Advanced Search (OLGA)

Gene: Exoc4 (exocyst complex component 4) Rattus norvegicus

Analyze

Symbol:

Exoc4

Name:

exocyst complex component 4

RGD ID:

621791

Description:

Enables PDZ domain binding activity and ionotropic glutamate receptor binding activity. Involved in several processes, including Golgi to transport vesicle transport; oligodendrocyte differentiation; and regulation of protein localization. Located in several cellular components, including dendritic shaft; growth cone; and postsynaptic density. Part of protein-containing complex. Is active in Schaffer collateral - CA1 synapse; postsynaptic density, intracellular component; and synaptic vesicle. Orthologous to human EXOC4 (exocyst complex component 4); PARTICIPATES IN E-cadherin signaling pathway; insulin signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; acetamide; aflatoxin B1.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

ALR; augmenter of liver regeneration (ALR) pseudogene; exocyst complex component Sec8; rSec8; Sec8; SEC8-like 1; SEC8-like 1 (S. cerevisiae); Sec8l1; secretory protein SEC8

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	EXOC4 (exocyst complex component 4)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, Panther
Mus musculus (house mouse):	Exoc4 (exocyst complex component 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Exoc4 (exocyst complex component 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	EXOC4 (exocyst complex component 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	EXOC4 (exocyst complex component 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	EXOC4 (exocyst complex component 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	EXOC4 (exocyst complex component 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Exoc4 (exocyst complex component 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Exoc4 (exocyst complex component 4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	EXOC4 (exocyst complex component 4)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	exoc4 (exocyst complex component 4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	SEC8	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Sec8	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	sec-8	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	exoc4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Allele / Splice:

Exoc4^{Tn(sb-T2/Bart3)2.317Mcwi}

Genetic Models:

F344-Exoc4^{Tn(sb-T2/Bart3)2.317Mcwi}

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	62,774,896 - 63,551,541 (+)	NCBI		GRCr8
mRatBN7.2	4	61,807,706 - 62,584,316 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	61,807,761 - 62,585,723 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	66,761,366 - 67,530,050 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	62,677,087 - 63,445,752 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	61,079,497 - 61,848,170 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	60,549,128 - 61,358,305 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	60,549,197 - 61,355,994 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	60,287,465 - 60,839,820 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Rnor_5.0	4	60,913,238 - 61,081,401 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	60,406,942 - 61,284,294 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	60,683,071 - 61,559,840 (+)	NCBI
Celera	4	56,882,713 - 57,637,636 (+)	NCBI		Celera
Cytogenetic Map	4	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Meckel syndrome (ISO)

pleomorphic xanthoastrocytoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-tribromophenol (ISO)

2-acetamidofluorene (ISO)

2-methylcholine (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

acetamide (EXP)

acrolein (ISO)

aflatoxin B1 (EXP,ISO)

alpha-pinene (ISO)

amphetamine (EXP)

aristolochic acid A (ISO)

Aroclor 1254 (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

benzo[b]fluoranthene (ISO)

bis(2-chloroethyl) sulfide (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

cadmium dichloride (ISO)

caffeine (ISO)

chlorpyrifos (ISO)

chrysene (ISO)

cisplatin (EXP,ISO)

clothianidin (ISO)

copper(II) sulfate (ISO)

decabromodiphenyl ether (ISO)

dibenz[a,h]anthracene (ISO)

dibutyl phthalate (EXP)

dorsomorphin (ISO)

doxorubicin (ISO)

endosulfan (EXP)

etoposide (ISO)

formaldehyde (ISO)

glyphosate (EXP)

irinotecan (ISO)

ivermectin (ISO)

methoxychlor (EXP)

methylmercury chloride (ISO)

mitomycin C (ISO)

N,N-diethyl-m-toluamide (EXP)

N-nitrosodiethylamine (ISO)

N-Nitrosopyrrolidine (ISO)

O-methyleugenol (ISO)

oxaliplatin (EXP)

ozone (ISO)

paracetamol (EXP)

permethrin (EXP)

pirinixic acid (ISO)

potassium chromate (ISO)

quercetin (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

sodium dichromate (EXP)

temozolomide (ISO)

tetrachloromethane (EXP,ISO)

tetraphene (ISO)

thapsigargin (ISO)

thioacetamide (EXP)

thiram (ISO)

topotecan (EXP)

trichostatin A (ISO)

triphenyl phosphate (ISO)

Triptolide (ISO)

troglitazone (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

chemical synaptic transmission (IBA,IMP)

establishment of cell polarity (IMP)

exocytosis (IBA)

Golgi to plasma membrane transport (IBA,IEA)

Golgi to transport vesicle transport (IDA)

membrane biogenesis (IMP)

oligodendrocyte differentiation (IMP)

paraxial mesoderm formation (IEA,ISO)

positive regulation of calcium-mediated signaling (IMP)

protein targeting to membrane (IEA,IMP)

protein transmembrane transport (IEA,ISO)

protein transport (IEA)

regulation of neurotransmitter receptor localization to postsynaptic specialization membrane (IDA,IMP)

regulation of protein transport (IMP)

vesicle docking involved in exocytosis (IEA)

vesicle targeting (TAS)

vesicle tethering involved in exocytosis (IEA)

Cellular Component

cell leading edge (IDA)

centrosome (IEA,ISO,ISS)

cytoplasm (ISO)

dendrite (IDA)

dendritic shaft (IDA)

endosome (IDA)

exocyst (IBA,IEA,TAS)

Flemming body (IEA)

growth cone (IDA)

growth cone membrane (IBA,IEA,ISO)

microvillus (IEA,ISO)

myelin sheath abaxonal region (IEA,ISO)

neuron projection (IDA,ISO)

neuronal cell body (IDA)

postsynaptic density (IDA)

postsynaptic density, intracellular component (IDA)

protein-containing complex (IDA)

Schaffer collateral - CA1 synapse (IDA)

synapse (IBA,IDA)

synaptic vesicle (EXP,IDA)

Molecular Function

ionotropic glutamate receptor binding (IPI)

PDZ domain binding (IDA,IEA,IPI,ISO)

protein binding (IPI,ISO)

protein-containing complex binding (IDA)

Molecular Pathway Annotations Click to see Annotation Detail View

E-cadherin signaling pathway (ISO)

insulin signaling pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	A role for Sec8 in oligodendrocyte morphological differentiation.	Anitei M, etal., J Cell Sci. 2006 Mar 1;119(Pt 5):807-18. Epub 2006 Feb 14.
2.	The glycine transporter GLYT1 interacts with Sec3, a component of the exocyst complex.	Cubelos B, etal., Neuropharmacology. 2005 Nov;49(6):935-44. doi: 10.1016/j.neuropharm.2005.07.021. Epub 2005 Sep 21.
3.	Activity-dependent synaptic GRIP1 accumulation drives synaptic scaling up in response to action potential blockade.	Gainey MA, etal., Proc Natl Acad Sci U S A. 2015 Jul 7;112(27):E3590-9. doi: 10.1073/pnas.1510754112. Epub 2015 Jun 24.
4.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.	Dual role of the exocyst in AMPA receptor targeting and insertion into the postsynaptic membrane.	Gerges NZ, etal., EMBO J. 2006 Apr 19;25(8):1623-34. Epub 2006 Apr 6.
6.	MyRIP anchors protein kinase A to the exocyst complex.	Goehring AS, etal., J Biol Chem. 2007 Nov 9;282(45):33155-67. Epub 2007 Sep 7.
7.	RalA and the exocyst complex influence neuronal polarity through PAR-3 and aPKC.	Lalli G J Cell Sci. 2009 May 15;122(Pt 10):1499-506. Epub 2009 Apr 21.
8.	GRIP1 and 2 regulate activity-dependent AMPA receptor recycling via exocyst complex interactions.	Mao L, etal., Proc Natl Acad Sci U S A. 2010 Nov 2;107(44):19038-43. doi: 10.1073/pnas.1013494107. Epub 2010 Oct 18.
9.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
10.	SH3BP1, an exocyst-associated RhoGAP, inactivates Rac1 at the front to drive cell motility.	Parrini MC, etal., Mol Cell. 2011 Jun 10;42(5):650-61. doi: 10.1016/j.molcel.2011.03.032.
11.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
12.	GOA pipeline	RGD automated data pipeline
13.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
14.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
15.	Exocyst complex subunit sec8 binds to postsynaptic density protein-95 (PSD-95): a novel interaction regulated by cypin (cytosolic PSD-95 interactor).	Riefler GM, etal., Biochem J. 2003 Jul 1;373(Pt 1):49-55.
16.	An aPKC-exocyst complex controls paxillin phosphorylation and migration through localised JNK1 activation.	Rosse C, etal., PLoS Biol. 2009 Nov;7(11):e1000235. Epub 2009 Nov 3.
17.	NMDA receptor trafficking through an interaction between PDZ proteins and the exocyst complex.	Sans N, etal., Nat Cell Biol. 2003 Jun;5(6):520-30.
18.	Arl13b and the exocyst interact synergistically in ciliogenesis.	Seixas C, etal., Mol Biol Cell. 2016 Jan 15;27(2):308-20. doi: 10.1091/mbc.E15-02-0061. Epub 2015 Nov 18.
19.	The mammalian Sec6/8 complex interacts with Ca(2+) signaling complexes and regulates their activity.	Shin DM, etal., J Cell Biol. 2000 Sep 4;150(5):1101-12.
20.	Molecular anatomy of a trafficking organelle.	Takamori S, etal., Cell. 2006 Nov 17;127(4):831-46.
21.	rSec6 and rSec8, mammalian homologs of yeast proteins essential for secretion.	Ting AE, etal., Proc Natl Acad Sci U S A 1995 Oct 10;92(21):9613-7.

Additional References at PubMed

PMID:9441674	PMID:11406615	PMID:17086175	PMID:18480549	PMID:19587293	PMID:19946888	PMID:20237282	PMID:21389209	PMID:24056301	PMID:30053369

Genomics

Comparative Map Data

Exoc4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	62,774,896 - 63,551,541 (+)	NCBI		GRCr8
mRatBN7.2	4	61,807,706 - 62,584,316 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	61,807,761 - 62,585,723 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	66,761,366 - 67,530,050 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	62,677,087 - 63,445,752 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	61,079,497 - 61,848,170 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	60,549,128 - 61,358,305 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	60,549,197 - 61,355,994 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	60,287,465 - 60,839,820 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Rnor_5.0	4	60,913,238 - 61,081,401 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	60,406,942 - 61,284,294 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	60,683,071 - 61,559,840 (+)	NCBI
Celera	4	56,882,713 - 57,637,636 (+)	NCBI		Celera
Cytogenetic Map	4	q22	NCBI

EXOC4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	133,253,078 - 134,100,951 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	133,253,072 - 134,067,137 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	7	132,937,834 - 133,750,514 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	132,588,363 - 133,401,054 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	7	132,395,083 - 133,207,766	NCBI
Celera	7	127,689,360 - 128,501,714 (+)	NCBI		Celera
Cytogenetic Map	7	q33	NCBI
HuRef	7	127,253,094 - 128,065,500 (+)	NCBI		HuRef
CHM1_1	7	132,872,749 - 133,685,075 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	7	134,574,528 - 135,422,862 (+)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	132,277,237 - 133,089,663 (+)	NCBI

Exoc4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	33,226,025 - 33,950,914 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	33,226,020 - 33,950,914 (+)	Ensembl		GRCm39 Ensembl
GRCm38	6	33,249,090 - 33,973,979 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	33,249,085 - 33,973,979 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	33,199,150 - 33,922,943 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	33,179,308 - 33,903,101 (+)	NCBI		MGSCv36	mm8
Celera	6	33,234,875 - 33,967,226 (+)	NCBI		Celera
Cytogenetic Map	6	A3.3	NCBI
cM Map	6	14.59	NCBI

Exoc4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955410	33,935,320 - 34,673,764 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955410	33,937,825 - 34,672,790 (-)	NCBI	ChiLan1.0	ChiLan1.0

EXOC4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	170,083,599 - 170,888,092 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	22,093,854 - 22,898,347 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	125,226,107 - 126,030,486 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	137,734,349 - 138,537,446 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	137,734,400 - 138,536,214 (+)	Ensembl	panpan1.1		panPan2

EXOC4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	14	3,334,286 - 4,077,478 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	14	3,334,220 - 4,077,411 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	14	2,990,436 - 3,736,256 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	14	3,063,572 - 3,812,726 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	14	3,063,572 - 3,812,695 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	14	3,267,885 - 4,015,200 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	14	3,012,296 - 3,761,501 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	14	3,158,194 - 3,902,305 (-)	NCBI		UU_Cfam_GSD_1.0

EXOC4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	18	15,105,138 - 15,906,707 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	18	15,105,152 - 15,906,734 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	18	16,661,831 - 16,935,462 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

EXOC4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	21	101,885,192 - 102,694,892 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666042	666,279 - 1,487,617 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Exoc4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624783	2,316,300 - 3,165,255 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624783	2,315,128 - 3,165,343 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Exoc4
3663 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	1525
Count of miRNA genes:	303
Interacting mature miRNAs:	402
Transcripts:	ENSRNOT00000071249, ENSRNOT00000075621
Prediction methods:	Microtar, Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1358352	Srcrt3	Stress Responsive Cort QTL 3	2.29		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	38465774	146803430	Rat
1549843	Bw53	Body weight QTL 53		0.0001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	61697658	103194791	Rat
61445	Strs3	Sensitivity to stroke QTL 3	3		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	4	40433388	85433388	Rat
6893678	Bw108	Body weight QTL 108	2.6	0.006	body mass (VT:0001259)	body weight (CMO:0000012)	4	43457976	88457976	Rat
10755501	Bp390	Blood pressure QTL 390	2.5		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	4	26775591	168368347	Rat
1358363	Sradr3	Stress Responsive Adrenal Weight QTL 3	6.19		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	4	57486946	102486946	Rat
61336	Bp21	Blood pressure QTL 21	4.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	57114705	78881294	Rat
1549839	Bw52	Body weight QTL 52		0.0001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	61697658	115089733	Rat
2313401	Anxrr27	Anxiety related response QTL 27			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	4	17933508	62933508	Rat
6909128	Pancm4	Pancreatic morphology QTL 4	11.35		pancreas mass (VT:0010144)	pancreas wet weight (CMO:0000626)	4	26907285	75585128	Rat
61475	Aia2	Adjuvant induced arthritis QTL 2	5.8		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	39505275	73892441	Rat
8694439	Bw168	Body weight QTL 168	9.57	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	4	40433414	85433414	Rat
8655906	Rf60	Renal function QTL 60	3.8		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	4	29494195	81006281	Rat
7387227	Uae40	Urinary albumin excretion QTL 40	2.9	0.0052	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	4	17946999	62946999	Rat
6909122	Insul22	Insulin level QTL 22	4.63		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	4	26907285	75585128	Rat
1354660	Salc1	Saline consumption QTL 1	11.26		drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	4	44463908	148090542	Rat
2300179	Bmd50	Bone mineral density QTL 50	5.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	4	60928534	105928534	Rat
1298082	Stresp4	Stress response QTL 4			blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	50119848	146803430	Rat
1300139	Hrtrt6	Heart rate QTL 6	2.85		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	39524264	116179656	Rat
70200	Alc18	Alcohol consumption QTL 18	9.2		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	4	56647873	149491524	Rat
1578657	Bss12	Bone structure and strength QTL 12	8.9		femur morphology trait (VT:0000559)	femoral neck cross-sectional area (CMO:0001697)	4	60220938	105220938	Rat
1578658	Bss13	Bone structure and strength QTL 13	8		femur strength trait (VT:0010010)	femoral neck polar moment of inertia (CMO:0001670)	4	60220938	105220938	Rat
4889969	Bss96	Bone structure and strength QTL 96	4.9		tibia size trait (VT:0100001)	tibia cortical bone volume (CMO:0001725)	4	56647776	78882945	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	11320076	180699135	Rat
4889972	Bss97	Bone structure and strength QTL 97	5.6		tibia size trait (VT:0100001)	tibia total bone volume (CMO:0001724)	4	56647776	78882945	Rat
5685012	Bmd87	Bone mineral density QTL 87	5.1		tibia mineral mass (VT:1000283)	bone mineral content (CMO:0001554)	4	56647776	78882945	Rat
5685009	Bmd86	Bone mineral density QTL 86	3.7		tibia mineral mass (VT:1000283)	bone mineral density (CMO:0001226)	4	56647776	78882945	Rat
1331807	Rf31	Renal function QTL 31	2.988		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	4	39524264	74726312	Rat
8552782	Vie1	Viral induced encephalitis QTL 1	26.4		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	4	34430484	82490359	Rat
634311	Sach7	Saccharin preference QTL 7			taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	57114432	81266970	Rat
738009	Sach4	Saccharine consumption QTL 4	4.9	0.000016	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	59948935	154902892	Rat
631261	Tcas3	Tongue tumor susceptibility QTL 3	6.88		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	4	10814170	91360527	Rat
2312567	Glom19	Glomerulus QTL 19	1.9	0.006	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	4	45456990	146803430	Rat
8655961	Kidm43	Kidney mass QTL 43	18		kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	4	36303261	103194984	Rat
1354612	Foco1	Food consumption QTL 1	8.87		eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	4	44463908	148090542	Rat
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5214602	146446691	Rat
8552801	Bw143	Body weight QTL 143	7.3		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	4	34430484	82490359	Rat
61412	Pia2	Pristane induced arthritis QTL 2	3.9		joint integrity trait (VT:0010548)	post-insult time to onset of experimental arthritis (CMO:0001450)	4	21333343	62278020	Rat
738031	Alc14	Alcohol consumption QTL 14	7.6	0.00003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
619616	Bp79	Blood pressure QTL 79		0.0292	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	5214602	78882945	Rat
1576305	Emca6	Estrogen-induced mammary cancer QTL 6	5.8		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	4	44463720	155883716	Rat
61418	Pia5	Pristane induced arthritis QTL 5	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	62277855	128289560	Rat
8552809	Vie5	Viral induced encephalitis QTL 5	25.3		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	4	34430484	82490359	Rat
738016	Alc16	Alcohol consumption QTL 16	3.6	0.00015	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
1558651	Swd3	Spike wave discharge measurement QTL 3	4.62	0.000024	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge frequency (CMO:0001742)	4	58432133	92991462	Rat
1358203	Stl19	Serum triglyceride level QTL 19	2.8	0.002	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	5218294	65958103	Rat
1641833	Alc21	Alcohol consumption QTL 21	8.6	0.0001	drinking behavior trait (VT:0001422)	ethanol drink intake rate (CMO:0001407)	4	56698790	126192555	Rat
631546	Bp86	Blood pressure QTL 86	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	57114432	91360801	Rat
12798520	Anxrr55	Anxiety related response QTL 55	4.45	0.01	locomotor behavior trait (VT:0001392)	number of rearing movements with lid-pushing in an experimental apparatus (CMO:0002715)	4	32583980	114627242	Rat
631671	Iddm11	Insulin dependent diabetes mellitus QTL 11	3.6	0.0012	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	4	58635877	78886137	Rat

Markers in Region

D4Rat22

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	62,277,855 - 62,278,020 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	61,038,901 - 61,039,065	NCBI	Rnor6.0
Rnor_5.0	4	60,769,721 - 60,769,885	UniSTS	Rnor5.0
RGSC_v3.4	4	60,974,346 - 60,974,511	RGD	RGSC3.4
RGSC_v3.4	4	60,974,347 - 60,974,511	UniSTS	RGSC3.4
RGSC_v3.1	4	61,250,477 - 61,250,641	RGD
Celera	4	57,345,999 - 57,346,163	UniSTS
RH 3.4 Map	4	372.0	RGD
RH 3.4 Map	4	372.0	UniSTS
RH 2.0 Map	4	420.2	RGD
SHRSP x BN Map	4	32.92	RGD
Cytogenetic Map	4	q22	UniSTS

WI-14795

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	62,040,245 - 62,040,395 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	60,782,539 - 60,782,688	NCBI	Rnor6.0
Rnor_5.0	4	60,523,379 - 60,523,528	UniSTS	Rnor5.0
RGSC_v3.4	4	60,645,105 - 60,645,254	UniSTS	RGSC3.4
Celera	4	57,111,999 - 57,112,148	UniSTS
Cytogenetic Map	4	q22	UniSTS

RH131294

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	61,830,729 - 61,830,911 (+)	MAPPER	mRatBN7.2
mRatBN7.2	10	71,323,979 - 71,324,161 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	73,821,382 - 73,821,563	NCBI	Rnor6.0
Rnor_6.0	4	60,572,121 - 60,572,302	NCBI	Rnor6.0
Rnor_5.0	10	76,278,016 - 76,278,197	UniSTS	Rnor5.0
Rnor_5.0	4	60,310,219 - 60,310,400	UniSTS	Rnor5.0
RGSC_v3.4	4	60,430,567 - 60,430,748	UniSTS	RGSC3.4
RGSC_v3.4	10	76,654,206 - 76,654,387	UniSTS	RGSC3.4
Celera	10	70,245,705 - 70,245,886	UniSTS
Celera	4	56,905,674 - 56,905,855	UniSTS
Cytogenetic Map	4	q22	UniSTS

RH131455

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	62,178,051 - 62,178,247 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	60,922,688 - 60,922,883	NCBI	Rnor6.0
Rnor_5.0	4	60,657,937 - 60,658,132	UniSTS	Rnor5.0
RGSC_v3.4	4	60,784,776 - 60,784,971	UniSTS	RGSC3.4
Celera	4	57,249,959 - 57,250,154	UniSTS
RH 3.4 Map	4	372.0	UniSTS
Cytogenetic Map	4	q22	UniSTS

RH143015

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	61,820,740 - 61,820,848 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	60,562,160 - 60,562,267	NCBI	Rnor6.0
Rnor_5.0	4	60,300,428 - 60,300,535	UniSTS	Rnor5.0
RGSC_v3.4	4	60,419,905 - 60,420,012	UniSTS	RGSC3.4
Celera	4	56,895,674 - 56,895,781	UniSTS
RH 3.4 Map	4	368.3	UniSTS
Cytogenetic Map	4	q22	UniSTS

BE110230

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	61,904,692 - 61,904,856 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	60,641,308 - 60,641,471	NCBI	Rnor6.0
Rnor_5.0	4	60,384,009 - 60,384,172	UniSTS	Rnor5.0
RGSC_v3.4	4	60,507,690 - 60,507,853	UniSTS	RGSC3.4
Celera	4	56,978,290 - 56,978,453	UniSTS
RH 3.4 Map	4	397.7	UniSTS
Cytogenetic Map	4	q22	UniSTS

BF396724

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	62,275,150 - 62,275,293 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	61,036,196 - 61,036,338	NCBI	Rnor6.0
Rnor_5.0	4	60,767,016 - 60,767,158	UniSTS	Rnor5.0
RGSC_v3.4	4	60,971,642 - 60,971,784	UniSTS	RGSC3.4
Celera	4	57,343,294 - 57,343,436	UniSTS
RH 3.4 Map	4	372.0	UniSTS
Cytogenetic Map	4	q22	UniSTS

AU047597

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	62,158,210 - 62,158,383 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	60,897,303 - 60,897,475	NCBI	Rnor6.0
Rnor_5.0	4	60,638,022 - 60,638,194	UniSTS	Rnor5.0
RGSC_v3.4	4	60,764,601 - 60,764,773	UniSTS	RGSC3.4
Celera	4	57,229,593 - 57,229,759	UniSTS
Cytogenetic Map	4	q22	UniSTS

RH136778

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	62,585,477 - 62,585,598 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	61,357,154 - 61,357,274	NCBI	Rnor6.0
Rnor_5.0	4	61,082,561 - 61,082,681	UniSTS	Rnor5.0
RGSC_v3.4	4	61,285,454 - 61,285,574	UniSTS	RGSC3.4
Celera	4	57,638,796 - 57,638,916	UniSTS
RH 3.4 Map	4	370.4	UniSTS
Cytogenetic Map	4	q22	UniSTS

Genetic Models

This gene Exoc4 is modified in the following models/strains:

F344-Exoc4^{Tn(sb-T2/Bart3)2.317Mcwi}

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053875	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017592394	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039106942	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039106944	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF190019	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473959	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FM107548	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U32498	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000071249 ⟹ ENSRNOP00000064888

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	61,807,761 - 62,054,122 (+)	Ensembl
Rnor_6.0 Ensembl	4	60,549,197 - 61,355,410 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000075621 ⟹ ENSRNOP00000066892

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	61,807,774 - 62,585,723 (+)	Ensembl
Rnor_6.0 Ensembl	4	60,549,197 - 61,355,994 (+)	Ensembl

RefSeq Acc Id:

NM_053875 ⟹ NP_446327

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	62,774,967 - 63,551,541 (+)	NCBI
mRatBN7.2	4	61,807,778 - 62,584,316 (+)	NCBI
Rnor_6.0	4	60,549,197 - 61,355,994 (+)	NCBI
Rnor_5.0	4	60,287,465 - 60,839,820 (+)	NCBI
Rnor_5.0	4	60,913,238 - 61,081,401 (+)	NCBI
RGSC_v3.4	4	60,406,942 - 61,284,294 (+)	RGD
Celera	4	56,882,713 - 57,637,636 (+)	RGD

Sequence:

show sequence

ATGGCGGCAGAAGCAGCTGGTGGGAAATACAGGAGCACAGTCAGCAAAAGCAAAGACCCCTCGG
GGCTGCTCATCTCGGTGATCAGGACTCTGTCTACCAGTGATGATGTTGAAGACCGAGAAAATGA
GAAAGGTCGCCTTGAAGAAGCCTATGAGAAGTGTGACCGTGACCTGGATGAATTGATCGTTCAG
CACTACACAGAATTGACAACAGCCATTCGCACATACCAGAGCATCACAGAACGCATCACTAACT
CCAGGAATAAAATCAAGCAGGTAAAAGAGAACCTGCTTTCCTGCAAGATGCTGTTGCATTGCAA
ACGGGATGAGCTTCGTAAACTATGGATTGAAGGAATTGAGCATAAGCATGTCCTGAACCTTCTG
GATGAGATTGAAAACATCAAGCAAGTGCCTCAAAAGCTGGAACAGTGCATGGCCAGCAAGCACT
ACCTCAGCGCCACGGACATGCTGGTGTCAGCAGTGGAGTCTCTGGAGGGTCCGCTGCTCCAGGT
GGAAGGACTCAGTGACCTCAGGCTGGAACTTCACAGCAAGAAGATGAACCTGCACTTGGTTCTC
ATAGAGGAACTGCACCGACATCTGTACATCAAATCCACTAGCCGGGTTGTACAGCGTAACAAGG
AAAAAGGGAAGATGAGTTCTCATGGCAAAGATGCTTCTCCTGGTCCTCTGATTGATGTTTCAAA
CATCTCTACTCCACGCAAATTCCTTGATGCCACTCAATATTCTGCTGCTGGAAGCTCAAGTGTG
AGGGAGATGAACCTGCAGGACATCAAAGAGGACTTGGACTGTGATCCTGAGGAGAACAGCACTC
TTTTCATGGGAATTCTTATTCAGGGGCTGGCCAGACTGAAGAAGATCCCTGAGACCGTTAAAGC
CATTAAAGAGCGTTTGGAGCAGGAGCTAAAGCAGATTGTGAAGAGGTCAACCACCCAGGTGGCA
GACAGTGCCTATCAGAGGGGAGAGAGCCTCACTGTGGACAACCAGCCAAGGTTACTTCTAGAAC
TGCTGGAACTGTTGTTTGATAAGTTTAATGCTGTAGCCAGTGCACATTCTATAGTCCTGGGGTA
CCTTCAGGACTCTGTGGGGACCCAGCCAACACAGCAGGAAGAGATCAAATTATACGATATGGCA
GATGTGTGGGTGAAGATCCAGGATGTGCTGCAGATGCTGTTGACTGAATACTTGGATATGAAGA
ACACACGTACTGCGTCAGAGCCGTCAGCTCAACTAAGCTATGCCAGTACTGGACGAGAGTTCGC
AGCCTTTTTTGCCAAGAAGAAACCACAAAGGCCAAAGAATTCTCTTTTCAAGTTTGAATCATCC
TCCCATGCTATCAGTATGAGCGCCTATCTCCGAGAACAGAGAAGGGAGCTGTACAGTCGGAGTG
GAGAACTTCAAGGAGGTCCTGATGACAACTTAATTGAAGGTGGAGGAACAAAATTTGTCTGCAA
ACCTGGAGCCAGAAATATTACCGTCATATTCCATCCACTGCTGAGATTTATTCAGGAGATTGAG
CATGCCCTGGGACTTGGCCCTGCCAAACAGTGTCTCCTTCGAGAGTTTCTCACTATATATATCA
AGAACATCTTCCTTAATCAGGTCTTGACTGAGATCAACAAGGAGATCGAAGGTGTCACCAAAAC
CTCAGACCCCTTGAAGATCCTAGCTAATGCAGACACCATGAAGGTTCTGGGCGTGCAGAGGCCT
CTTCTACAGAGCACCATCATCGTGGAGAAGACAGTACAAGACCTCATGAACCTGATGCATGACT
TGAGTGCATATTCAGATCAGTTCCTCAACATGGTGTGTGTGAAGCTACAGGAATACAAGGACAC
ATGCTCCACAGCCTACAGAGGCATTGTCCAATCAGAAGAGAAACTTGTCATCAGTGCATCTTGG
GCAAAAGATGATGATATCAGCAGACTCTTGAAATCACTGCCGAACTGGACTAACATGGCTCAGC
CCAAACAGCTAAGGCCTAAGAGAGAGGAGGAGGAAGACTTCATAAGGGCAGCCTTTGGCAAGGA
GTCTGAGGTTCTGATTGGAAACCTTGGTGACAAACTCATTCCTCCACAAGATATTCTCCGTGAC
GTCAGTGACCTCAAAGCCTTGGCCAACATGCATGAAAGCCTGGAATGGCTGGCAGGCCGAACAA
AGTCAGCTTTCTCCAGCCTTTCTGCATCCCAGATGCTTTCCCCTGCTCAAGAGAGCCACGTAAA
CATGGACCTTCCTCCAGTGTCTGAACAGATCATGCAGACGCTGAGTGAACTTGCCAAGTCCTTC
CAGGACATGGCTGACCGCTGCTTGCTCGTCTTGCATCTGGAAGTGAGAGTTCATTGTTTCCACT
ATCTCATCCCTCTGGCAAAGGAGGGGAACTATGCCATTGTGGCCAATGTGGAAAGCATGGATTA
TGACCCTTTAGTGGTCAAGCTCAACAAAGACATCAGTGCCATGGAAGAGGCCATGAGCGCCAGC
CTCCAGCAACACAAGTTCCAGTACATCTTCGAAGGTCTGGGACACCTCATCTCCTGTATCCTCA
TTAATGGGGCTCAGTACTTCCGGCGCATCAGTGAGTCTGGCATCAAGAAAATGTGTAGAAACAT
TTTTGTTCTTCAGCAGAATTTGACCAACATCACCATGTCACGGGAGGCAGACTTGGACTTTGCA
AGACAGTACTACGAGATGCTGTACAACACTGCTGATGAGCTCCTGAACCTGGTGGTGGACCAGG
GTGTGAAATACACAGAGCTAGAGTACATCCATGCCCTGACCCTGCTGCACCGAAGCCAGACTGG
CGTGGGGGACCAGACCACCCAGAACACCAGGCTGCAGAGACTCAAGGAGATCATCTGTGAGCAG
GCTGCCATCAAGCAAGCCACCAAGGACAAGAAAATAACCACTGTGTGATGGGGTGTGGGTGGGT
TCACGGTGTGCACAGACACAGGCTCTAGCTCCTCAGCCTGAGCTGGCTGTGCTTTGTCCACCCT
GATGCTTAGTGGGTAGATGGTGGATTATTTTCTCTTAGTTTTGCTTTTCTATATGAATGCTAAG
AAAGTTTGCAGGACAGAATGTTTTGCCTAATAACTACTTTAGTCTATTCCCAAGGGATGAGGGT
GGAACAGGGAGGAGACCATGTCAAGTTGCTGGACTCAGAAAGGAATGAAGGAAAGCCAACTGCC
ACTTAAGTTTTAGAACCATCCTGAAATGCCAAGTAAGGCCTGTGGCATGAGCAGTGGGCTTTCT
CTTGTCTTAGCCTTGTCAGTTTATAATTCAGTGTAATAAGTATGTGCACATTGCTTTGTCTGCA
TTGCCAAAATCAAAGCGCTTCTCAGCTGGCTTCCCAATCCAAAACAGATCTCTTTAAGGCTGGG
GATAGCAGTCCTTTATCCCAACCCTGGGACAGATTGCACCTATACCAGGACTGCTCGCAGGCTG
CTGATTGGTTTTACAACCTTTTTATTTTATTCCTTCTGTATTAAAACCAGTTA

hide sequence

RefSeq Acc Id:

XM_039106942 ⟹ XP_038962870

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	62,774,896 - 63,145,482 (+)	NCBI
mRatBN7.2	4	61,807,706 - 62,178,302 (+)	NCBI

RefSeq Acc Id:

XM_039106944 ⟹ XP_038962872

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	62,774,896 - 63,224,931 (+)	NCBI
mRatBN7.2	4	61,807,706 - 62,229,432 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_446327	(Get FASTA)	NCBI Sequence Viewer
	XP_038962870	(Get FASTA)	NCBI Sequence Viewer
	XP_038962872	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAC52265	(Get FASTA)	NCBI Sequence Viewer
	EDM15293	(Get FASTA)	NCBI Sequence Viewer
	EDM15294	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000064888.3
	ENSRNOP00000066892.3
GenBank Protein	Q62824	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_446327 ⟸ NM_053875

- UniProtKB:

Q62824 (UniProtKB/Swiss-Prot), M0RBF8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAAEAAGGKYRSTVSKSKDPSGLLISVIRTLSTSDDVEDRENEKGRLEEAYEKCDRDLDELIVQ
HYTELTTAIRTYQSITERITNSRNKIKQVKENLLSCKMLLHCKRDELRKLWIEGIEHKHVLNLL
DEIENIKQVPQKLEQCMASKHYLSATDMLVSAVESLEGPLLQVEGLSDLRLELHSKKMNLHLVL
IEELHRHLYIKSTSRVVQRNKEKGKMSSHGKDASPGPLIDVSNISTPRKFLDATQYSAAGSSSV
REMNLQDIKEDLDCDPEENSTLFMGILIQGLARLKKIPETVKAIKERLEQELKQIVKRSTTQVA
DSAYQRGESLTVDNQPRLLLELLELLFDKFNAVASAHSIVLGYLQDSVGTQPTQQEEIKLYDMA
DVWVKIQDVLQMLLTEYLDMKNTRTASEPSAQLSYASTGREFAAFFAKKKPQRPKNSLFKFESS
SHAISMSAYLREQRRELYSRSGELQGGPDDNLIEGGGTKFVCKPGARNITVIFHPLLRFIQEIE
HALGLGPAKQCLLREFLTIYIKNIFLNQVLTEINKEIEGVTKTSDPLKILANADTMKVLGVQRP
LLQSTIIVEKTVQDLMNLMHDLSAYSDQFLNMVCVKLQEYKDTCSTAYRGIVQSEEKLVISASW
AKDDDISRLLKSLPNWTNMAQPKQLRPKREEEEDFIRAAFGKESEVLIGNLGDKLIPPQDILRD
VSDLKALANMHESLEWLAGRTKSAFSSLSASQMLSPAQESHVNMDLPPVSEQIMQTLSELAKSF
QDMADRCLLVLHLEVRVHCFHYLIPLAKEGNYAIVANVESMDYDPLVVKLNKDISAMEEAMSAS
LQQHKFQYIFEGLGHLISCILINGAQYFRRISESGIKKMCRNIFVLQQNLTNITMSREADLDFA
RQYYEMLYNTADELLNLVVDQGVKYTELEYIHALTLLHRSQTGVGDQTTQNTRLQRLKEIICEQ
AAIKQATKDKKITTV

hide sequence

Ensembl Acc Id:

ENSRNOP00000066892 ⟸ ENSRNOT00000075621

Ensembl Acc Id:

ENSRNOP00000064888 ⟸ ENSRNOT00000071249

RefSeq Acc Id:	XP_038962872 ⟸ XM_039106944
- Peptide Label:	isoform X2
- UniProtKB:	M0R649 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038962870 ⟸ XM_039106942
- Peptide Label:	isoform X1
- UniProtKB:	M0R649 (UniProtKB/TrEMBL)

Protein Domains

Exocyst complex component Sec8 middle helical Exocyst complex component Sec8 N-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q62824-F1-model_v2	AlphaFold	Q62824	1-975	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692952

Promoter ID:

EPDNEW_R3473

Type:

multiple initiation site

Name:

Exoc4_1

Description:

exocyst complex component 4

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	4	60,549,183 - 60,549,243	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621791	AgrOrtholog
BioCyc Gene	G2FUF-45285	BioCyc
Ensembl Genes	ENSRNOG00000046023	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000071249.4	UniProtKB/TrEMBL
	ENSRNOT00000075621.3	UniProtKB/TrEMBL
InterPro	Sec8/EXOC4	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Sec8_exocyst	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Sec8_M	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:116654	UniProtKB/Swiss-Prot
NCBI Gene	116654	ENTREZGENE
PANTHER	EXOCYST COMPLEX COMPONENT 4	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR14146	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Sec8_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Sec8_exocyst	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Exoc4	PhenoGen
RatGTEx	ENSRNOG00000046023	RatGTEx
UniProt	A6IEK6_RAT	UniProtKB/TrEMBL
	A6IEK7_RAT	UniProtKB/TrEMBL
	EXOC4_RAT	UniProtKB/Swiss-Prot
	M0R649	ENTREZGENE, UniProtKB/TrEMBL
	M0RBF8	ENTREZGENE, UniProtKB/TrEMBL
	Q62824	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2006-03-30	Exoc4	exocyst complex component 4	Sec8l1	SEC8-like 1 (S. cerevisiae)	Symbol and Name updated	1299863	APPROVED
2004-09-10	Sec8l1	SEC8-like 1 (S. cerevisiae)	Sec8	secretory protein SEC8	Symbol and Name updated	1299863	APPROVED
2002-08-07	Sec8	secretory protein SEC8			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_homology	shows 20% identity to yeast Sec8p	633933
gene_protein	110-kDa protein	633933

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Annotations - PID (archival)