Symbol:
Ndufa11
Name:
NADH:ubiquinone oxidoreductase subunit A11
RGD ID:
1303292
Description:
Predicted to be involved in mitochondrial electron transport, NADH to ubiquinone. Predicted to be located in mitochondrial inner membrane. Predicted to be part of respiratory chain complex I. Human ortholog(s) of this gene implicated in communication disorder and nuclear type mitochondrial complex I deficiency 14. Orthologous to human NDUFA11 (NADH:ubiquinone oxidoreductase subunit A11); PARTICIPATES IN Alzheimer's disease pathway; Huntington's disease pathway; oxidative phosphorylation pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 3-chloropropane-1,2-diol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
CI-B14.7; complex I-B14.7; LOC301123; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 11; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11; NADH-ubiquinone oxidoreductase subunit B14.7; RE70703p-like
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 1,637,614 - 1,641,673 (+) NCBI GRCr8 mRatBN7.2 9 1,550,487 - 1,554,546 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 1,550,468 - 1,555,601 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 1,984,630 - 1,988,692 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 7,333,716 - 7,337,779 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 6,289,827 - 6,293,889 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 10,334,104 - 10,338,163 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 10,334,090 - 10,338,216 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 9,331,184 - 9,335,243 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Celera 9 6,962,202 - 6,966,261 (-) NCBI Celera Cytogenetic Map 9 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ndufa11 Rat 1,2-dichloroethane decreases expression ISO RGD:1553646 6480464 ethylene dichloride results in decreased expression of NDUFA11 mRNA CTD PMID:28960355 Ndufa11 Rat 1,2-dimethylhydrazine multiple interactions ISO RGD:1553646 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of NDUFA11 mRNA CTD PMID:22206623 Ndufa11 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of NDUFA11 mRNA CTD PMID:32145629 Ndufa11 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1553646 6480464 Tetrachlorodibenzodioxin results in increased expression of NDUFA11 mRNA CTD PMID:20399798 Ndufa11 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of NDUFA11 mRNA CTD PMID:33387578 Ndufa11 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of NDUFA11 mRNA CTD PMID:34747641 Ndufa11 Rat 3-chloropropane-1,2-diol decreases expression EXP 6480464 alpha-Chlorohydrin results in decreased expression of NDUFA11 mRNA CTD PMID:28522335 Ndufa11 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:1553646 6480464 bisphenol S results in increased expression of NDUFA11 mRNA CTD PMID:39298647 Ndufa11 Rat acrylamide decreases expression ISO RGD:1353803 6480464 Acrylamide results in decreased expression of NDUFA11 mRNA CTD PMID:32763439 Ndufa11 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of NDUFA11 mRNA CTD PMID:33354967 Ndufa11 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of NDUFA11 mRNA CTD PMID:16483693 Ndufa11 Rat Aroclor 1254 increases expression ISO RGD:1553646 6480464 Chlorodiphenyl (54% Chlorine) results in increased expression of NDUFA11 mRNA CTD PMID:23650126 Ndufa11 Rat arsenite(3-) decreases expression ISO RGD:1553646 6480464 arsenite results in decreased expression of NDUFA11 mRNA CTD PMID:33053406 Ndufa11 Rat arsenite(3-) multiple interactions ISO RGD:1353803 6480464 arsenite promotes the reaction [G3BP1 protein binds to NDUFA11 mRNA] CTD PMID:32406909 Ndufa11 Rat atrazine decreases expression ISO RGD:1353803 6480464 Atrazine results in decreased expression of NDUFA11 mRNA CTD PMID:22378314 Ndufa11 Rat beta-lapachone decreases expression ISO RGD:1353803 6480464 beta-lapachone results in decreased expression of NDUFA11 mRNA CTD PMID:38218311 Ndufa11 Rat bis(2-ethylhexyl) phthalate increases expression ISO RGD:1553646 6480464 Diethylhexyl Phthalate results in increased expression of NDUFA11 mRNA CTD PMID:33754040 Ndufa11 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of NDUFA11 mRNA CTD PMID:25181051 Ndufa11 Rat bisphenol A decreases expression ISO RGD:1553646 6480464 bisphenol A results in decreased expression of NDUFA11 mRNA CTD PMID:35598803 Ndufa11 Rat bisphenol A increases expression ISO RGD:1553646 6480464 bisphenol A results in increased expression of NDUFA11 mRNA CTD PMID:33221593 Ndufa11 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of NDUFA11 mRNA CTD PMID:32145629 Ndufa11 Rat bisphenol A affects expression ISO RGD:1353803 6480464 bisphenol A affects the expression of NDUFA11 mRNA CTD PMID:30903817 Ndufa11 Rat bisphenol F decreases expression ISO RGD:1553646 6480464 bisphenol F results in decreased expression of NDUFA11 mRNA CTD PMID:38685157 Ndufa11 Rat butan-1-ol multiple interactions ISO RGD:1353803 6480464 [[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic more ... CTD PMID:29432896 Ndufa11 Rat cadmium dichloride increases methylation EXP 6480464 Cadmium Chloride results in increased methylation of NDUFA11 promoter CTD PMID:22457795 Ndufa11 Rat cadmium dichloride decreases expression ISO RGD:1353803 6480464 Cadmium Chloride results in decreased expression of NDUFA11 mRNA CTD PMID:38568856 Ndufa11 Rat carbon nanotube increases expression ISO RGD:1553646 6480464 Nanotubes, Carbon analog results in increased expression of NDUFA11 mRNA; Nanotubes, Carbon results in increased more ... CTD PMID:25554681 Ndufa11 Rat carbon nanotube affects expression ISO RGD:1553646 6480464 Nanotubes, Carbon affects the expression of NDUFA11 mRNA CTD PMID:31978390 Ndufa11 Rat chloropicrin decreases expression ISO RGD:1353803 6480464 chloropicrin results in decreased expression of NDUFA11 mRNA CTD PMID:26352163 Ndufa11 Rat chlorpyrifos increases expression ISO RGD:1553646 6480464 Chlorpyrifos results in increased expression of NDUFA11 mRNA CTD PMID:37019170 Ndufa11 Rat clofibrate decreases expression ISO RGD:1553646 6480464 Clofibrate results in decreased expression of NDUFA11 mRNA CTD PMID:17585979 Ndufa11 Rat cyclosporin A decreases expression ISO RGD:1353803 6480464 Cyclosporine results in decreased expression of NDUFA11 mRNA CTD PMID:25562108 Ndufa11 Rat diquat decreases expression ISO RGD:1553646 6480464 Diquat results in decreased expression of NDUFA11 protein CTD PMID:36851058 Ndufa11 Rat doxorubicin increases expression ISO RGD:1353803 6480464 Doxorubicin results in increased expression of NDUFA11 mRNA CTD PMID:29803840 Ndufa11 Rat epoxiconazole increases expression ISO RGD:1553646 6480464 epoxiconazole results in increased expression of NDUFA11 mRNA CTD PMID:35436446 Ndufa11 Rat ethanol increases expression ISO RGD:1553646 6480464 Ethanol results in increased expression of NDUFA11 mRNA CTD PMID:30319688 Ndufa11 Rat fenthion increases expression ISO RGD:1553646 6480464 Fenthion results in increased expression of NDUFA11 mRNA CTD PMID:34813904 Ndufa11 Rat folic acid multiple interactions ISO RGD:1553646 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of NDUFA11 mRNA CTD PMID:22206623 Ndufa11 Rat isoprenaline multiple interactions EXP 6480464 [Isoproterenol co-treated with POSTN protein] results in decreased expression of NDUFA11 mRNA CTD PMID:30303030 Ndufa11 Rat lipopolysaccharide multiple interactions ISO RGD:1353803 6480464 [Acetaminophen co-treated with Lipopolysaccharides] results in decreased expression of NDUFA11 mRNA CTD PMID:31059760 Ndufa11 Rat methidathion increases expression ISO RGD:1553646 6480464 methidathion results in increased expression of NDUFA11 mRNA CTD PMID:34813904 Ndufa11 Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Pyridostigmine Bromide co-treated with DEET co-treated with Permethrin] results in increased expression of NDUFA11 mRNA CTD PMID:28659758 Ndufa11 Rat oxybenzone decreases expression EXP 6480464 oxybenzone results in decreased expression of NDUFA11 mRNA CTD PMID:30316929 Ndufa11 Rat paracetamol decreases expression ISO RGD:1353803 6480464 Acetaminophen results in decreased expression of NDUFA11 mRNA CTD PMID:31059760 Ndufa11 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of NDUFA11 mRNA CTD PMID:33387578 Ndufa11 Rat paracetamol multiple interactions ISO RGD:1353803 6480464 [Acetaminophen co-treated with Lipopolysaccharides] results in decreased expression of NDUFA11 mRNA CTD PMID:31059760 Ndufa11 Rat permethrin multiple interactions EXP 6480464 [Pyridostigmine Bromide co-treated with DEET co-treated with Permethrin] results in increased expression of NDUFA11 mRNA CTD PMID:28659758 Ndufa11 Rat pirinixic acid multiple interactions ISO RGD:1553646 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ... CTD PMID:19710929 Ndufa11 Rat Pyridostigmine bromide multiple interactions EXP 6480464 [Pyridostigmine Bromide co-treated with DEET co-treated with Permethrin] results in increased expression of NDUFA11 mRNA CTD PMID:28659758 Ndufa11 Rat sodium arsenite increases expression ISO RGD:1553646 6480464 sodium arsenite results in increased expression of NDUFA11 mRNA CTD PMID:30130555 Ndufa11 Rat sodium arsenite decreases expression ISO RGD:1353803 6480464 sodium arsenite results in decreased expression of NDUFA11 mRNA CTD PMID:38568856 Ndufa11 Rat sodium fluoride increases expression ISO RGD:1553646 6480464 Sodium Fluoride results in increased expression of NDUFA11 protein CTD PMID:28918527 Ndufa11 Rat sulforaphane increases expression ISO RGD:1553646 6480464 sulforaphane results in increased expression of NDUFA11 mRNA CTD PMID:30529165 Ndufa11 Rat temozolomide decreases expression ISO RGD:1353803 6480464 Temozolomide results in decreased expression of NDUFA11 mRNA CTD PMID:31758290 Ndufa11 Rat tetrachloroethene decreases expression ISO RGD:1553646 6480464 Tetrachloroethylene results in decreased expression of NDUFA11 mRNA CTD PMID:28973375 Ndufa11 Rat thapsigargin decreases expression ISO RGD:1353803 6480464 Thapsigargin results in decreased expression of NDUFA11 mRNA CTD PMID:22378314 Ndufa11 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of NDUFA11 mRNA CTD PMID:34492290 Ndufa11 Rat thiram decreases expression ISO RGD:1353803 6480464 Thiram results in decreased expression of NDUFA11 mRNA CTD PMID:38568856 Ndufa11 Rat titanium dioxide increases expression ISO RGD:1553646 6480464 titanium dioxide results in increased expression of NDUFA11 mRNA CTD PMID:27760801 Ndufa11 Rat titanium dioxide decreases methylation ISO RGD:1553646 6480464 titanium dioxide results in decreased methylation of NDUFA11 gene CTD PMID:35295148 Ndufa11 Rat toluene affects expression EXP 6480464 Toluene affects the expression of NDUFA11 mRNA CTD PMID:21827849 Ndufa11 Rat toluene decreases expression EXP 6480464 Toluene results in decreased expression of NDUFA11 mRNA CTD PMID:22967744 Ndufa11 Rat triphenyl phosphate affects expression ISO RGD:1353803 6480464 triphenyl phosphate affects the expression of NDUFA11 mRNA CTD PMID:37042841 Ndufa11 Rat tris(2-butoxyethyl) phosphate increases expression ISO RGD:1353803 6480464 tris(2-butoxyethyl) phosphate results in increased expression of NDUFA11 mRNA CTD PMID:29024780 Ndufa11 Rat tungsten increases expression ISO RGD:1553646 6480464 Tungsten results in increased expression of NDUFA11 mRNA CTD PMID:30912803 Ndufa11 Rat tunicamycin decreases expression ISO RGD:1353803 6480464 Tunicamycin results in decreased expression of NDUFA11 mRNA CTD PMID:22378314 Ndufa11 Rat valproic acid increases expression ISO RGD:1353803 6480464 Valproic Acid results in increased expression of NDUFA11 mRNA CTD PMID:23179753 Ndufa11 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of NDUFA11 mRNA CTD PMID:23034163
Imported Annotations - KEGG (archival)
1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3-chloropropane-1,2-diol (EXP) 4,4'-sulfonyldiphenol (ISO) acrylamide (ISO) aflatoxin B1 (EXP) ammonium chloride (EXP) Aroclor 1254 (ISO) arsenite(3-) (ISO) atrazine (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) butan-1-ol (ISO) cadmium dichloride (EXP,ISO) carbon nanotube (ISO) chloropicrin (ISO) chlorpyrifos (ISO) clofibrate (ISO) cyclosporin A (ISO) diquat (ISO) doxorubicin (ISO) epoxiconazole (ISO) ethanol (ISO) fenthion (ISO) folic acid (ISO) isoprenaline (EXP) lipopolysaccharide (ISO) methidathion (ISO) N,N-diethyl-m-toluamide (EXP) oxybenzone (EXP) paracetamol (EXP,ISO) permethrin (EXP) pirinixic acid (ISO) Pyridostigmine bromide (EXP) sodium arsenite (ISO) sodium fluoride (ISO) sulforaphane (ISO) temozolomide (ISO) tetrachloroethene (ISO) thapsigargin (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) toluene (EXP) triphenyl phosphate (ISO) tris(2-butoxyethyl) phosphate (ISO) tungsten (ISO) tunicamycin (ISO) valproic acid (ISO) vinclozolin (EXP)
Ndufa11 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 1,637,614 - 1,641,673 (+) NCBI GRCr8 mRatBN7.2 9 1,550,487 - 1,554,546 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 1,550,468 - 1,555,601 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 1,984,630 - 1,988,692 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 7,333,716 - 7,337,779 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 6,289,827 - 6,293,889 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 10,334,104 - 10,338,163 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 10,334,090 - 10,338,216 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 9,331,184 - 9,335,243 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Celera 9 6,962,202 - 6,966,261 (-) NCBI Celera Cytogenetic Map 9 q11 NCBI
NDUFA11 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 5,891,229 - 5,903,790 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 5,891,207 - 5,904,006 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 5,891,240 - 5,903,801 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 5,845,686 - 5,855,025 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 5,845,685 - 5,855,025 NCBI Celera 19 5,830,248 - 5,842,986 (-) NCBI Celera Cytogenetic Map 19 p13.3 NCBI HuRef 19 5,650,763 - 5,663,502 (-) NCBI HuRef CHM1_1 19 5,891,532 - 5,904,277 (-) NCBI CHM1_1 T2T-CHM13v2.0 19 5,878,657 - 5,891,220 (-) NCBI T2T-CHM13v2.0
Ndufa11 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 57,024,762 - 57,031,248 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 57,024,767 - 57,029,141 (+) Ensembl GRCm39 Ensembl GRCm38 17 56,717,762 - 56,724,248 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 56,717,767 - 56,722,141 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 56,857,185 - 56,863,671 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 17 56,402,886 - 56,407,816 (+) NCBI MGSCv36 mm8 Celera 17 61,061,897 - 61,068,383 (+) NCBI Celera Cytogenetic Map 17 D NCBI cM Map 17 29.47 NCBI
Ndufa11 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955495 3,557,016 - 3,564,999 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955495 3,557,016 - 3,564,999 (+) NCBI ChiLan1.0 ChiLan1.0
NDUFA11 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 10,295,409 - 10,304,660 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 9,521,617 - 9,530,800 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 4,912,557 - 4,925,203 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 5,843,085 - 5,854,846 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 5,843,085 - 5,854,797 (-) Ensembl panpan1.1 panPan2
NDUFA11 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 54,183,584 - 54,189,435 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 53,927,083 - 53,932,783 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 54,834,771 - 54,840,499 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 54,834,781 - 54,840,496 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 53,901,171 - 53,906,885 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 54,350,035 - 54,355,744 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 54,580,210 - 54,585,910 (+) NCBI UU_Cfam_GSD_1.0
Ndufa11 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 214,444,923 - 214,451,109 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936588 3,383,509 - 3,390,087 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936588 3,383,674 - 3,389,862 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
NDUFA11 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 73,130,403 - 73,137,916 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 73,131,029 - 73,137,921 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 73,675,744 - 73,682,635 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
NDUFA11 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 6 5,517,871 - 5,529,754 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 6 5,517,797 - 5,529,455 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666081 2,507,925 - 2,515,866 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ndufa11
.
Predicted Target Of
Count of predictions: 99 Count of miRNA genes: 85 Interacting mature miRNAs: 88 Transcripts: ENSRNOT00000070862 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
70226 Eae4 Experimental allergic encephalomyelitis QTL 4 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 9 1 25661317 Rat 10054141 Gmadr4 Adrenal mass QTL 4 2.45 0.0074 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 9 1 14209783 Rat 9589158 Gluco65 Glucose level QTL 65 6.82 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 9 1 37999212 Rat 10054125 Srcrt7 Stress Responsive Cort QTL 7 3.33 0.0011 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 9 1 87073594 Rat 2303559 Gluco54 Glucose level QTL 54 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 9 1254084 46254084 Rat 7411592 Foco8 Food consumption QTL 8 7.4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 9 1 37999212 Rat 1331757 Cdexp1 CD45RC expression in CD8 T cells QTL 1 4.3 CD8-positive T cell quantity (VT:0008077) blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990) 9 1024537 67509080 Rat 1298088 Edpm11 Estrogen-dependent pituitary mass QTL 11 2.5 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 9 1 43718459 Rat 9589055 Scfw5 Subcutaneous fat weight QTL 5 5.55 0.001 subcutaneous adipose mass (VT:1000472) abdominal subcutaneous fat pad weight (CMO:0002069) 9 1 37999212 Rat 1641911 Alcrsp13 Alcohol response QTL 13 response to alcohol trait (VT:0010489) brain neurotensin receptor 1 density (CMO:0002068) 9 1 43718459 Rat 1354650 Despr5 Despair related QTL 5 4.01 0.0017 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 9 1254084 46254084 Rat 1300124 Cm4 Cardiac mass QTL 4 3.55 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 9 1 40594091 Rat
RH143940
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 9 1,554,550 - 1,554,773 (-) MAPPER mRatBN7.2 Rnor_6.0 9 10,333,877 - 10,334,099 NCBI Rnor6.0 Rnor_5.0 9 9,330,957 - 9,331,179 UniSTS Rnor5.0 Celera 9 6,961,975 - 6,962,197 UniSTS Cytogenetic Map 9 q11 UniSTS
AA818971
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 1 230,501,526 - 230,501,725 (+) Marker Load Pipeline RH 3.4 Map 2 1662.03 UniSTS Cytogenetic Map 9 q11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000070862 ⟹ ENSRNOP00000064246
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 9 1,550,468 - 1,555,601 (+) Ensembl Rnor_6.0 Ensembl 9 10,334,090 - 10,338,216 (-) Ensembl
RefSeq Acc Id:
NM_212517 ⟹ NP_997682
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 1,637,614 - 1,641,673 (+) NCBI mRatBN7.2 9 1,550,487 - 1,554,546 (+) NCBI Rnor_6.0 9 10,334,104 - 10,338,163 (-) NCBI Rnor_5.0 9 9,331,184 - 9,335,243 (-) NCBI Celera 9 6,962,202 - 6,966,261 (-) RGD
Sequence:
GAGCTCGTCCAAACGCCGTAAAGTCTGCTAGGCTGGCTAGGTACGGCCATGGCCAAGCGGTTTTTCGAAGCCTACAATGAGACCCCCGACGGCACCCAGTGTCATCGCAAGGCCTACATCACTACTGC
hide sequence
RefSeq Acc Id:
NP_997682 ⟸ NM_212517
- UniProtKB:
Q80W89 (UniProtKB/Swiss-Prot), A6KQV2 (UniProtKB/TrEMBL), A0A8L2QX46 (UniProtKB/TrEMBL)
- Sequence:
MAKRFFEAYNETPDGTQCHRKAYITTALGGLCGLISSAYSITHNPADSPLEAVARVGRFTFTAAAIGAMFGLTTCVSAQVREKPDDPLNYFIGGCAGGLTLGARTHSYGTAAIGCVYMGTAAALFKMG
hide sequence
Ensembl Acc Id:
ENSRNOP00000064246 ⟸ ENSRNOT00000070862
RGD ID: 13696452 Promoter ID: EPDNEW_R6977 Type: initiation region Name: Ndufa11_1 Description: NADH:ubiquinone oxidoreductase subunit A11 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 9 10,338,169 - 10,338,229 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-12-01
Ndufa11
NADH:ubiquinone oxidoreductase subunit A11
Ndufa11
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 11
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-11-17
Ndufa11
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 11
LOC301123
RE70703p-like
Symbol and Name updated
1299863 APPROVED
2005-09-30
LOC301123
Symbol and Name status set to provisional
70820 PROVISIONAL
