Coro1c (coronin 1C) - Rat Genome Database

Name: Coro1c
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Advanced Search (OLGA)

Gene: Coro1c (coronin 1C) Rattus norvegicus

Analyze

Symbol:

Coro1c

Name:

coronin 1C

RGD ID:

1564490

Description:

Predicted to enable actin filament binding activity and small GTPase binding activity. Predicted to be involved in several processes, including negative regulation of cell-substrate adhesion; regulation of cell migration; and regulation of plasma membrane bounded cell projection organization. Predicted to act upstream of or within corpus callosum development and ventricular system development. Predicted to be located in several cellular components, including endosome membrane; lamellipodium; and lateral plasma membrane. Predicted to be part of flotillin complex. Orthologous to human CORO1C (coronin 1C); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

coronin, actin binding protein 1C; coronin-1C; LOC501841; RGD1564490; similar to Coronin, actin binding protein 1C

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CORO1C (coronin 1C)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Coro1c (coronin, actin binding protein 1C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Coro1c (coronin 1C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CORO1C (coronin 1C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CORO1C (coronin 1C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Coro1c (coronin 1C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CORO1C (coronin 1C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CORO1C (coronin 1C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Coro1c (coronin 1C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	CORO1B (coronin 1B)	HGNC	OrthoDB
Homo sapiens (human):	CORO6 (coronin 6)	HGNC	OrthoDB
Alliance orthologs ³
Homo sapiens (human):	CORO1C (coronin 1C)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Coro1c (coronin, actin binding protein 1C)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	coro1ca (coronin, actin binding protein, 1Ca)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	coro1cb (coronin, actin binding protein, 1Cb)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	CRN1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	cor-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	coro	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	coro1c	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	48,373,573 - 48,445,718 (+)	NCBI		GRCr8
mRatBN7.2	12	42,713,024 - 42,785,179 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	42,712,991 - 42,785,179 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	43,907,113 - 43,949,533 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	44,520,715 - 44,563,133 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	43,581,242 - 43,623,661 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	48,481,741 - 48,554,054 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	48,481,750 - 48,554,052 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	50,264,710 - 50,337,014 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	43,747,188 - 43,819,356 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	12	44,343,663 - 44,386,096 (+)	NCBI		Celera
Cytogenetic Map	12	q16	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

IgA glomerulonephritis (ISO)

lung non-small cell carcinoma (ISO)

proliferative diabetic retinopathy (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1-nitropyrene (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

3,4-methylenedioxymethamphetamine (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

acrolein (ISO)

aflatoxin B1 (ISO)

alpha-pinene (ISO)

amitrole (EXP)

arsane (ISO)

arsenic atom (ISO)

beauvericin (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

beta-lapachone (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

buspirone (EXP)

butan-1-ol (ISO)

CGP 52608 (ISO)

cisplatin (ISO)

cobalt dichloride (ISO)

coumestrol (ISO)

cyclosporin A (ISO)

decabromodiphenyl ether (ISO)

dexamethasone (ISO)

dextran sulfate (ISO)

dibutyl phthalate (EXP)

dorsomorphin (ISO)

enniatin (ISO)

enzyme inhibitor (ISO)

ethanol (ISO)

fenthion (ISO)

fulvestrant (ISO)

gefitinib (ISO)

genistein (ISO)

gentamycin (EXP)

indometacin (ISO)

inulin (ISO)

ivermectin (ISO)

leflunomide (EXP)

methimazole (EXP)

microcystin-LR (ISO)

N-methyl-4-phenylpyridinium (ISO)

nefazodone (EXP)

nimesulide (EXP)

ozone (ISO)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

pirinixic acid (ISO)

propiconazole (EXP)

resveratrol (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenate (ISO)

sodium dichromate (ISO)

sulfadimethoxine (EXP)

sunitinib (ISO)

T-2 toxin (ISO)

temozolomide (ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trichloroethene (EXP)

triphenyl phosphate (EXP,ISO)

triptonide (ISO)

troglitazone (ISO)

valproic acid (ISO)

vancomycin (ISO)

vinclozolin (EXP)

zearalenone (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

actin filament organization (IBA)

activation of GTPase activity (ISO)

corpus callosum development (ISO)

endosomal transport (ISO)

endosome fission (ISO)

endosome membrane tubulation (ISO)

establishment of protein localization (ISO)

membrane fission (ISO)

negative regulation of epithelial cell migration (ISO)

negative regulation of focal adhesion assembly (ISO)

negative regulation of protein kinase activity by regulation of protein phosphorylation (ISO)

negative regulation of protein phosphorylation (ISO)

negative regulation of substrate adhesion-dependent cell spreading (ISO)

neural crest cell migration (IBA,ISO)

positive regulation of lamellipodium morphogenesis (ISO)

regulation of epithelial cell migration (ISO)

regulation of fibroblast migration (ISO)

regulation of focal adhesion assembly (ISO)

regulation of protein phosphorylation (ISO)

regulation of ruffle assembly (ISO)

regulation of smooth muscle cell chemotaxis (IMP)

regulation of substrate adhesion-dependent cell spreading (ISO)

ventricular system development (ISO)

Cellular Component

actin cytoskeleton (ISO)

cytoskeleton (ISO)

endosome membrane (ISO)

flotillin complex (ISO)

focal adhesion (ISO)

lamellipodium (ISO)

lateral plasma membrane (ISO)

vesicle (ISO)

Molecular Function

actin filament binding (IBA,ISO)

protein binding (ISO)

small GTPase binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Exploring the Immune Infiltration Landscape and M2 Macrophage-Related Biomarkers of Proliferative Diabetic Retinopathy.	Meng Z, etal., Front Endocrinol (Lausanne). 2022 May 27;13:841813. doi: 10.3389/fendo.2022.841813. eCollection 2022.
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
5.	Role of coronin 1B in PDGF-induced migration of vascular smooth muscle cells.	Williams HC, etal., Circ Res. 2012 Jun 22;111(1):56-65. doi: 10.1161/CIRCRESAHA.111.255745. Epub 2012 May 22.

Additional References at PubMed

PMID:12477932	PMID:19913511	PMID:21423176	PMID:22364218	PMID:22871113	PMID:25074804	PMID:30220460	PMID:31505169	PMID:35352799	PMID:35659652

Genomics

Comparative Map Data

Coro1c
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	48,373,573 - 48,445,718 (+)	NCBI		GRCr8
mRatBN7.2	12	42,713,024 - 42,785,179 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	42,712,991 - 42,785,179 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	43,907,113 - 43,949,533 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	44,520,715 - 44,563,133 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	43,581,242 - 43,623,661 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	48,481,741 - 48,554,054 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	48,481,750 - 48,554,052 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	50,264,710 - 50,337,014 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	43,747,188 - 43,819,356 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	12	44,343,663 - 44,386,096 (+)	NCBI		Celera
Cytogenetic Map	12	q16	NCBI

CORO1C
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	108,645,109 - 108,731,518 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	108,645,109 - 108,731,526 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	12	109,038,885 - 109,125,294 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	107,563,014 - 107,649,424 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	12	107,541,354 - 107,627,761	NCBI
Celera	12	108,708,285 - 108,794,696 (-)	NCBI		Celera
Cytogenetic Map	12	q24.11	NCBI
HuRef	12	106,103,254 - 106,190,451 (-)	NCBI		HuRef
CHM1_1	12	109,005,617 - 109,092,972 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	12	108,619,700 - 108,706,142 (-)	NCBI		T2T-CHM13v2.0

Coro1c
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	113,980,500 - 114,046,767 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	113,980,497 - 114,046,819 (-)	Ensembl		GRCm39 Ensembl
GRCm38	5	113,842,439 - 113,908,706 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	113,842,436 - 113,908,758 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	114,292,448 - 114,358,715 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	114,103,438 - 114,169,705 (-)	NCBI		MGSCv36	mm8
Celera	5	110,944,005 - 111,011,106 (-)	NCBI		Celera
Cytogenetic Map	5	F	NCBI
cM Map	5	55.64	NCBI

Coro1c
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955455	9,901,702 - 9,953,098 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955455	9,905,243 - 9,952,504 (-)	NCBI	ChiLan1.0	ChiLan1.0

CORO1C
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	116,709,930 - 116,795,288 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	116,706,328 - 116,791,686 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	106,220,755 - 106,306,098 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	109,617,087 - 109,702,129 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	109,617,093 - 109,674,368 (-)	Ensembl	panpan1.1		panPan2

CORO1C
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	26	18,161,707 - 18,236,654 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	26	18,176,441 - 18,236,652 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	26	17,565,220 - 17,640,232 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	26	18,505,707 - 18,580,881 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	26	18,505,739 - 18,582,355 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	26	17,774,249 - 17,849,531 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	26	18,496,473 - 18,573,357 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	26	18,515,317 - 18,590,632 (+)	NCBI		UU_Cfam_GSD_1.0

Coro1c
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	144,838,455 - 144,922,226 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936769	553,642 - 637,008 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936769	555,719 - 637,420 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CORO1C
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	42,062,893 - 42,145,123 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	14	42,062,468 - 42,145,130 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	44,605,492 - 44,688,485 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CORO1C
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	103,846,783 - 103,933,283 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	103,845,292 - 103,999,993 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666037	141,165,870 - 141,272,991 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Coro1c
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624747	11,879,215 - 11,963,250 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624747	11,879,315 - 11,967,496 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Coro1c
243 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	293
Count of miRNA genes:	182
Interacting mature miRNAs:	224
Transcripts:	ENSRNOT00000000886
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631560	Apr1	Acute phase response QTL 1	6.1		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	19144362	46669029	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
8693635	Alc28	Alcohol consumption QTL 28	2.7	0.439	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	12	23081340	44726024	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
7411643	Foco20	Food consumption QTL 20		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	20328819	46669029	Rat
61324	Eae5	Experimental allergic encephalomyelitis QTL 5	14		nervous system integrity trait (VT:0010566)	percentage of study population developing relapsing-remitting experimental autoimmune encephalomyelitis during a period of time (CMO:0001402)	12	19610870	46669029	Rat
5684888	Pia42	Pristane induced arthritis QTL 42			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	19610870	42828880	Rat
1549912	Bp268	Blood pressure QTL 268			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	13182736	46669029	Rat
2302060	Pia37	Pristane induced arthritis QTL 37	6.1	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	13198157	46669029	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	12812385	46669029	Rat
1300162	Bp188	Blood pressure QTL 188	3.19		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	32103174	45899022	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564498	46669029	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	9603277	46669029	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	6107579	46669029	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
1549902	Bp269	Blood pressure QTL 269			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	13182736	46669029	Rat
1600386	Calcic2	Intracellular calcium level QTL 2		0.001	platelet physiology trait (VT:0005464)	platelet intracellular calcium level (CMO:0000922)	12	28064433	46669029	Rat
1302792	Scl21	Serum cholesterol level QTL 21	3.8	0.0011	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	12	7196730	46669029	Rat
61404	Bw120	Body weight QTL 120	5.1		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	12	12351619	46669029	Rat
1300175	Cm5	Cardiac mass QTL 5	3.78		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	12	28064433	45899022	Rat
8693658	Alc33	Alcohol consumption QTL 33	2.1	0.68	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	12	23081340	43551788	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	10474137	46669029	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	11073825	45055165	Rat
634351	Apr5	Acute phase response QTL 5	6.7		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	12	1	44503507	Rat
634350	Apr4	Acute phase response QTL 4	6		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	1172005	46172005	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	5564495	46669029	Rat
737979	Pia22	Pristane induced arthritis QTL 22	53.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	1	44465750	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	12812385	46669029	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
2302042	Pia38	Pristane induced arthritis QTL 38	3.5	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	1	44503507	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	10474137	46669029	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat

Markers in Region

D12Rat21

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	42,767,529 - 42,767,729 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	48,536,412 - 48,536,609	NCBI	Rnor6.0
Rnor_5.0	12	50,319,372 - 50,319,569	UniSTS	Rnor5.0
RGSC_v3.4	12	43,801,711 - 43,801,909	RGD	RGSC3.4
RGSC_v3.4	12	43,801,712 - 43,801,909	UniSTS	RGSC3.4
RGSC_v3.1	12	43,665,099 - 43,665,297	RGD
Celera	12	44,370,327 - 44,370,524	UniSTS
RH 2.0 Map	12	473.0	RGD
SHRSP x BN Map	12	51.8299	RGD
Cytogenetic Map	12	q16	UniSTS

BI278729

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	42,713,985 - 42,714,159 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	48,482,915 - 48,483,088	NCBI	Rnor6.0
Rnor_5.0	12	50,265,875 - 50,266,048	UniSTS	Rnor5.0
RGSC_v3.4	12	43,748,174 - 43,748,347	UniSTS	RGSC3.4
Celera	12	44,316,836 - 44,317,009	UniSTS
Cytogenetic Map	12	q16	UniSTS

RH137525

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	42,784,877 - 42,785,113 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	48,553,753 - 48,553,988	NCBI	Rnor6.0
Rnor_5.0	12	50,336,713 - 50,336,948	UniSTS	Rnor5.0
RGSC_v3.4	12	43,819,057 - 43,819,292	UniSTS	RGSC3.4
Celera	12	44,387,667 - 44,387,902	UniSTS
Cytogenetic Map	12	q16	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001109327	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC166764	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473973	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000000886 ⟹ ENSRNOP00000000886

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	42,713,015 - 42,785,179 (+)	Ensembl
Rnor_6.0 Ensembl	12	48,481,750 - 48,554,052 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000109613 ⟹ ENSRNOP00000095715

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	42,713,050 - 42,785,023 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000115919 ⟹ ENSRNOP00000094519

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	42,740,860 - 42,783,550 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000116184 ⟹ ENSRNOP00000097058

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	42,712,991 - 42,778,465 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000117394 ⟹ ENSRNOP00000094473

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	42,713,071 - 42,785,179 (+)	Ensembl

RefSeq Acc Id:

NM_001109327 ⟹ NP_001102797

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	48,373,573 - 48,445,718 (+)	NCBI
mRatBN7.2	12	42,713,024 - 42,785,179 (+)	NCBI
Rnor_6.0	12	48,509,742 - 48,552,182 (+)	NCBI
Rnor_5.0	12	50,264,710 - 50,337,014 (+)	NCBI
RGSC_v3.4	12	43,747,188 - 43,819,356 (+)	RGD
Celera	12	44,343,663 - 44,386,096 (+)	NCBI

Sequence:

show sequence

ATGCGGCGAGTGGTACGACAGAGCAAGTTCCGGCACGTCTTTGGACAGGCAGTGAAGAATGACC
AGTGCTACGATGACATCCGCGTCTCCCGAGTCACCTGGGACAGCTCCTTTTGTGCTGTCAACCC
CAGATTCGTGGCCATCATCATAGAAGCGAGTGGGGGAGGGGCCTTCCTGGTGCTCCCTCTGCAC
AAGACGGGACGAATTGACAAATCCTACCCTACAGTGTGTGGCCACACAGGACCAGTGCTGGACA
TAGACTGGTGCCCACACAACGACCAGGTCATCGCCAGCGGCTCAGAGGACTGCACTGTGATGGT
TTGGCAGATCCCGGAAAATGGACTGACCCTTTCCCTGACTGAACCTGTGGTGATTTTAGAAGGT
CACTCAAAAAGAGTTGGCATCGTGGCCTGGCATCCGACGGCCCGCAATGTGCTTCTCAGTGCAG
GCTGTGATAATGCCATTATCATCTGGAACGTGGGGACAGGGGAGGCCCTCATCAACTTGGACGA
CATGCATTCAGACATGATTTACAACGTGAGCTGGAGCCGCAATGGCAGTCTCATCTGCACAGCG
TCCAAAGACAAGAAAGTGAGGGTCATCGATCCCAGGAGACAGGAGATCGTAGCGGAAAAGGAGA
AAGCACACGAAGGAGCCAGGCCCATGCGCGCCATCTTCCTGGCCGACGGCAATGTCTTCACTAC
TGGTTTTAGCCGTATGAGCGAGCGGCAGTTGGCACTCTGGAACCCAAAAAACATGCAGGAACCA
ATTGCTCTTCATGAAATGGACACTAGCAATGGGGTGCTGCTCCCTTTCTACGACCCGGACACCA
GCATCATTTACTTATGTGGGAAGGGTGACAGCAGTATCCGCTACTTTGAAATCACGGATGAGTC
CCCATACGTGCACTACCTCAACACCTTCAGCAGCAAGGAGCCTCAGCGAGGGATGGGCTACATG
CCCAAGCGGGGGCTTGACGTCAACAAGTGTGAGATCGCCAGATTCTTCAAGCTTCACGAGAGAA
AGTGTGAACCTATTATCATGACAGTCCCCAGGAAGTCTGACCTCTTCCAAGATGACCTGTACCC
TGACACAGCGGGGCCGGAAGCAGCACTTGAGGCAGAGGAGTGGTTTGAGGGGAAAAACGCAGAC
CCCATCCTCATCTCCTTGAAGCATGGGTACATTCCAGGCAAGAACAGGGATCTCAAGGTCGTCA
AGAAGAACATTCTGGACAGCAAGCCAGCTGCAAACAAGAAGAGTGATCTCATCTGTGCCCCTAA
GAAGACCACAGACACAGCCAGTGTGCAAAATGAAGCCAAGCTGGATGAGATTTTAAAAGAGATC
AAATCCATAAAGGACACAATCTGCAATCAAGACGAGCGCATTTCAAAGCTAGAACAGCAGCTGG
CCAAGATGGCTGCCTGA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001102797	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI66764	(Get FASTA)	NCBI Sequence Viewer
	EDM13959	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000000886.4
	ENSRNOP00000094473.1
	ENSRNOP00000094519.1
	ENSRNOP00000095715.1
	ENSRNOP00000097058.1

RefSeq Acc Id:

NP_001102797 ⟸ NM_001109327

- UniProtKB:

G3V624 (UniProtKB/TrEMBL), A0A8I6ANC4 (UniProtKB/TrEMBL), A6J220 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MRRVVRQSKFRHVFGQAVKNDQCYDDIRVSRVTWDSSFCAVNPRFVAIIIEASGGGAFLVLPLH
KTGRIDKSYPTVCGHTGPVLDIDWCPHNDQVIASGSEDCTVMVWQIPENGLTLSLTEPVVILEG
HSKRVGIVAWHPTARNVLLSAGCDNAIIIWNVGTGEALINLDDMHSDMIYNVSWSRNGSLICTA
SKDKKVRVIDPRRQEIVAEKEKAHEGARPMRAIFLADGNVFTTGFSRMSERQLALWNPKNMQEP
IALHEMDTSNGVLLPFYDPDTSIIYLCGKGDSSIRYFEITDESPYVHYLNTFSSKEPQRGMGYM
PKRGLDVNKCEIARFFKLHERKCEPIIMTVPRKSDLFQDDLYPDTAGPEAALEAEEWFEGKNAD
PILISLKHGYIPGKNRDLKVVKKNILDSKPAANKKSDLICAPKKTTDTASVQNEAKLDEILKEI
KSIKDTICNQDERISKLEQQLAKMAA

hide sequence

Ensembl Acc Id:

ENSRNOP00000000886 ⟸ ENSRNOT00000000886

Ensembl Acc Id:

ENSRNOP00000094519 ⟸ ENSRNOT00000115919

Ensembl Acc Id:

ENSRNOP00000094473 ⟸ ENSRNOT00000117394

Ensembl Acc Id:

ENSRNOP00000095715 ⟸ ENSRNOT00000109613

Ensembl Acc Id:

ENSRNOP00000097058 ⟸ ENSRNOT00000116184

Protein Domains

DUF1899

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-G3V624-F1-model_v2	AlphaFold	G3V624	1-474	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698718

Promoter ID:

EPDNEW_R9242

Type:

initiation region

Name:

Coro1c_1

Description:

coronin 1C

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	12	48,481,774 - 48,481,834	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1564490	AgrOrtholog
BioCyc Gene	G2FUF-18933	BioCyc
Ensembl Genes	ENSRNOG00000000697	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000000886.5	UniProtKB/TrEMBL
	ENSRNOT00000109613.1	UniProtKB/TrEMBL
	ENSRNOT00000115919.1	UniProtKB/TrEMBL
	ENSRNOT00000116184.1	UniProtKB/TrEMBL
	ENSRNOT00000117394.1	UniProtKB/TrEMBL
Gene3D-CATH	2.130.10.10	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7932115	IMAGE-MGC_LOAD
InterPro	Coronin	UniProtKB/TrEMBL
	DUF1899	UniProtKB/TrEMBL
	WD40/YVTN_repeat-like_dom_sf	UniProtKB/TrEMBL
	WD40_repeat	UniProtKB/TrEMBL
	WD40_repeat_CS	UniProtKB/TrEMBL
	WD40_repeat_dom_sf	UniProtKB/TrEMBL
KEGG Report	rno:501841	UniProtKB/TrEMBL
MGC_CLONE	MGC:188526	IMAGE-MGC_LOAD
NCBI Gene	501841	ENTREZGENE
PANTHER	Coronin	UniProtKB/TrEMBL
	PTHR10856:SF10	UniProtKB/TrEMBL
Pfam	DUF1899	UniProtKB/TrEMBL
	WD40	UniProtKB/TrEMBL
	WD40_4	UniProtKB/TrEMBL
PhenoGen	Coro1c	PhenoGen
PROSITE	WD_REPEATS_1	UniProtKB/TrEMBL
	WD_REPEATS_2	UniProtKB/TrEMBL
	WD_REPEATS_REGION	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000000697	RatGTEx
SMART	DUF1899	UniProtKB/TrEMBL
	DUF1900	UniProtKB/TrEMBL
	WD40	UniProtKB/TrEMBL
Superfamily-SCOP	Nucleoporin domain	UniProtKB/TrEMBL
	SSF50978	UniProtKB/TrEMBL
UniProt	A0A8I6ANC4	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6ARY1_RAT	UniProtKB/TrEMBL
	A0A8I6GLR9_RAT	UniProtKB/TrEMBL
	A6J220	ENTREZGENE, UniProtKB/TrEMBL
	B2RYG0_RAT	UniProtKB/TrEMBL
	G3V624	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-01-20	Coro1c	coronin 1C	Coro1c	coronin, actin binding protein 1C	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-06	Coro1c	coronin, actin binding protein 1C	RGD1564490_predicted	similar to Coronin, actin binding protein 1C (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-07	RGD1564490_predicted	similar to Coronin, actin binding protein 1C (predicted)	LOC501841	similar to Coronin, actin binding protein 1C	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC501841	similar to Coronin, actin binding protein 1C			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD