Symbol:
C1qtnf3
Name:
C1q and TNF related 3
RGD ID:
1305010
Description:
Predicted to enable identical protein binding activity. Predicted to be involved in several processes, including intracellular triglyceride homeostasis; negative regulation of non-canonical NF-kappaB signal transduction; and regulation of cytokine production. Predicted to act upstream of or within glucose homeostasis; negative regulation of gluconeogenesis; and positive regulation of intracellular signal transduction. Predicted to be located in extracellular space. Predicted to be part of protein-containing complex. Orthologous to human C1QTNF3 (C1q and TNF related 3); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
Adim; adiponectin m; C1q and tumor necrosis factor related protein 3; complement C1q tumor necrosis factor-related protein 3; LOC294806
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 61,644,225 - 61,666,640 (+) NCBI GRCr8 mRatBN7.2 2 59,917,099 - 59,939,519 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 59,917,188 - 59,939,433 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 67,026,247 - 67,048,653 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 65,147,754 - 65,170,160 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 60,149,133 - 60,171,540 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 60,920,160 - 60,942,586 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 60,920,257 - 60,942,500 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 83,741,856 - 83,764,282 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 60,303,261 - 60,325,510 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 60,231,385 - 60,253,774 (+) NCBI Celera 2 58,744,899 - 58,767,152 (-) NCBI Celera Cytogenetic Map 2 q16 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
C1qtnf3 Rat 1,2-dichloroethane increases expression ISO C1qtnf3 (Mus musculus) 6480464 ethylene dichloride results in increased expression of C1QTNF3 mRNA CTD PMID:28960355 C1qtnf3 Rat 1,2-dimethylhydrazine decreases expression ISO C1qtnf3 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of C1QTNF3 mRNA CTD PMID:22206623 C1qtnf3 Rat 17alpha-ethynylestradiol increases expression ISO C1qtnf3 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of C1QTNF3 mRNA CTD PMID:17942748 C1qtnf3 Rat 17beta-estradiol increases expression ISO C1qtnf3 (Mus musculus) 6480464 Estradiol results in increased expression of C1QTNF3 mRNA CTD PMID:19484750 C1qtnf3 Rat 17beta-estradiol decreases expression ISO C1QTNF3 (Homo sapiens) 6480464 Estradiol results in decreased expression of C1QTNF3 mRNA CTD PMID:31614463 C1qtnf3 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO C1QTNF3 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 C1qtnf3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO C1qtnf3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of C1QTNF3 mRNA CTD PMID:19933214 C1qtnf3 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of C1QTNF3 mRNA CTD PMID:32109520 C1qtnf3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of C1QTNF3 mRNA CTD PMID:22808131 C1qtnf3 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 C1qtnf3 Rat 2,4,6-tribromophenol decreases expression ISO C1QTNF3 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 C1qtnf3 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO C1QTNF3 (Homo sapiens) 6480464 tetrabromobisphenol A results in decreased expression of C1QTNF3 protein CTD PMID:31675489 C1qtnf3 Rat 4,4'-sulfonyldiphenol decreases methylation ISO C1qtnf3 (Mus musculus) 6480464 bisphenol S results in decreased methylation of C1QTNF3 exon and bisphenol S results in decreased methylation of C1QTNF3 promoter CTD PMID:33297965 C1qtnf3 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of C1QTNF3 mRNA CTD PMID:24780913 and PMID:30047161 C1qtnf3 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of C1QTNF3 mRNA CTD PMID:28959563 C1qtnf3 Rat aflatoxin B1 decreases expression ISO C1QTNF3 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of C1QTNF3 mRNA CTD PMID:27153756 C1qtnf3 Rat aldehydo-D-glucose decreases expression ISO C1qtnf3 (Mus musculus) 6480464 Glucose results in decreased expression of C1QTNF3 mRNA CTD PMID:31525975 C1qtnf3 Rat all-trans-retinoic acid increases expression ISO C1QTNF3 (Homo sapiens) 6480464 Tretinoin results in increased expression of C1QTNF3 mRNA CTD PMID:21934132 C1qtnf3 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of C1QTNF3 mRNA CTD PMID:35163327 C1qtnf3 Rat alpha-Zearalanol decreases expression EXP 6480464 Zeranol results in decreased expression of C1QTNF3 mRNA CTD PMID:35163327 C1qtnf3 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of C1QTNF3 mRNA CTD PMID:30047161 C1qtnf3 Rat beauvericin decreases expression ISO C1QTNF3 (Homo sapiens) 6480464 beauvericin results in decreased expression of C1QTNF3 mRNA CTD PMID:29203277 C1qtnf3 Rat benzo[a]pyrene multiple interactions ISO C1qtnf3 (Mus musculus) 6480464 AHR protein affects the reaction [Benzo(a)pyrene affects the expression of C1QTNF3 mRNA] CTD PMID:22228805 C1qtnf3 Rat benzo[a]pyrene decreases expression ISO C1QTNF3 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of C1QTNF3 mRNA CTD PMID:32234424 C1qtnf3 Rat benzo[a]pyrene increases methylation ISO C1qtnf3 (Mus musculus) 6480464 Benzo(a)pyrene results in increased methylation of C1QTNF3 3' UTR more ... CTD PMID:27901495 C1qtnf3 Rat benzo[a]pyrene increases methylation ISO C1QTNF3 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of C1QTNF3 promoter CTD PMID:27901495 C1qtnf3 Rat benzo[a]pyrene increases expression ISO C1qtnf3 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of C1QTNF3 mRNA CTD PMID:23735875 C1qtnf3 Rat benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of C1QTNF3 mRNA CTD PMID:21839799 C1qtnf3 Rat benzo[a]pyrene decreases expression ISO C1qtnf3 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of C1QTNF3 mRNA CTD PMID:22228805 C1qtnf3 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of C1QTNF3 mRNA CTD PMID:25181051 and PMID:38750585 C1qtnf3 Rat bisphenol A decreases expression ISO C1qtnf3 (Mus musculus) 6480464 bisphenol A results in decreased expression of C1QTNF3 mRNA CTD PMID:37105096 C1qtnf3 Rat bisphenol A decreases expression ISO C1QTNF3 (Homo sapiens) 6480464 bisphenol A results in decreased expression of C1QTNF3 protein CTD PMID:31675489 C1qtnf3 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of C1QTNF3 mRNA CTD PMID:33296240 C1qtnf3 Rat buta-1,3-diene decreases expression ISO C1qtnf3 (Mus musculus) 6480464 1 and 3-butadiene results in decreased expression of C1QTNF3 mRNA CTD PMID:29038090 C1qtnf3 Rat butanal decreases expression ISO C1QTNF3 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of C1QTNF3 mRNA CTD PMID:26079696 C1qtnf3 Rat cadmium atom multiple interactions ISO C1qtnf3 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of C1QTNF3 mRNA CTD PMID:37325564 C1qtnf3 Rat cadmium dichloride multiple interactions ISO C1qtnf3 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of C1QTNF3 mRNA CTD PMID:37325564 C1qtnf3 Rat copper(II) sulfate decreases expression ISO C1QTNF3 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of C1QTNF3 mRNA CTD PMID:19549813 C1qtnf3 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of C1QTNF3 mRNA CTD PMID:26577399 C1qtnf3 Rat D-glucose decreases expression ISO C1qtnf3 (Mus musculus) 6480464 Glucose results in decreased expression of C1QTNF3 mRNA CTD PMID:31525975 C1qtnf3 Rat decabromodiphenyl ether decreases expression ISO C1QTNF3 (Homo sapiens) 6480464 decabromobiphenyl ether results in decreased expression of C1QTNF3 protein CTD PMID:31675489 C1qtnf3 Rat dexamethasone multiple interactions EXP 6480464 Testosterone inhibits the reaction [Dexamethasone results in decreased expression of C1QTNF3 mRNA] CTD PMID:20032058 C1qtnf3 Rat dexamethasone decreases expression EXP 6480464 Dexamethasone results in decreased expression of C1QTNF3 mRNA CTD PMID:20032058 C1qtnf3 Rat dibutyl phthalate increases expression ISO C1qtnf3 (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of C1QTNF3 mRNA CTD PMID:21266533 C1qtnf3 Rat dimethylarsinic acid multiple interactions ISO C1qtnf3 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of C1QTNF3 mRNA CTD PMID:34876320 C1qtnf3 Rat dimethylarsinic acid decreases expression EXP 6480464 Cacodylic Acid results in decreased expression of C1QTNF3 mRNA CTD PMID:37567419 C1qtnf3 Rat dioxygen multiple interactions ISO C1qtnf3 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of C1QTNF3 mRNA CTD PMID:30529165 C1qtnf3 Rat diquat decreases expression ISO C1qtnf3 (Mus musculus) 6480464 Diquat results in decreased expression of C1QTNF3 mRNA CTD PMID:36851058 C1qtnf3 Rat folic acid increases expression ISO C1qtnf3 (Mus musculus) 6480464 Folic Acid results in increased expression of C1QTNF3 mRNA CTD PMID:25629700 C1qtnf3 Rat furan decreases expression EXP 6480464 furan results in decreased expression of C1QTNF3 mRNA CTD PMID:25539665 C1qtnf3 Rat genistein increases expression ISO C1qtnf3 (Mus musculus) 6480464 Genistein results in increased expression of C1QTNF3 mRNA CTD PMID:32186404 C1qtnf3 Rat glucose decreases expression ISO C1qtnf3 (Mus musculus) 6480464 Glucose results in decreased expression of C1QTNF3 mRNA CTD PMID:31525975 C1qtnf3 Rat glyphosate decreases expression EXP 6480464 Glyphosate results in decreased expression of C1QTNF3 mRNA CTD PMID:38314887 C1qtnf3 Rat GW 4064 increases expression ISO C1qtnf3 (Mus musculus) 6480464 GW 4064 results in increased expression of C1QTNF3 mRNA CTD PMID:26655953 C1qtnf3 Rat hydrazine decreases expression ISO C1qtnf3 (Mus musculus) 6480464 hydrazine results in decreased expression of C1QTNF3 mRNA CTD PMID:15282401 C1qtnf3 Rat hydrogen peroxide affects expression ISO C1QTNF3 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of C1QTNF3 mRNA CTD PMID:20044591 C1qtnf3 Rat inulin multiple interactions ISO C1qtnf3 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of C1QTNF3 mRNA CTD PMID:36331819 C1qtnf3 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of C1QTNF3 mRNA CTD PMID:30047161 C1qtnf3 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of C1QTNF3 gene CTD PMID:35440735 C1qtnf3 Rat methylarsonic acid multiple interactions ISO C1qtnf3 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of C1QTNF3 mRNA CTD PMID:34876320 C1qtnf3 Rat N-nitrosodiethylamine multiple interactions ISO C1qtnf3 (Mus musculus) 6480464 [Piperonyl Butoxide co-treated with Diethylnitrosamine] affects the methylation of C1QTNF3 gene CTD PMID:23968726 C1qtnf3 Rat nickel atom decreases expression ISO C1QTNF3 (Homo sapiens) 6480464 Nickel results in decreased expression of C1QTNF3 mRNA CTD PMID:24768652 and PMID:25583101 C1qtnf3 Rat okadaic acid decreases expression ISO C1QTNF3 (Homo sapiens) 6480464 Okadaic Acid results in decreased expression of C1QTNF3 mRNA CTD PMID:38832940 C1qtnf3 Rat ozone multiple interactions ISO C1qtnf3 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of C1QTNF3 mRNA CTD PMID:27106289 C1qtnf3 Rat paracetamol increases expression ISO C1QTNF3 (Homo sapiens) 6480464 Acetaminophen results in increased expression of C1QTNF3 mRNA CTD PMID:26690555 C1qtnf3 Rat pentanal decreases expression ISO C1QTNF3 (Homo sapiens) 6480464 pentanal results in decreased expression of C1QTNF3 mRNA CTD PMID:26079696 C1qtnf3 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO C1qtnf3 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of C1QTNF3 mRNA CTD PMID:36331819 C1qtnf3 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of C1QTNF3 mRNA CTD PMID:35163327 C1qtnf3 Rat PhIP decreases expression ISO C1QTNF3 (Homo sapiens) 6480464 2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in decreased expression of C1QTNF3 mRNA CTD PMID:20816883 C1qtnf3 Rat piperonyl butoxide multiple interactions ISO C1qtnf3 (Mus musculus) 6480464 [Piperonyl Butoxide co-treated with Diethylnitrosamine] affects the methylation of C1QTNF3 gene CTD PMID:23968726 C1qtnf3 Rat pirinixic acid increases expression ISO C1qtnf3 (Mus musculus) 6480464 pirinixic acid results in increased expression of C1QTNF3 mRNA CTD PMID:18301758 C1qtnf3 Rat sodium arsenate multiple interactions ISO C1qtnf3 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of C1QTNF3 mRNA CTD PMID:34876320 C1qtnf3 Rat sodium arsenite increases expression ISO C1QTNF3 (Homo sapiens) 6480464 sodium arsenite results in increased expression of C1QTNF3 mRNA CTD PMID:29301061 C1qtnf3 Rat sodium arsenite multiple interactions ISO C1qtnf3 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of C1QTNF3 mRNA CTD PMID:34876320 C1qtnf3 Rat sodium arsenite decreases expression ISO C1qtnf3 (Mus musculus) 6480464 sodium arsenite results in decreased expression of C1QTNF3 mRNA CTD PMID:37682722 C1qtnf3 Rat sodium arsenite decreases expression ISO C1QTNF3 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of C1QTNF3 mRNA CTD PMID:34032870 C1qtnf3 Rat sunitinib increases expression ISO C1QTNF3 (Homo sapiens) 6480464 Sunitinib results in increased expression of C1QTNF3 mRNA CTD PMID:31533062 C1qtnf3 Rat testosterone multiple interactions EXP 6480464 Testosterone inhibits the reaction [Dexamethasone results in decreased expression of C1QTNF3 mRNA] CTD PMID:20032058 C1qtnf3 Rat thimerosal decreases expression ISO C1QTNF3 (Homo sapiens) 6480464 Thimerosal results in decreased expression of C1QTNF3 mRNA CTD PMID:27188386 C1qtnf3 Rat triclosan increases expression ISO C1QTNF3 (Homo sapiens) 6480464 Triclosan results in increased expression of C1QTNF3 mRNA CTD PMID:30510588 C1qtnf3 Rat urethane decreases expression ISO C1QTNF3 (Homo sapiens) 6480464 Urethane results in decreased expression of C1QTNF3 mRNA CTD PMID:28818685 C1qtnf3 Rat valproic acid decreases expression ISO C1QTNF3 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of C1QTNF3 mRNA CTD PMID:29154799 C1qtnf3 Rat vancomycin increases expression ISO C1qtnf3 (Mus musculus) 6480464 Vancomycin results in increased expression of C1QTNF3 mRNA CTD PMID:18930951 C1qtnf3 Rat vorinostat decreases expression ISO C1QTNF3 (Homo sapiens) 6480464 vorinostat results in decreased expression of C1QTNF3 mRNA CTD PMID:27188386
1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4,6-tribromophenol (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) acrylamide (EXP) aflatoxin B1 (ISO) aldehydo-D-glucose (ISO) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) amitrole (EXP) beauvericin (ISO) benzo[a]pyrene (EXP,ISO) bisphenol A (EXP,ISO) buta-1,3-diene (ISO) butanal (ISO) cadmium atom (ISO) cadmium dichloride (ISO) copper(II) sulfate (ISO) Cuprizon (EXP) D-glucose (ISO) decabromodiphenyl ether (ISO) dexamethasone (EXP) dibutyl phthalate (ISO) dimethylarsinic acid (EXP,ISO) dioxygen (ISO) diquat (ISO) folic acid (ISO) furan (EXP) genistein (ISO) glucose (ISO) glyphosate (EXP) GW 4064 (ISO) hydrazine (ISO) hydrogen peroxide (ISO) inulin (ISO) methimazole (EXP) methoxychlor (EXP) methylarsonic acid (ISO) N-nitrosodiethylamine (ISO) nickel atom (ISO) okadaic acid (ISO) ozone (ISO) paracetamol (ISO) pentanal (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP) PhIP (ISO) piperonyl butoxide (ISO) pirinixic acid (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sunitinib (ISO) testosterone (EXP) thimerosal (ISO) triclosan (ISO) urethane (ISO) valproic acid (ISO) vancomycin (ISO) vorinostat (ISO)
C1qtnf3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 61,644,225 - 61,666,640 (+) NCBI GRCr8 mRatBN7.2 2 59,917,099 - 59,939,519 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 59,917,188 - 59,939,433 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 67,026,247 - 67,048,653 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 65,147,754 - 65,170,160 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 60,149,133 - 60,171,540 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 60,920,160 - 60,942,586 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 60,920,257 - 60,942,500 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 83,741,856 - 83,764,282 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 60,303,261 - 60,325,510 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 60,231,385 - 60,253,774 (+) NCBI Celera 2 58,744,899 - 58,767,152 (-) NCBI Celera Cytogenetic Map 2 q16 NCBI
C1QTNF3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 5 34,017,858 - 34,244,724 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 5 34,017,858 - 34,043,213 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 5 34,017,963 - 34,244,829 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 5 34,053,720 - 34,079,074 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 5 33,906,383 - 33,931,740 (-) NCBI Celera Cytogenetic Map 5 p13.2 NCBI HuRef 5 33,995,911 - 34,021,322 (-) NCBI HuRef CHM1_1 5 34,019,515 - 34,044,921 (-) NCBI CHM1_1 T2T-CHM13v2.0 5 34,139,780 - 34,489,333 (-) NCBI T2T-CHM13v2.0
C1qtnf3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 15 10,952,418 - 10,980,248 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 15 10,952,418 - 10,980,236 (+) Ensembl GRCm39 Ensembl GRCm38 15 10,952,119 - 10,980,162 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 15 10,952,332 - 10,980,150 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 15 10,882,111 - 10,909,905 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 15 10,897,081 - 10,924,875 (+) NCBI MGSCv36 mm8 Celera 15 10,744,504 - 10,772,229 (+) NCBI Celera Cytogenetic Map 15 A1 NCBI cM Map 15 5.38 NCBI
C1qtnf3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955426 19,585,460 - 19,606,557 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955426 19,588,637 - 19,606,557 (-) NCBI ChiLan1.0 ChiLan1.0
C1QTNF3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 4 76,266,807 - 76,292,103 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 5 74,420,423 - 74,445,734 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 5 76,292,679 - 76,325,064 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 5 81,687,891 - 81,713,276 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 5 81,687,891 - 81,742,003 (+) Ensembl panpan1.1 panPan2
C1QTNF3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 4 73,787,706 - 73,817,410 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 4 73,403,467 - 73,429,087 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 4 74,293,968 - 74,319,593 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 4 74,293,890 - 74,315,886 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 4 74,040,738 - 74,066,138 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 4 74,164,083 - 74,189,699 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 4 74,698,469 - 74,723,846 (+) NCBI UU_Cfam_GSD_1.0
C1qtnf3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 224,311,357 - 224,332,271 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936518 7,039,525 - 7,060,739 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936518 7,039,590 - 7,060,463 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
C1QTNF3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 16 20,032,980 - 20,060,164 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 16 20,032,973 - 20,059,905 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 16 20,792,522 - 20,820,072 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
C1QTNF3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 4 33,257,167 - 33,281,430 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 4 33,256,717 - 33,281,161 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666071 23,553,026 - 23,577,069 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
C1qtnf3
.
Predicted Target Of
Count of predictions: 99 Count of miRNA genes: 93 Interacting mature miRNAs: 97 Transcripts: ENSRNOT00000025170 Prediction methods: Miranda, Targetscan Result types: miRGate_prediction
1578777 Stresp15 Stress response QTL 15 2 0.05 blood aldosterone amount (VT:0005346) plasma aldosterone level (CMO:0000551) 2 59846005 104846005 Rat 6480225 Gdil1 Gastrointestinal dilation QTL 1 enteric ganglion morphology trait (VT:0001045) length of intestine affected by colonic aganglionosis to total length of colon ratio (CMO:0001836) 2 56660879 74786777 Rat 2293671 Bss44 Bone structure and strength QTL 44 10.97 0.0001 lumbar vertebra morphology trait (VT:0010494) lumbar vertebra cortical cross-sectional area (CMO:0001690) 2 43162366 148478373 Rat 1298074 Bp164 Blood pressure QTL 164 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 2293676 Bmd19 Bone mineral density QTL 19 10.7 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 2 43162366 111362592 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 2293682 Bmd24 Bone mineral density QTL 24 8.9 0.0001 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 2 43162366 111362592 Rat 731167 Glom4 Glomerulus QTL 4 2.4 0.0082 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 2 20304672 65304672 Rat 152025242 Bw191 Body weight QTL 191 3.62 body mass (VT:0001259) 2 38573329 122609194 Rat 1302794 Stl27 Serum triglyceride level QTL 27 4.4 0.0001 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 2 25413423 143657569 Rat 61467 Bp14 Blood pressure QTL 14 2.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 43154682 202446871 Rat 10402051 Gdil2 Gastrointestinal dilation QTL 2 enteric ganglion morphology trait (VT:0001045) length of intestine affected by colonic aganglionosis to total length of colon ratio (CMO:0001836) 2 24903853 74786777 Rat 70174 BpQTLCluster2 Blood pressure QTL cluster 2 4.24 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 2 40067944 102785628 Rat 1358901 Cm38 Cardiac mass QTL 38 2 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 631208 Bw1 Body weight QTL1 5.09 mesenteric fat pad mass (VT:0010427) mesenteric fat pad weight to body weight ratio (CMO:0000654) 2 43171017 83575226 Rat 1331760 Bp206 Blood pressure QTL 206 3.62454 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 56043031 202447032 Rat 1358899 Kidm23 Kidney mass QTL 23 3.88 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358908 Bw49 Body weight QTL 49 3.36 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 1300155 Bp174 Blood pressure QTL 174 4.09 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 2 42804607 60653831 Rat 5684990 Bmd82 Bone mineral density QTL 82 2.8 tibia mineral mass (VT:1000283) bone mineral content (CMO:0001554) 2 59324377 103795077 Rat 1358910 Kidm27 Kidney mass QTL 27 5.77 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 61355 Bp36 Blood pressure QTL 36 2.9 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 2 5873687 102844969 Rat 2300168 Bmd47 Bone mineral density QTL 47 6.6 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 2 20662448 65662448 Rat 1358911 Kidm28 Kidney mass QTL 28 5.42 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358904 Cm39 Cardiac mass QTL 39 2.26 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 1357990 Ael1 Aortic elastin QTL 1 3.1 0.00091 aorta elastin amount (VT:0003905) aortic elastin 2 19076825 64076825 Rat 1358887 Bw50 Body weight QTL 50 2.39 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 1298085 Bp165 Blood pressure QTL 165 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 2290453 Scl55 Serum cholesterol level QTL 55 2.83 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 2 26917817 136917119 Rat 1358894 Kidm24 Kidney mass QTL 24 4.03 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 731184 Mamtr4 Mammary tumor resistance QTL 4 0.0003 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 2 16491740 61491740 Rat 61371 Edpm1 Estrogen-dependent pituitary mass QTL 1 4 0.05 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 2 35134841 88029593 Rat 1582246 Cm60 Cardiac mass QTL 60 5.8 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 57605612 76539510 Rat 631500 Bp99 Blood pressure QTL 99 2.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 59324719 102755241 Rat 7387318 Stl32 Serum triglyceride level QTL 32 3.2 0.0003 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 2 22384627 67384627 Rat 10755436 Coatc8 Coat color QTL 8 0.02431 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 2 35023117 80023117 Rat 10755434 Coatc7 Coat color QTL 7 0.04794 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 2 30648065 75648065 Rat 1358917 Cm42 Cardiac mass QTL 42 2.82 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 5684996 Bmd85 Bone mineral density QTL 85 4.7 0.024 tibia mineral mass (VT:1000283) bone mineral density (CMO:0001226) 2 59324377 103795077 Rat 1358913 Cm41 Cardiac mass QTL 41 2.73 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 9590095 Sffal3 Serum free fatty acids level QTL 3 6.78 0.001 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 2 27157160 72157160 Rat 2293835 Kiddil5 Kidney dilation QTL 5 3.8 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 42804607 157142209 Rat 631266 Bp132 Blood pressure QTL 132 0.0005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 46123260 202447032 Rat 1354617 Bp240 Blood pressure QTL 240 4 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 26917817 81754745 Rat 1558648 Smcn1 Smooth muscle cell number QTL 1 0.039 blood vessel smooth muscle cell quantity (VT:0010525) aorta smooth muscle cell count per unit vessel length (CMO:0001646) 2 59134147 127460910 Rat 2293843 Kiddil6 Kidney dilation QTL 6 3.1 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 42804607 182042367 Rat 1354592 Rf50 Renal function QTL 50 3.5 urine output (VT:0003620) timed urine volume (CMO:0000260) 2 53822747 74786777 Rat 152025206 Hrtrt23 Heart rate QTL 23 5.98 heart pumping trait (VT:2000009) 2 28484589 169504100 Rat 152025204 Hrtrt22 Heart rate QTL 22 5.6 heart pumping trait (VT:2000009) 2 28484589 169504100 Rat 1354601 Slep1 Serum leptin concentration QTL 1 5.39 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 2 43171017 184114403 Rat 61438 Cia7 Collagen induced arthritis QTL 7 4.6 0.0001 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 2 59324377 141596857 Rat 1354603 Bp243 Blood pressure QTL 243 3.9 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 26917817 127469484 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
36
113
89
88
57
19
57
6
197
78
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000025170 ⟹ ENSRNOP00000025170
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 59,917,188 - 59,939,433 (+) Ensembl Rnor_6.0 Ensembl 2 60,920,257 - 60,942,500 (+) Ensembl
RefSeq Acc Id:
NM_001134436 ⟹ NP_001127908
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 61,644,316 - 61,666,565 (+) NCBI mRatBN7.2 2 59,917,188 - 59,939,439 (+) NCBI Rnor_6.0 2 60,920,257 - 60,942,506 (+) NCBI Rnor_5.0 2 83,741,856 - 83,764,282 (-) NCBI RGSC_v3.4 2 60,303,261 - 60,325,510 (+) RGD Celera 2 58,744,899 - 58,767,152 (-) RGD
Sequence:
CGGGTGCCGGGTGCCTACAGCCCCCATCAGCTTCCCCGGGGAGATTCTGCCGATTTGTCACGAGCCATGCTCAGGAGGCAGCTCGTCTGGTGGCACCTGCTGGCTTTGCTTTTCCTCCCATTTTGCCT
hide sequence
RefSeq Acc Id:
XM_006232067 ⟹ XP_006232129
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 61,644,225 - 61,666,640 (+) NCBI mRatBN7.2 2 59,917,099 - 59,939,519 (+) NCBI Rnor_6.0 2 60,920,160 - 60,942,586 (+) NCBI Rnor_5.0 2 83,741,856 - 83,764,282 (-) NCBI
Sequence:
CTTATTTATTACACACCAAAAGTATAAAACCACACAGCCGGCTGCAGCTCTCATCTCCAAACCT
hide sequence
RefSeq Acc Id:
NP_001127908 ⟸ NM_001134436
- Peptide Label:
precursor
- UniProtKB:
B1WC91 (UniProtKB/TrEMBL)
- Sequence:
MLRRQLVWWHLLALLFLPFCLCQDEYMEVSRRANKAVARIVQSHQQTGRSGSRREKVREQSHAKTGTVDNNTSTDLKSLRPDELPHPEVEDLAQINPFWGQSPQAGGLPPDCSKCCHGDYGFRGYQGP
hide sequence
RefSeq Acc Id:
XP_006232129 ⟸ XM_006232067
- Peptide Label:
isoform X1
- Sequence:
MLRRQLVWWHLLALLFLPFCLCQDEYMESPQAGGLPPDCSKCCHGDYGFRGYQGPPGPPGPPGI
hide sequence
Ensembl Acc Id:
ENSRNOP00000025170 ⟸ ENSRNOT00000025170
RGD ID: 13691187 Promoter ID: EPDNEW_R1712 Type: single initiation site Name: C1qtnf3_1 Description: C1q and TNF related 3 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 2 60,920,212 - 60,920,272 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2017-03-09
C1qtnf3
C1q and TNF related 3
C1qtnf3
C1q and tumor necrosis factor related protein 3
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
C1qtnf3
C1q and tumor necrosis factor related protein 3
C1qtnf3_predicted
C1q and tumor necrosis factor related protein 3 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
C1qtnf3_predicted
C1q and tumor necrosis factor related protein 3 (predicted)
Symbol and Name status set to approved
70820 APPROVED
