Symbol:
Nelfe
Name:
negative elongation factor complex member E
RGD ID:
1303325
Description:
Enables chromatin binding activity. Involved in positive regulation of ERK1 and ERK2 cascade; positive regulation of protein modification process; and regulation of transcription by RNA polymerase II. Predicted to be located in nuclear body and plasma membrane. Predicted to be part of NELF complex. Predicted to be active in chromatin and nucleus. Orthologous to human NELFE (negative elongation factor complex member E); PARTICIPATES IN RNA polymerase II transcription elongation pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 2,6-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
negative elongation factor E; Rd; RD RNA-binding protein; Rdbp
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 3,981,259 - 3,987,016 (-) NCBI GRCr8 mRatBN7.2 20 3,976,512 - 3,982,389 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 3,976,518 - 3,982,355 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 4,676,633 - 4,682,383 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 4,038,381 - 4,044,131 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 4,575,547 - 4,581,290 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 4,530,328 - 4,536,085 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 4,530,342 - 4,536,209 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 6,610,127 - 6,615,884 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 4,077,925 - 4,081,561 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 20 4,078,021 - 4,081,787 (-) NCBI Celera 20 4,048,306 - 4,054,061 (+) NCBI Celera Cytogenetic Map 20 p12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Nelfe Rat (1->4)-beta-D-glucan multiple interactions ISO RGD:1621569 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of NELFE mRNA CTD PMID:36331819 Nelfe Rat 1,2-dimethylhydrazine multiple interactions ISO RGD:1621569 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of NELFE mRNA CTD PMID:22206623 Nelfe Rat 17alpha-ethynylestradiol increases expression ISO RGD:1621569 6480464 Ethinyl Estradiol results in increased expression of NELFE mRNA CTD PMID:17942748 Nelfe Rat 17alpha-ethynylestradiol multiple interactions ISO RGD:1621569 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of NELFE mRNA CTD PMID:17942748 Nelfe Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO RGD:1344973 6480464 2,2',4,4'-tetrabromodiphenyl ether results in decreased expression of NELFE protein CTD PMID:31675489 Nelfe Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1621569 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of NELFE mRNA; Tetrachlorodibenzodioxin promotes the more ... CTD PMID:17942748|PMID:19654925 Nelfe Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of NELFE mRNA CTD PMID:33387578 Nelfe Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of NELFE mRNA CTD PMID:32109520 Nelfe Rat 2,3,7,8-tetrachlorodibenzodioxine increases phosphorylation EXP 6480464 Tetrachlorodibenzodioxin results in increased phosphorylation of NELFE protein CTD PMID:23298284 Nelfe Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1621569 6480464 Tetrachlorodibenzodioxin affects the expression of NELFE mRNA CTD PMID:21570461 Nelfe Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1621569 6480464 Tetrachlorodibenzodioxin results in decreased expression of NELFE mRNA CTD PMID:21354282 Nelfe Rat 2,4,6-tribromophenol decreases expression ISO RGD:1344973 6480464 2,4,6-tribromophenol results in decreased expression of NELFE mRNA CTD PMID:31675489 Nelfe Rat 2,4-dinitrotoluene affects expression EXP 6480464 2,4-dinitrotoluene affects the expression of NELFE mRNA CTD PMID:21346803 Nelfe Rat 2,6-dinitrotoluene affects expression EXP 6480464 2,6-dinitrotoluene affects the expression of NELFE mRNA CTD PMID:21346803 Nelfe Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO RGD:1344973 6480464 tetrabromobisphenol A results in decreased expression of NELFE protein CTD PMID:31675489 Nelfe Rat 4,4'-diaminodiphenylmethane decreases expression ISO RGD:1621569 6480464 4,4'-diaminodiphenylmethane results in decreased expression of NELFE mRNA CTD PMID:18648102 Nelfe Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:1621569 6480464 bisphenol S results in increased expression of NELFE mRNA CTD PMID:39298647 Nelfe Rat 4,4'-sulfonyldiphenol affects methylation ISO RGD:1621569 6480464 bisphenol S affects the methylation of NELFE gene CTD PMID:31683443 Nelfe Rat 4-amino-2,6-dinitrotoluene affects expression EXP 6480464 4-amino-2,6-dinitrotoluene affects the expression of NELFE mRNA CTD PMID:21346803 Nelfe Rat acrolein multiple interactions ISO RGD:1344973 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ... CTD PMID:32699268 Nelfe Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of NELFE mRNA CTD PMID:33354967 Nelfe Rat alpha-pinene multiple interactions ISO RGD:1344973 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ... CTD PMID:32699268 Nelfe Rat aristolochic acid A decreases expression ISO RGD:1344973 6480464 aristolochic acid I results in decreased expression of NELFE mRNA; aristolochic acid I results in more ... CTD PMID:33212167 Nelfe Rat arsane affects methylation ISO RGD:1344973 6480464 Arsenic affects the methylation of NELFE gene CTD PMID:25304211 Nelfe Rat arsenic atom affects methylation ISO RGD:1344973 6480464 Arsenic affects the methylation of NELFE gene CTD PMID:25304211 Nelfe Rat benzo[a]pyrene decreases methylation ISO RGD:1344973 6480464 Benzo(a)pyrene results in decreased methylation of NELFE 3' UTR CTD PMID:27901495 Nelfe Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of NELFE mRNA CTD PMID:25181051 Nelfe Rat bisphenol A decreases expression ISO RGD:1344973 6480464 bisphenol A results in decreased expression of NELFE protein CTD PMID:31675489 Nelfe Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of NELFE mRNA CTD PMID:33296240 Nelfe Rat cadmium dichloride increases expression ISO RGD:1344973 6480464 Cadmium Chloride results in increased expression of NELFE mRNA CTD PMID:38568856 Nelfe Rat caffeine decreases phosphorylation ISO RGD:1344973 6480464 Caffeine results in decreased phosphorylation of NELFE protein CTD PMID:35688186 Nelfe Rat CGP 52608 multiple interactions ISO RGD:1344973 6480464 CGP 52608 promotes the reaction [RORA protein binds to NELFE gene] CTD PMID:28238834 Nelfe Rat chlorpyrifos decreases expression ISO RGD:1621569 6480464 Chlorpyrifos results in decreased expression of NELFE mRNA CTD PMID:32715474 Nelfe Rat cobalt dichloride decreases expression ISO RGD:1344973 6480464 cobaltous chloride results in decreased expression of NELFE mRNA CTD PMID:19320972|PMID:19376846 Nelfe Rat coumarin increases phosphorylation ISO RGD:1344973 6480464 coumarin results in increased phosphorylation of NELFE protein CTD PMID:35688186 Nelfe Rat cyclosporin A increases expression ISO RGD:1344973 6480464 Cyclosporine results in increased expression of NELFE mRNA CTD PMID:20106945|PMID:27989131 Nelfe Rat dibutyl phthalate decreases expression ISO RGD:1621569 6480464 Dibutyl Phthalate results in decreased expression of NELFE mRNA CTD PMID:21266533 Nelfe Rat dioxygen decreases expression ISO RGD:1621569 6480464 Oxygen deficiency results in decreased expression of NELFE mRNA CTD PMID:22629407 Nelfe Rat dioxygen multiple interactions ISO RGD:1621569 6480464 Oxygen inhibits the reaction [Oxygen deficiency results in decreased expression of NELFE mRNA] CTD PMID:22629407 Nelfe Rat doxorubicin decreases expression ISO RGD:1344973 6480464 Doxorubicin results in decreased expression of NELFE mRNA CTD PMID:29803840 Nelfe Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of NELFE mRNA CTD PMID:29391264 Nelfe Rat enzyme inhibitor multiple interactions ISO RGD:1344973 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation more ... CTD PMID:23301498 Nelfe Rat folic acid multiple interactions ISO RGD:1621569 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of NELFE mRNA CTD PMID:22206623 Nelfe Rat FR900359 affects phosphorylation ISO RGD:1344973 6480464 FR900359 affects the phosphorylation of NELFE protein CTD PMID:37730182 Nelfe Rat genistein multiple interactions ISO RGD:1344973 6480464 Genistein promotes the reaction [NELFE protein binds to ESR1 protein] CTD PMID:27156127 Nelfe Rat hexadecanoic acid decreases phosphorylation ISO RGD:1344973 6480464 Palmitic Acid results in decreased phosphorylation of NELFE protein CTD PMID:28073184 Nelfe Rat hypochlorous acid decreases expression ISO RGD:1621569 6480464 Hypochlorous Acid results in decreased expression of NELFE mRNA CTD PMID:19376150 Nelfe Rat isobutanol multiple interactions ISO RGD:1344973 6480464 [[Gasoline co-treated with isobutyl alcohol] results in increased abundance of [Particulate Matter co-treated with Polycyclic more ... CTD PMID:29432896 Nelfe Rat ivermectin decreases expression ISO RGD:1344973 6480464 Ivermectin results in decreased expression of NELFE protein CTD PMID:32959892 Nelfe Rat lead(0) decreases expression ISO RGD:1344973 6480464 Lead results in decreased expression of NELFE mRNA CTD PMID:19921347 Nelfe Rat methyl methanesulfonate increases expression ISO RGD:1344973 6480464 Methyl Methanesulfonate results in increased expression of NELFE mRNA CTD PMID:23649840 Nelfe Rat ozone multiple interactions ISO RGD:1344973 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ... CTD PMID:32699268 Nelfe Rat paracetamol increases expression ISO RGD:1344973 6480464 Acetaminophen results in increased expression of NELFE mRNA CTD PMID:25704631 Nelfe Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:1621569 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of NELFE mRNA CTD PMID:36331819 Nelfe Rat phenobarbital affects expression ISO RGD:1621569 6480464 Phenobarbital affects the expression of NELFE mRNA CTD PMID:23091169 Nelfe Rat quercetin increases expression ISO RGD:1344973 6480464 Quercetin results in increased expression of NELFE mRNA CTD PMID:21632981 Nelfe Rat SB 431542 multiple interactions ISO RGD:1344973 6480464 [LDN 193189 co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in increased expression of NELFE more ... CTD PMID:37664457 Nelfe Rat T-2 toxin increases expression ISO RGD:1344973 6480464 T-2 Toxin results in increased expression of NELFE mRNA CTD PMID:34581912 Nelfe Rat tamoxifen increases expression ISO RGD:1621569 6480464 Tamoxifen results in increased expression of NELFE mRNA CTD PMID:17555576 Nelfe Rat temozolomide increases expression ISO RGD:1344973 6480464 Temozolomide results in increased expression of NELFE mRNA CTD PMID:31758290 Nelfe Rat tetrahydropalmatine decreases expression ISO RGD:1344973 6480464 tetrahydropalmatine results in decreased expression of NELFE protein CTD PMID:20109541 Nelfe Rat trichloroethene increases expression ISO RGD:1621569 6480464 Trichloroethylene results in increased expression of NELFE mRNA CTD PMID:19448997 Nelfe Rat trimellitic anhydride increases expression ISO RGD:1621569 6480464 trimellitic anhydride results in increased expression of NELFE mRNA CTD PMID:19042947 Nelfe Rat triphenyl phosphate affects expression ISO RGD:1344973 6480464 triphenyl phosphate affects the expression of NELFE mRNA CTD PMID:37042841 Nelfe Rat valproic acid increases expression ISO RGD:1344973 6480464 Valproic Acid results in increased expression of NELFE mRNA CTD PMID:29154799
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
Nelfe Rat chromatin binding IDA 9588536 RGD Nelfe Rat chromatin binding enables ISO RGD:1621569 1624291 PMID:31399344 RGD PMID:31399344 Nelfe Rat chromatin binding enables IEA UniProtKB:P18615|ensembl:ENSP00000364578 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Nelfe Rat chromatin binding enables IEA UniProtKB:P19426|ensembl:ENSMUSP00000094956 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Nelfe Rat chromatin binding enables ISO RGD:1344973 1624291 PMID:14701750, PMID:27256882 RGD PMID:14701750|PMID:27256882 Nelfe Rat chromatin binding IMP 9693718 RGD Nelfe Rat mRNA binding enables ISO RGD:1344973 1624291 PMID:27256882 RGD PMID:27256882 Nelfe Rat mRNA binding enables IEA UniProtKB:P18615|ensembl:ENSP00000364578 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Nelfe Rat nucleic acid binding enables IEA InterPro:IPR035979 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Nelfe Rat protein binding enables ISO RGD:1344973 1624291 UniProtKB:P14373|UniProtKB:Q2TAC2|UniProtKB:Q5JR59|UniProtKB:Q63ZY3|UniProtKB:Q8WX92|UniProtKB:Q8WX92-2 PMID:12612062, PMID:14667819, PMID:20211142, PMID:24981860, PMID:25416956, PMID:26496610, PMID:28514442, PMID:32296183, PMID:33961781 RGD PMID:12612062|PMID:14667819|PMID:20211142|PMID:24981860|PMID:25416956|PMID:26496610|PMID:28514442|PMID:32296183|PMID:33961781 Nelfe Rat protein binding enables ISO RGD:1621569 1624291 UniProtKB:P11499|UniProtKB:Q8C4Y3 PMID:22579285, PMID:26010750 RGD PMID:22579285|PMID:26010750 Nelfe Rat RNA binding enables ISO RGD:1344973 1624291 PMID:27256882 RGD PMID:27256882 Nelfe Rat RNA binding enables IEA InterPro:IPR000504 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Nelfe Rat RNA binding enables IEA UniRule:UR000414619 1600115 GO_REF:0000104 UniProt GO_REF:0000104 Nelfe Rat RNA binding enables IEA UniProtKB:P18615|ensembl:ENSP00000364578 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Nelfe Rat RNA binding enables IEA UniProtKB-KW:KW-0694 1600115 GO_REF:0000043 UniProt GO_REF:0000043
(1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (ISO) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 3,3',5,5'-tetrabromobisphenol A (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-amino-2,6-dinitrotoluene (EXP) acrolein (ISO) aflatoxin B1 (EXP) alpha-pinene (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) cadmium dichloride (ISO) caffeine (ISO) CGP 52608 (ISO) chlorpyrifos (ISO) cobalt dichloride (ISO) coumarin (ISO) cyclosporin A (ISO) dibutyl phthalate (ISO) dioxygen (ISO) doxorubicin (ISO) endosulfan (EXP) enzyme inhibitor (ISO) folic acid (ISO) FR900359 (ISO) genistein (ISO) hexadecanoic acid (ISO) hypochlorous acid (ISO) isobutanol (ISO) ivermectin (ISO) lead(0) (ISO) methyl methanesulfonate (ISO) ozone (ISO) paracetamol (ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) quercetin (ISO) SB 431542 (ISO) T-2 toxin (ISO) tamoxifen (ISO) temozolomide (ISO) tetrahydropalmatine (ISO) trichloroethene (ISO) trimellitic anhydride (ISO) triphenyl phosphate (ISO) valproic acid (ISO)
1.
Negative elongation factor NELF controls transcription of immediate early genes in a stimulus-specific manner.
Fujita T, etal., Exp Cell Res. 2009 Jan 15;315(2):274-84. doi: 10.1016/j.yexcr.2008.10.032. Epub 2008 Nov 5.
2.
Transcription elongation factors are involved in programming hormone production in pituitary neuroendocrine GH4C1 cells.
Fujita T, etal., Mol Cell Endocrinol. 2010 May 5;319(1-2):63-70. doi: 10.1016/j.mce.2010.01.020. Epub 2010 Jan 25.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Control of transcriptional elongation.
Kwak H and Lis JT, Annu Rev Genet. 2013;47:483-508. doi: 10.1146/annurev-genet-110711-155440. Epub 2013 Sep 11.
5.
GOA pipeline
RGD automated data pipeline
6.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
8.
Rapid activity-induced transcription of Arc and other IEGs relies on poised RNA polymerase II.
Saha RN, etal., Nat Neurosci. 2011 May 29;14(7):848-56. doi: 10.1038/nn.2839.
9.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
Nelfe Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 3,981,259 - 3,987,016 (-) NCBI GRCr8 mRatBN7.2 20 3,976,512 - 3,982,389 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 3,976,518 - 3,982,355 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 4,676,633 - 4,682,383 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 4,038,381 - 4,044,131 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 4,575,547 - 4,581,290 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 4,530,328 - 4,536,085 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 4,530,342 - 4,536,209 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 6,610,127 - 6,615,884 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 4,077,925 - 4,081,561 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 20 4,078,021 - 4,081,787 (-) NCBI Celera 20 4,048,306 - 4,054,061 (+) NCBI Celera Cytogenetic Map 20 p12 NCBI
NELFE Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 31,952,087 - 31,958,971 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 31,952,087 - 31,959,038 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 31,919,864 - 31,926,748 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 32,027,843 - 32,034,843 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 32,027,843 - 32,034,747 NCBI Celera 6 33,519,627 - 33,526,530 (-) NCBI Celera Cytogenetic Map 6 p21.33 NCBI HuRef 6 31,706,833 - 31,713,834 (-) NCBI HuRef CHM1_1 6 31,921,945 - 31,928,945 (-) NCBI CHM1_1 T2T-CHM13v2.0 6 31,805,292 - 31,812,176 (-) NCBI T2T-CHM13v2.0
Nelfe Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 35,069,367 - 35,075,348 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 35,069,367 - 35,075,348 (+) Ensembl GRCm39 Ensembl GRCm38 17 34,850,391 - 34,856,372 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 34,850,391 - 34,856,372 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 34,987,336 - 34,993,317 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 17 34,458,975 - 34,464,214 (+) NCBI MGSCv36 mm8 Celera 17 37,945,699 - 37,951,680 (+) NCBI Celera Cytogenetic Map 17 B1 NCBI cM Map 17 18.4 NCBI
Nelfe Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955437 466,690 - 473,084 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955437 467,018 - 473,084 (-) NCBI ChiLan1.0 ChiLan1.0
NELFE Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 46,428,781 - 46,435,590 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 42,390,268 - 42,397,077 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 31,612,924 - 31,619,732 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 32,499,538 - 32,506,382 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 32,499,540 - 32,506,382 (-) Ensembl panpan1.1 panPan2
NELFE Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 12 1,406,411 - 1,412,387 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 12 1,406,271 - 1,412,324 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 12 1,541,468 - 1,547,598 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 12 1,548,568 - 1,554,700 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 12 1,548,568 - 1,554,605 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 12 1,405,843 - 1,411,974 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 12 1,474,213 - 1,480,345 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 12 1,539,542 - 1,546,943 (-) NCBI UU_Cfam_GSD_1.0
Nelfe Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404946 35,965,333 - 35,971,346 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936727 1,589,942 - 1,598,182 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936727 1,589,942 - 1,596,009 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
NELFE Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 24,040,525 - 24,047,025 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 24,040,525 - 24,046,932 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 27,765,281 - 27,771,676 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
NELFE Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 17 40,063,298 - 40,069,714 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 17 40,063,755 - 40,198,451 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666044 31,868,805 - 31,875,524 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Nelfe
.
Predicted Target Of
Count of predictions: 29 Count of miRNA genes: 28 Interacting mature miRNAs: 29 Transcripts: ENSRNOT00000000478 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
61472 Aia1 Adjuvant induced arthritis QTL 1 18 0.001 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 20 2646395 4597031 Rat 2306850 Pia40 Pristane induced arthritis QTL 40 0.0001 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 20 1527959 5304575 Rat 1641915 Colcr9 Colorectal carcinoma resistance QTL 9 2.97 0.0024 intestine integrity trait (VT:0010554) benign colorectal tumor number (CMO:0001795) 20 1530655 46530655 Rat 2317057 Aia27 Adjuvant induced arthritis QTL 27 2.83 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 20 2892597 26381954 Rat 7387283 Uae44 Urinary albumin excretion QTL 44 0.1712 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 20 1 26123605 Rat 7411668 Foco32 Food consumption QTL 32 8 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 20 1 36600972 Rat 2305926 Iddm37 Insulin dependent diabetes mellitus QTL 37 6 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 20 1527842 46527842 Rat 1354642 Despr15 Despair related QTL 15 0.0027 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 20 1 24159021 Rat 1600382 Edcs3 Endometrial carcinoma susceptibility QTL3 3.5 0.003 uterus morphology trait (VT:0001120) percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759) 20 1 25159026 Rat 61448 Ciaa1 CIA Autoantibody QTL 1 30 0.001 blood autoantibody amount (VT:0003725) calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281) 20 2646395 4597031 Rat 1331772 Cdexp2 CD45RC expression in CD8 T cells QTL 2 5.7 CD8-positive T cell quantity (VT:0008077) blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990) 20 3621649 10078919 Rat 8694189 Bw153 Body weight QTL 153 3.13 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 20 1 29191651 Rat 1300152 Bp195 Blood pressure QTL 195 3.46 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 20 3621649 9243559 Rat 9590109 Sffal8 Serum free fatty acids level QTL 8 5.32 0.01 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 20 1 29191651 Rat 9590275 Scort15 Serum corticosterone level QTL 15 3.48 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 20 1 29191651 Rat 9589155 Insul32 Insulin level QTL 32 6.38 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 20 1 29191651 Rat 7411650 Foco23 Food consumption QTL 23 20.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 20 1 29191651 Rat 2317851 Alcrsp22 Alcohol response QTL 22 3.2 0.05 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 20 1 27339237 Rat 1598816 Memor12 Memory QTL 12 2.4 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 20 2606836 47606836 Rat 61432 Cia1 Collagen induced arthritis QTL 1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 20 3621656 14101050 Rat 1641893 Alcrsp7 Alcohol response QTL 7 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 20 1 27339237 Rat 6893685 Bw111 Body weight QTL 111 2.7 0.004 body mass (VT:0001259) body weight (CMO:0000012) 20 1 32578807 Rat 9590252 Scort12 Serum corticosterone level QTL 12 20.46 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 20 1 36600972 Rat 737973 Pia21 Pristane induced arthritis QTL 21 4.8 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 20 3621656 4606812 Rat
AI255840
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 20 3,976,300 - 3,976,398 (-) MAPPER mRatBN7.2 Rnor_6.0 20 4,536,318 - 4,536,415 NCBI Rnor6.0 Rnor_5.0 20 6,616,117 - 6,616,214 UniSTS Rnor5.0 RGSC_v3.4 20 4,077,593 - 4,077,690 UniSTS RGSC3.4 Celera 20 4,054,296 - 4,054,393 UniSTS Cytogenetic Map 20 p12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000000478 ⟹ ENSRNOP00000000478
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 20 3,976,518 - 3,982,355 (-) Ensembl Rnor_6.0 Ensembl 20 4,530,344 - 4,536,209 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000075925 ⟹ ENSRNOP00000068302
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 20 4,530,365 - 4,533,928 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000076352 ⟹ ENSRNOP00000068403
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 20 4,530,342 - 4,536,084 (+) Ensembl
RefSeq Acc Id:
NM_001165901 ⟹ NP_001159373
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 3,981,261 - 3,987,016 (-) NCBI mRatBN7.2 20 3,976,633 - 3,982,389 (-) NCBI Rnor_6.0 20 4,530,328 - 4,536,083 (+) NCBI Rnor_5.0 20 6,610,127 - 6,615,884 (+) NCBI RGSC_v3.4 20 4,077,925 - 4,081,561 (-) RGD Celera 20 4,048,306 - 4,054,061 (+) RGD
Sequence:
CCGCGAGCCCGCGCGCAGCAGCCCGCGCGGCGGCGCCGGAGACCGCGGGCCCGGGCGCCGCCCCCTCAGGAGCCAACATGTTGGTGATACCTCCGGGGCTGAGTGAAGAGGAAGAGGCACTACAGAAG
hide sequence
RefSeq Acc Id:
NM_212548 ⟹ NP_997713
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 3,981,261 - 3,986,922 (-) NCBI mRatBN7.2 20 3,976,633 - 3,982,295 (-) NCBI Rnor_6.0 20 4,530,422 - 4,536,083 (+) NCBI Rnor_5.0 20 6,610,127 - 6,615,884 (+) NCBI RGSC_v3.4 20 4,077,925 - 4,081,561 (-) RGD Celera 20 4,048,400 - 4,054,061 (+) NCBI
Sequence:
GCGCCTTCCCCGCGCGGCCCCTGGTTCTTCTTCCTCCTCCTCTGGTTGCCCAGATAGCGCTGCG
hide sequence
RefSeq Acc Id:
XM_006255922 ⟹ XP_006255984
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 3,981,259 - 3,986,997 (-) NCBI mRatBN7.2 20 3,976,512 - 3,982,360 (-) NCBI Rnor_6.0 20 4,530,335 - 4,536,085 (+) NCBI Rnor_5.0 20 6,610,127 - 6,615,884 (+) NCBI
Sequence:
CCCGCGCGCAGCAGCCCGCGCGGCGGCGCCGGAGACCGCGGGCCCGGGCGCCGCCCCCTCAGGTGAGGGCTTCGTCTCACATCCTTCGCGCCTTCCCCGCGCGGCCCCTGGTTCTTCTTCCTCCTCCT
hide sequence
RefSeq Acc Id:
NP_997713 ⟸ NM_212548
- UniProtKB:
Q6MG75 (UniProtKB/TrEMBL), F1LP40 (UniProtKB/TrEMBL), Q6AXP2 (UniProtKB/TrEMBL), A0A8J8XR86 (UniProtKB/TrEMBL)
- Sequence:
MLVIPPGLSEEEEALQKKFNKLKKKKKALLALKKQSSSGTASQGGVKRSLSEQPVVDTATATEQAKQLVKSGAISAIKAETKNSGFKRSRTLEGKLKDPEKGPVPTFQPFQRSMSADEDLQEPSRRPQ
hide sequence
RefSeq Acc Id:
NP_001159373 ⟸ NM_001165901
- UniProtKB:
Q6MG75 (UniProtKB/TrEMBL), F1LP40 (UniProtKB/TrEMBL), Q6AXP2 (UniProtKB/TrEMBL), A0A8J8XR86 (UniProtKB/TrEMBL)
- Sequence:
MLVIPPGLSEEEEALQKKFNKLKKKKKALLALKKQSSSGTASQGGVKRSLSEQPVVDTATATEQAKQLVKSGAISAIKAETKNSGFKRSRTLEGKLKDPEKGPVPTFQPFQRSMSADEDLQEPSRRPQ
hide sequence
RefSeq Acc Id:
XP_006255984 ⟸ XM_006255922
- Peptide Label:
isoform X1
- UniProtKB:
Q6MG75 (UniProtKB/TrEMBL), F1LP40 (UniProtKB/TrEMBL), Q6AXP2 (UniProtKB/TrEMBL), A0A8J8XR86 (UniProtKB/TrEMBL)
- Sequence:
MLVIPPGLSEEEEALQKKFNKLKKKKKALLALKKQSSSGTASQGGVKRSLSEQPVVDTATATEQAKQLVKSGAISAIKAETKNSGFKRSRTLEGKLKDPEKGPVPTFQPFQRSMSADEDLQEPSRRPQ
hide sequence
Ensembl Acc Id:
ENSRNOP00000068302 ⟸ ENSRNOT00000075925
Ensembl Acc Id:
ENSRNOP00000000478 ⟸ ENSRNOT00000000478
Ensembl Acc Id:
ENSRNOP00000068403 ⟸ ENSRNOT00000076352
RGD ID: 13701355 Promoter ID: EPDNEW_R11878 Type: initiation region Name: Nelfe_1 Description: negative elongation factor complex member E SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 20 4,530,344 - 4,530,404 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2013-02-06
Nelfe
negative elongation factor complex member E
Rdbp
RD RNA-binding protein
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-11-17
Rdbp
RD RNA-binding protein
Symbol and Name status set to approved
1299863 APPROVED
2005-10-12
Rdbp
Symbol and Name status set to provisional
70820 PROVISIONAL
