD PMID:30157460 Cyfip2 Rat methyl methanesulfonate increases expression ISO CYFIP2 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of CYFIP2 mRNA CTD PMID:23649840 Cyfip2 Rat methylmercury chloride decreases expression ISO CYFIP2 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of CYFIP2 mRNA CTD PMID:28001369 Cyfip2 Rat methylmercury chloride decreases expression ISO Cyfip2 (Mus musculus) 6480464 methylmercuric chloride results in decreased expression of CYFIP2 mRNA CTD PMID:29261810 Cyfip2 Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of CYFIP2 gene CTD PMID:33148267 Cyfip2 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine] results in increased expression of CYFIP2 mRNA CTD PMID:22129741 Cyfip2 Rat nickel atom increases expression ISO CYFIP2 (Homo sapiens) 6480464 Nickel results in increased expression of CYFIP2 mRNA CTD PMID:24768652 and PMID:25583101 Cyfip2 Rat Nutlin-3 increases expression ISO CYFIP2 (Homo sapiens) 6480464 nutlin 3 results in increased expression of CYFIP2 mRNA CTD PMID:38460933 Cyfip2 Rat Nutlin-3 multiple interactions ISO CYFIP2 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of CYFIP2 protein CTD PMID:38460933 Cyfip2 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of CYFIP2 mRNA CTD PMID:25729387 Cyfip2 Rat paracetamol increases expression ISO CYFIP2 (Homo sapiens) 6480464 Acetaminophen results in increased expression of CYFIP2 mRNA CTD PMID:22230336 Cyfip2 Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of CYFIP2 gene CTD PMID:33148267 Cyfip2 Rat phenobarbital increases expression ISO Cyfip2 (Mus musculus) 6480464 Phenobarbital results in increased expression of CYFIP2 mRNA CTD PMID:19482888 Cyfip2 Rat pirinixic acid multiple interactions ISO CYFIP2 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of CYFIP2 mRNA CTD PMID:19710929 Cyfip2 Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of CYFIP2 mRNA CTD PMID:19162173 Cyfip2 Rat pirinixic acid increases expression ISO Cyfip2 (Mus musculus) 6480464 pirinixic acid results in increased expression of CYFIP2 mRNA CTD PMID:20813756 Cyfip2 Rat piroxicam multiple interactions ISO CYFIP2 (Homo sapiens) 6480464 [Piroxicam co-treated with Cisplatin] results in decreased expression of CYFIP2 mRNA CTD PMID:21858171 Cyfip2 Rat poly(I:C) multiple interactions EXP 6480464 [Poly I-C co-treated with HU 211] results in decreased expression of CYFIP2 mRNA CTD PMID:26923065 Cyfip2 Rat potassium chromate increases expression ISO CYFIP2 (Homo sapiens) 6480464 potassium chromate(VI) results in increased expression of CYFIP2 mRNA CTD PMID:22714537 Cyfip2 Rat progesterone multiple interactions ISO CYFIP2 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in decreased expression of CYFIP2 mRNA CTD PMID:20660070 Cyfip2 Rat progesterone decreases expression ISO CYFIP2 (Homo sapiens) 6480464 Progesterone results in decreased expression of CYFIP2 mRNA CTD PMID:20864642 Cyfip2 Rat propanal increases expression ISO CYFIP2 (Homo sapiens) 6480464 propionaldehyde results in increased expression of CYFIP2 mRNA CTD PMID:26079696 Cyfip2 Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of CYFIP2 mRNA CTD PMID:28374803 Cyfip2 Rat SB 431542 multiple interactions ISO CYFIP2 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of CYFIP2 mRNA CTD PMID:27188386 Cyfip2 Rat silicon dioxide increases expression ISO Cyfip2 (Mus musculus) 6480464 Silicon Dioxide results in increased expression of CYFIP2 mRNA CTD PMID:29203145 Cyfip2 Rat sodium arsenate multiple interactions ISO CYFIP2 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of CYFIP2 mRNA CTD PMID:32525701 Cyfip2 Rat sodium arsenite decreases expression ISO CYFIP2 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of CYFIP2 mRNA and sodium arsenite results in decreased expression of CYFIP2 protein CTD PMID:30528433 and PMID:38568856 Cyfip2 Rat sulforaphane increases expression ISO Cyfip2 (Mus musculus) 6480464 sulforaphane results in increased expression of CYFIP2 mRNA CTD PMID:30529165 Cyfip2 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of CYFIP2 mRNA CTD PMID:23411599 and PMID:34492290 Cyfip2 Rat thiram decreases expression ISO CYFIP2 (Homo sapiens) 6480464 Thiram results in decreased expression of CYFIP2 mRNA CTD PMID:38568856 Cyfip2 Rat titanium dioxide increases expression EXP 6480464 titanium dioxide results in increased expression of CYFIP2 mRNA CTD PMID:30012374 Cyfip2 Rat titanium dioxide multiple interactions ISO Cyfip2 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of CYFIP2 mRNA CTD PMID:29950665 Cyfip2 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of CYFIP2 mRNA CTD PMID:25729387 Cyfip2 Rat trichostatin A decreases expression ISO CYFIP2 (Homo sapiens) 6480464 trichostatin A results in decreased expression of CYFIP2 mRNA CTD PMID:26272509 Cyfip2 Rat trichostatin A multiple interactions ISO CYFIP2 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of CYFIP2 mRNA CTD PMID:27188386 Cyfip2 Rat trimellitic anhydride increases expression ISO Cyfip2 (Mus musculus) 6480464 trimellitic anhydride results in increased expression of CYFIP2 mRNA CTD PMID:19042947 Cyfip2 Rat triphenyl phosphate decreases expression EXP 6480464 triphenyl phosphate results in decreased expression of CYFIP2 mRNA CTD PMID:30589522 Cyfip2 Rat triphenyl phosphate affects expression ISO CYFIP2 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of CYFIP2 mRNA CTD PMID:37042841 Cyfip2 Rat triptonide increases expression ISO Cyfip2 (Mus musculus) 6480464 triptonide results in increased expression of CYFIP2 mRNA CTD PMID:33045310 Cyfip2 Rat trovafloxacin decreases expression ISO Cyfip2 (Mus musculus) 6480464 trovafloxacin results in decreased expression of CYFIP2 mRNA CTD PMID:35537566 Cyfip2 Rat tungsten decreases expression ISO Cyfip2 (Mus musculus) 6480464 Tungsten results in decreased expression of CYFIP2 mRNA CTD PMID:30912803 Cyfip2 Rat valproic acid increases methylation ISO CYFIP2 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of CYFIP2 gene CTD PMID:29154799 Cyfip2 Rat valproic acid increases expression ISO CYFIP2 (Homo sapiens) 6480464 Valproic Acid results in increased expression of CYFIP2 mRNA CTD PMID:19101580 more ... Cyfip2 Rat valproic acid affects expression ISO CYFIP2 (Homo sapiens) 6480464 Valproic Acid affects the expression of CYFIP2 mRNA CTD PMID:25979313 Cyfip2 Rat valproic acid increases expression ISO Cyfip2 (Mus musculus) 6480464 Valproic Acid results in increased expression of CYFIP2 mRNA CTD PMID:21427059 Cyfip2 Rat valproic acid multiple interactions ISO CYFIP2 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of CYFIP2 mRNA CTD PMID:17183730 Cyfip2 Rat vancomycin increases expression ISO Cyfip2 (Mus musculus) 6480464 Vancomycin results in increased expression of CYFIP2 mRNA CTD PMID:18930951 Cyfip2 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of CYFIP2 mRNA CTD PMID:23869203 Cyfip2 Rat zoledronic acid decreases expression ISO CYFIP2 (Homo sapiens) 6480464 zoledronic acid results in decreased expression of CYFIP2 mRNA CTD PMID:24714768
Imported Annotations - PID (archival)
(-)-alpha-phellandrene (ISO) 1,1-dichloroethene (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,6-dinitrotoluene (EXP) 2-butoxyethanol (ISO) 2-methylcholine (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3-chloropropane-1,2-diol (EXP) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) acrylamide (EXP,ISO) actinomycin D (ISO) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) all-trans-retinoic acid (ISO) alpha-phellandrene (ISO) alpha-Zearalanol (EXP) Ampullosporin (EXP) antirheumatic drug (ISO) aristolochic acid A (ISO) Aroclor 1254 (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) atrazine (ISO) Azoxymethane (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) benzo[e]pyrene (ISO) beta-lapachone (ISO) beta-naphthoflavone (ISO) bisphenol A (EXP,ISO) buta-1,3-diene (ISO) cadmium dichloride (ISO) carbamazepine (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chlordecone (ISO) choline (ISO) cisplatin (ISO) cobalt dichloride (ISO) copper(II) chloride (ISO) coumestrol (ISO) cyclosporin A (ISO) DDE (ISO) dextran sulfate (ISO) diarsenic trioxide (ISO) dibenzofurans (ISO) dimethylarsinic acid (EXP) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (EXP) epoxiconazole (ISO) ethanol (ISO) ethyl methanesulfonate (ISO) folic acid (ISO) formaldehyde (ISO) gentamycin (EXP) hydralazine (ISO) indole-3-methanol (EXP) ivermectin (ISO) ketamine (EXP) L-methionine (ISO) lead diacetate (ISO) leflunomide (EXP) methapyrilene (ISO) methyl methanesulfonate (ISO) methylmercury chloride (ISO) N,N-diethyl-m-toluamide (EXP) N-nitrosodiethylamine (EXP) nickel atom (ISO) Nutlin-3 (ISO) oxaliplatin (EXP) paracetamol (ISO) permethrin (EXP) phenobarbital (ISO) pirinixic acid (EXP,ISO) piroxicam (ISO) poly(I:C) (EXP) potassium chromate (ISO) progesterone (ISO) propanal (ISO) rotenone (EXP) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sulforaphane (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (EXP,ISO) topotecan (EXP) trichostatin A (ISO) trimellitic anhydride (ISO) triphenyl phosphate (EXP,ISO) triptonide (ISO) trovafloxacin (ISO) tungsten (ISO) valproic acid (ISO) vancomycin (ISO) vinclozolin (EXP) zoledronic acid (ISO)
Cyfip2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 31,122,653 - 31,242,440 (-) NCBI GRCr8 mRatBN7.2 10 30,621,318 - 30,741,113 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 30,621,318 - 30,741,113 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 35,348,673 - 35,468,277 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 3,887,117 - 4,006,729 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 30,323,472 - 30,442,925 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 31,278,746 - 31,419,235 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 31,278,746 - 31,419,235 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 31,097,979 - 31,198,028 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 31,321,000 - 31,443,480 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 31,324,310 - 31,444,535 (-) NCBI Celera 10 30,074,331 - 30,193,168 (-) NCBI Celera Cytogenetic Map 10 q21 NCBI
CYFIP2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 5 157,266,123 - 157,395,594 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 5 157,266,079 - 157,395,595 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 5 156,693,133 - 156,822,602 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 5 156,625,669 - 156,755,184 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 5 156,628,929 - 156,752,793 NCBI Celera 5 152,719,640 - 152,849,168 (+) NCBI Celera Cytogenetic Map 5 q33.3 NCBI HuRef 5 151,780,753 - 151,910,647 (+) NCBI HuRef CHM1_1 5 156,125,748 - 156,255,279 (+) NCBI CHM1_1 T2T-CHM13v2.0 5 157,785,054 - 157,914,553 (+) NCBI T2T-CHM13v2.0
Cyfip2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 46,084,676 - 46,203,686 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 46,084,677 - 46,203,686 (-) Ensembl GRCm39 Ensembl GRCm38 11 46,193,849 - 46,312,859 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 46,193,850 - 46,312,859 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 46,007,360 - 46,125,852 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 46,037,281 - 46,155,773 (-) NCBI MGSCv36 mm8 Celera 11 50,779,500 - 50,898,263 (-) NCBI Celera Cytogenetic Map 11 B1.1 NCBI cM Map 11 27.61 NCBI
Cyfip2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955408 11,462,837 - 11,588,378 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955408 11,483,891 - 11,586,628 (+) NCBI ChiLan1.0 ChiLan1.0
CYFIP2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 4 152,461,545 - 152,591,293 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 5 150,601,092 - 150,730,844 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 5 152,667,136 - 152,796,575 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 5 159,288,779 - 159,418,077 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 5 159,292,029 - 159,418,077 (+) Ensembl panpan1.1 panPan2
CYFIP2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 4 52,769,638 - 52,875,080 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 4 52,743,048 - 52,880,589 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 4 52,661,797 - 52,785,745 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 4 53,206,203 - 53,330,066 (-) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 4 53,032,652 - 53,138,139 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 4 53,139,468 - 53,263,349 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 4 53,656,324 - 53,780,306 (-) NCBI UU_Cfam_GSD_1.0
Cyfip2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 107,310,615 - 107,431,342 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936515 5,759,345 - 5,880,713 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936515 5,759,940 - 5,880,688 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CYFIP2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 16 65,852,588 - 66,001,559 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 16 65,852,584 - 66,001,576 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 16 71,707,184 - 71,865,915 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CYFIP2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 23 59,661,045 - 59,794,717 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 23 59,661,089 - 59,794,826 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666034 17,835,766 - 17,969,652 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Cyfip2
.
Predicted Target Of
Count of predictions: 339 Count of miRNA genes: 197 Interacting mature miRNAs: 244 Transcripts: ENSRNOT00000059496 Prediction methods: Miranda, Targetscan Result types: miRGate_prediction
9589136 Insul27 Insulin level QTL 27 10.46 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 10 11474010 56474010 Rat 631564 Apr3 Acute phase response QTL 3 3.9 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 10 15275955 60275955 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 631554 Bp133 Blood pressure QTL 133 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 743364 63851208 Rat 631557 Bp136 Blood pressure QTL 136 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 30632053 75632053 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1578761 Stresp21 Stress response QTL 21 3.3 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 6375746 51375746 Rat 2293680 Bss40 Bone structure and strength QTL 40 5.66 0.0001 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 10 1 35225947 Rat 2298544 Neuinf9 Neuroinflammation QTL 9 4.6 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 10 5801990 62146030 Rat 10401803 Kidm50 Kidney mass QTL 50 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 10 418344 45418344 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 1598852 Anxrr19 Anxiety related response QTL 19 5.07 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 10 18167841 63167841 Rat 1581497 Esta1 Estrogen-induced thymic atrophy QTL 1 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 21329805 61345413 Rat 2313095 Bss62 Bone structure and strength QTL 62 1.5 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 724527 Bp148 Blood pressure QTL 148 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 28453136 73453136 Rat 1331762 Rf40 Renal function QTL 40 3.873 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 10 29299504 64155584 Rat 2300171 Bmd58 Bone mineral density QTL 58 4.9 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 26944628 71944628 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2301967 Cm73 Cardiac mass QTL 73 4.55 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 10 14487011 89062041 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 2313104 Bss61 Bone structure and strength QTL 61 0.9 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 9590310 Scort19 Serum corticosterone level QTL 19 6.3 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 10402859 Bp381 Blood pressure QTL 381 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 6893352 Bw100 Body weight QTL 100 0.33 0.6 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 724556 Pur2 Proteinuria QTL 2 5.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 22427500 90627625 Rat 8662860 Vetf10 Vascular elastic tissue fragility QTL 10 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 10 6154182 73453136 Rat 2313066 Bss63 Bone structure and strength QTL 63 1.4 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 10 5387014 50387014 Rat 2313064 Bmd71 Bone mineral density QTL 71 0.9 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 10 5387014 50387014 Rat 70223 Bp57 Blood pressure QTL 57 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 1 80676123 Rat 1354587 Kidm21 Kidney mass QTL 21 3.3 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 10 15028513 60430477 Rat 6893350 Bw99 Body weight QTL 99 0.87 0.16 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 70224 Eae3 Experimental allergic encephalomyelitis QTL 3 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 10 26521957 61345413 Rat 2298480 Eau7 Experimental allergic uveoretinitis QTL 7 0.0049 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 10 27957626 34490668 Rat 2313081 Bss64 Bone structure and strength QTL 64 1.3 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 10 5387014 50387014 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 2313087 Bmd80 Bone mineral density QTL 80 3.2 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 10 19606483 64606483 Rat 634327 Hc4 Hypercalciuria QTL 4 2.4 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 10 1 38328221 Rat 631531 Iresp2 Immunoglobin response QTL2 6.3 blood immunoglobulin E amount (VT:0002492) serum immunoglobulin E level (CMO:0002101) 10 22918268 36400810 Rat 631532 Cm50 Cardiac mass QTL 50 6.6 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 10 17907113 51786432 Rat 7411611 Foco17 Food consumption QTL 17 18.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 1 42315980 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1600371 Mcs21 Mammary carcinoma susceptibility QTL 21 3 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 28875650 52200160 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 9590268 Scort13 Serum corticosterone level QTL 13 3.26 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 2292441 Bp308 Blood pressure QTL 308 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2313055 Bw96 Body weight QTL 96 3.6 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 10 19606483 64606483 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat
D10Mgh19
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 10 31,132,826 - 31,132,934 (+) Marker Load Pipeline mRatBN7.2 10 30,631,492 - 30,631,600 (+) MAPPER mRatBN7.2 Rnor_6.0 10 31,288,920 - 31,289,027 NCBI Rnor6.0 Rnor_5.0 10 31,108,153 - 31,108,260 UniSTS Rnor5.0 RGSC_v3.4 10 31,331,174 - 31,331,281 UniSTS RGSC3.4 RGSC_v3.4 10 31,331,173 - 31,331,281 RGD RGSC3.4 RGSC_v3.1 10 31,332,222 - 31,332,330 RGD Celera 10 30,084,505 - 30,084,605 UniSTS Cytogenetic Map 10 q21 UniSTS
RH144330
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 30,639,067 - 30,639,256 (+) MAPPER mRatBN7.2 Rnor_6.0 10 31,296,494 - 31,296,682 NCBI Rnor6.0 Rnor_5.0 10 31,115,727 - 31,115,915 UniSTS Rnor5.0 RGSC_v3.4 10 31,338,748 - 31,338,936 UniSTS RGSC3.4 Celera 10 30,092,072 - 30,092,260 UniSTS RH 3.4 Map 10 319.5 UniSTS Cytogenetic Map 10 q21 UniSTS
RH140277
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 30,621,441 - 30,621,661 (+) MAPPER mRatBN7.2 Rnor_6.0 10 31,278,870 - 31,279,089 NCBI Rnor6.0 Rnor_5.0 10 31,098,103 - 31,098,322 UniSTS Rnor5.0 RGSC_v3.4 10 31,321,124 - 31,321,343 UniSTS RGSC3.4 Celera 10 30,074,455 - 30,074,674 UniSTS RH 3.4 Map 10 340.7 UniSTS Cytogenetic Map 10 q21 UniSTS
21STS02
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 30,621,322 - 30,621,519 (+) MAPPER mRatBN7.2 Rnor_6.0 10 31,278,751 - 31,278,947 NCBI Rnor6.0 Rnor_5.0 10 31,097,984 - 31,098,180 UniSTS Rnor5.0 RGSC_v3.4 10 31,321,005 - 31,321,201 UniSTS RGSC3.4 Celera 10 30,074,336 - 30,074,532 UniSTS Cytogenetic Map 10 q21 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000059496 ⟹ ENSRNOP00000056255
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 30,621,318 - 30,741,113 (-) Ensembl Rnor_6.0 Ensembl 10 31,278,746 - 31,419,235 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000081280 ⟹ ENSRNOP00000068584
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 30,621,318 - 30,741,113 (-) Ensembl Rnor_6.0 Ensembl 10 31,278,764 - 31,359,699 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000119958 ⟹ ENSRNOP00000094378
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 30,621,318 - 30,722,683 (-) Ensembl
RefSeq Acc Id:
NM_001106996 ⟹ NP_001100466
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 31,122,653 - 31,242,440 (-) NCBI mRatBN7.2 10 30,621,318 - 30,741,113 (-) NCBI Rnor_6.0 10 31,278,746 - 31,419,235 (-) NCBI Rnor_5.0 10 31,097,979 - 31,198,028 (-) NCBI RGSC_v3.4 10 31,321,000 - 31,443,480 (-) RGD Celera 10 30,074,331 - 30,193,168 (-) RGD
Sequence:
TCCTGCGCCCCGGCGCGGGGCCCTGCGGTAGTCTCGGGTCCCTCCCCTGGACCTGTCGCTGAACCAGTGTGGGAGACAGACGCCGCAGCCATGACCACCCACGTCACTTTGGAAGATGCCCTGTCCAA
hide sequence
RefSeq Acc Id:
NP_001100466 ⟸ NM_001106996
- UniProtKB:
D3ZX82 (UniProtKB/TrEMBL), A6HDR1 (UniProtKB/TrEMBL)
- Sequence:
MSSTPWICTTTAPTMRSPSSKSSSCMTRSKQRQVNLCFDQFVYKLADQIFAYYKAMAGSVLLDKRFRAECKNYGVIIPYPPSNRYETLLKQRHVQLLGRSIDLNRLITQRISAAMYKSLDQAISRFES
hide sequence
Ensembl Acc Id:
ENSRNOP00000056255 ⟸ ENSRNOT00000059496
Ensembl Acc Id:
ENSRNOP00000068584 ⟸ ENSRNOT00000081280
Ensembl Acc Id:
ENSRNOP00000094378 ⟸ ENSRNOT00000119958
RGD ID: 13697124 Promoter ID: EPDNEW_R7649 Type: multiple initiation site Name: Cyfip2_1 Description: cytoplasmic FMR1 interacting protein 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 31,419,236 - 31,419,296 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Cyfip2
cytoplasmic FMR1 interacting protein 2
Cyfip2_predicted
cytoplasmic FMR1 interacting protein 2 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Cyfip2_predicted
cytoplasmic FMR1 interacting protein 2 (predicted)
Symbol and Name status set to approved
70820 APPROVED
