Advanced Search (OLGA)

Gene: Dele1 (DAP3 binding cell death enhancer 1) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Dele1

Name:

DAP3 binding cell death enhancer 1

RGD ID:

735029

Description:

Predicted to enable protein kinase binding activity and protein serine/threonine kinase activator activity. Predicted to be involved in several processes, including HRI-mediated signaling; positive regulation of mitophagy; and response to iron ion starvation. Predicted to be located in cytosol and mitochondrial inner membrane. Predicted to be active in mitochondrial outer membrane. Orthologous to human DELE1 (DAP3 binding cell death enhancer 1); INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine; 3,4-methylenedioxymethamphetamine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

DAP3-binding cell death enhancer 1; DAP3-binding cell death enhancer 1, long form; death ligand signal enhancer; Dele; DELE1(L); hypothetical protein LOC307480; MGC72566; RGD735029; SEL1 domain containing protein RGD735029; similar to Hypothetical protein KIAA0141; uncharacterized protein KIAA0141 homolog

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	DELE1 (DAP3 binding cell death enhancer 1)	HGNC	EggNOG, Ensembl, HomoloGene, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Dele1 (DAP3 binding cell death enhancer 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Dele1 (DAP3 binding cell death enhancer 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	DELE1 (DAP3 binding cell death enhancer 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	DELE1 (DAP3 binding cell death enhancer 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Dele1 (DAP3 binding cell death enhancer 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	DELE1 (DAP3 binding cell death enhancer 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	DELE1 (DAP3 binding cell death enhancer 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Dele1 (DAP3 binding cell death enhancer 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	DELE1 (DAP3 binding cell death enhancer 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Dele1 (DAP3 binding cell death enhancer 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	dele1	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	SKT5	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	dele1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	30,325,369 - 30,349,285 (+)	NCBI		GRCr8
mRatBN7.2	18	30,085,093 - 30,098,105 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	30,085,126 - 30,098,756 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	18	30,189,458 - 30,202,379 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	30,952,103 - 30,965,028 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	30,287,407 - 30,300,332 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	31,396,897 - 31,409,914 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	31,396,922 - 31,409,907 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	31,076,930 - 31,089,931 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	18	31,178,792 - 31,191,713 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	18	31,205,437 - 31,218,358 (+)	NCBI
Celera	18	29,725,992 - 29,738,913 (+)	NCBI		Celera
Cytogenetic Map	18	p11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dele1	Rat	familial adenomatous polyposis 1		ISO	DELE1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Familial adenomatous polyposis 1	ClinVar	PMID:17963004 more ...
Dele1	Rat	Hereditary Neoplastic Syndromes		ISO	DELE1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Hereditary cancer-predisposing syndrome	ClinVar	PMID:17963004 more ...
Dele1	Rat	Neurodevelopmental Disorders		ISO	DELE1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Neurodevelopmental disorder	ClinVar	PMID:25741868

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dele1	Rat	(+)-catechin	multiple interactions	ISO	DELE1 (Homo sapiens)	6480464	[Catechin co-treated with Grape Seed Proanthocyanidins] results in decreased expression of DELE1 mRNA	CTD	PMID:24763279
Dele1	Rat	(1->4)-beta-D-glucan	multiple interactions	ISO	Dele1 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of DELE1 mRNA	CTD	PMID:36331819
Dele1	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	Dele1 (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of DELE1 mRNA	CTD	PMID:22206623
Dele1	Rat	2,2',4,4'-Tetrabromodiphenyl ether	increases expression	EXP		6480464	2 more ...	CTD	PMID:21394737
Dele1	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of DELE1 mRNA	CTD	PMID:21215274
Dele1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of DELE1 mRNA	CTD	PMID:33387578
Dele1	Rat	3,4-methylenedioxymethamphetamine	decreases expression	EXP		6480464	N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of DELE1 mRNA	CTD	PMID:30071829
Dele1	Rat	4,4'-sulfonyldiphenol	decreases methylation	ISO	DELE1 (Homo sapiens)	6480464	bisphenol S results in decreased methylation of DELE1 gene	CTD	PMID:31601247
Dele1	Rat	acrylamide	decreases expression	ISO	DELE1 (Homo sapiens)	6480464	Acrylamide results in decreased expression of DELE1 mRNA	CTD	PMID:32763439
Dele1	Rat	aflatoxin B1	increases methylation	ISO	DELE1 (Homo sapiens)	6480464	Aflatoxin B1 results in increased methylation of DELE1 3' UTR	CTD	PMID:30157460
Dele1	Rat	atrazine	decreases expression	ISO	DELE1 (Homo sapiens)	6480464	Atrazine results in decreased expression of DELE1 mRNA	CTD	PMID:22378314
Dele1	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of DELE1 mRNA	CTD	PMID:25181051
Dele1	Rat	cadmium dichloride	increases expression	EXP		6480464	Cadmium Chloride results in increased expression of DELE1 mRNA	CTD	PMID:33453195
Dele1	Rat	copper atom	multiple interactions	ISO	DELE1 (Homo sapiens)	6480464	[NSC 689534 binds to Copper] which results in decreased expression of DELE1 mRNA	CTD	PMID:20971185
Dele1	Rat	copper(0)	multiple interactions	ISO	DELE1 (Homo sapiens)	6480464	[NSC 689534 binds to Copper] which results in decreased expression of DELE1 mRNA	CTD	PMID:20971185
Dele1	Rat	Dibutyl phosphate	affects expression	ISO	DELE1 (Homo sapiens)	6480464	di-n-butylphosphoric acid affects the expression of DELE1 mRNA	CTD	PMID:37042841
Dele1	Rat	dibutyl phthalate	decreases expression	EXP		6480464	Dibutyl Phthalate results in decreased expression of DELE1 mRNA	CTD	PMID:21266533
Dele1	Rat	dorsomorphin	multiple interactions	ISO	DELE1 (Homo sapiens)	6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of DELE1 mRNA	CTD	PMID:27188386
Dele1	Rat	doxorubicin	decreases expression	ISO	DELE1 (Homo sapiens)	6480464	Doxorubicin results in decreased expression of DELE1 mRNA	CTD	PMID:29803840
Dele1	Rat	fenthion	increases expression	ISO	Dele1 (Mus musculus)	6480464	Fenthion results in increased expression of DELE1 mRNA	CTD	PMID:34813904
Dele1	Rat	finasteride	increases expression	EXP		6480464	Finasteride results in increased expression of DELE1 mRNA	CTD	PMID:24136188
Dele1	Rat	flutamide	increases expression	EXP		6480464	Flutamide results in increased expression of DELE1 mRNA	CTD	PMID:24136188
Dele1	Rat	folic acid	multiple interactions	ISO	Dele1 (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of DELE1 mRNA	CTD	PMID:22206623
Dele1	Rat	furan	increases methylation	EXP		6480464	furan results in increased methylation of DELE1 gene	CTD	PMID:22079235
Dele1	Rat	manganese atom	multiple interactions	ISO	DELE1 (Homo sapiens)	6480464	[manganese chloride results in increased abundance of Manganese] which results in decreased expression of DELE1 mRNA	CTD	PMID:39836092
Dele1	Rat	manganese(0)	multiple interactions	ISO	DELE1 (Homo sapiens)	6480464	[manganese chloride results in increased abundance of Manganese] which results in decreased expression of DELE1 mRNA	CTD	PMID:39836092
Dele1	Rat	manganese(II) chloride	multiple interactions	ISO	DELE1 (Homo sapiens)	6480464	[manganese chloride results in increased abundance of Manganese] which results in decreased expression of DELE1 mRNA	CTD	PMID:39836092
Dele1	Rat	methidathion	increases expression	ISO	Dele1 (Mus musculus)	6480464	methidathion results in increased expression of DELE1 mRNA	CTD	PMID:34813904
Dele1	Rat	nitrates	multiple interactions	ISO	Dele1 (Mus musculus)	6480464	[Particulate Matter results in increased abundance of Nitrates] which results in increased expression of DELE1 mRNA	CTD	PMID:35964746
Dele1	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	Dele1 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of DELE1 mRNA	CTD	PMID:36331819
Dele1	Rat	quercitrin	decreases expression	ISO	DELE1 (Homo sapiens)	6480464	quercitrin results in decreased expression of DELE1 mRNA	CTD	PMID:25193878
Dele1	Rat	rotenone	increases expression	EXP		6480464	Rotenone results in increased expression of DELE1 mRNA	CTD	PMID:28374803
Dele1	Rat	SB 431542	multiple interactions	ISO	DELE1 (Homo sapiens)	6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of DELE1 mRNA	CTD	PMID:27188386
Dele1	Rat	titanium dioxide	increases expression	ISO	Dele1 (Mus musculus)	6480464	titanium dioxide results in increased expression of DELE1 mRNA	CTD	PMID:29264374
Dele1	Rat	valproic acid	decreases expression	ISO	DELE1 (Homo sapiens)	6480464	Valproic Acid results in decreased expression of DELE1 mRNA	CTD	PMID:23179753 and PMID:26272509
Dele1	Rat	valproic acid	multiple interactions	ISO	DELE1 (Homo sapiens)	6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of DELE1 mRNA	CTD	PMID:27188386
Dele1	Rat	vinclozolin	increases methylation	EXP		6480464	vinclozolin results in increased methylation of DELE1 gene	CTD	PMID:31079544

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dele1	Rat	apoptotic process	involved_in	IEA	UniProtKB-KW:KW-0053	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Dele1	Rat	cellular response to stress	involved_in	ISO	DELE1 (Homo sapiens)	1624291	PMID:32132706 more ...	RGD	PMID:32132706 more ...
Dele1	Rat	cellular response to stress	involved_in	IEA	UniProtKB:Q14154 and ensembl:ENSP00000396225	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Dele1	Rat	DNA damage response	involved_in	ISO	DELE1 (Homo sapiens) and UniProtKB:Q14154-PRO_0000050721	1624291	PMID:37832546	RGD	PMID:37832546
Dele1	Rat	DNA damage response	involved_in	IEA	UniProtKB-KW:KW-0227	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Dele1	Rat	DNA damage response	involved_in	ISS	UniProtKB:Q14154-PRO_0000050721	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Dele1	Rat	extrinsic apoptotic signaling pathway via death domain receptors	involved_in	ISS	UniProtKB:Q14154	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Dele1	Rat	extrinsic apoptotic signaling pathway via death domain receptors	involved_in	IEA	UniProtKB:Q14154 and ensembl:ENSP00000396225	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Dele1	Rat	extrinsic apoptotic signaling pathway via death domain receptors	involved_in	IBA	PANTHER:PTN002894916 and UniProtKB:Q14154	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Dele1	Rat	extrinsic apoptotic signaling pathway via death domain receptors	involved_in	ISO	DELE1 (Homo sapiens)	1624291	PMID:20563667	RGD	PMID:20563667
Dele1	Rat	HRI-mediated signaling	involved_in	ISO	DELE1 (Homo sapiens)	1624291	PMID:38340717	RGD	PMID:38340717
Dele1	Rat	HRI-mediated signaling	involved_in	IEA	UniProtKB:Q14154 and ensembl:ENSP00000396225	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Dele1	Rat	HRI-mediated signaling	involved_in	ISO	DELE1 (Homo sapiens) more ...	1624291	PMID:32132706 and PMID:32132707	RGD	PMID:32132706 and PMID:32132707
Dele1	Rat	HRI-mediated signaling	involved_in	ISS	UniProtKB:Q14154-PRO_0000050721	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Dele1	Rat	HRI-mediated signaling	involved_in	ISO	DELE1 (Homo sapiens) more ...	1624291	PMID:37327776	RGD	PMID:37327776
Dele1	Rat	HRI-mediated signaling	involved_in	ISO	DELE1 (Homo sapiens) and UniProtKB:Q14154-PRO_0000050721	1624291	PMID:37550454 and PMID:37832546	RGD	PMID:37550454 and PMID:37832546
Dele1	Rat	integrated stress response signaling	involved_in	ISO	DELE1 (Homo sapiens) more ...	1624291	PMID:32132706 and PMID:32132707	RGD	PMID:32132706 and PMID:32132707
Dele1	Rat	integrated stress response signaling	involved_in	ISS	UniProtKB:Q14154-PRO_0000050721	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Dele1	Rat	positive regulation of mitophagy	involved_in	ISO	DELE1 (Homo sapiens)	1624291	PMID:38340717	RGD	PMID:38340717
Dele1	Rat	positive regulation of mitophagy	involved_in	IEA	UniProtKB:Q14154 and ensembl:ENSP00000396225	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Dele1	Rat	protein homooligomerization	involved_in	ISO	DELE1 (Homo sapiens) and UniProtKB:Q14154-PRO_0000050721	1624291	PMID:37550454	RGD	PMID:37550454
Dele1	Rat	response to iron ion starvation	involved_in	IEA	UniProtKB:Q14154 and ensembl:ENSP00000396225	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Dele1	Rat	response to iron ion starvation	involved_in	ISO	DELE1 (Homo sapiens) and UniProtKB:Q14154-PRO_0000050721	1624291	PMID:37327776	RGD	PMID:37327776

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dele1	Rat	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Dele1	Rat	cytosol	is_active_in	ISO	DELE1 (Homo sapiens)	1624291	PMID:32132706 and PMID:32132707	RGD	PMID:32132706 and PMID:32132707
Dele1	Rat	cytosol	is_active_in	IEA	UniProtKB:Q14154 and ensembl:ENSP00000396225	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Dele1	Rat	cytosol	located_in	IEA	UniProtKB-SubCell:SL-0091	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Dele1	Rat	cytosol	located_in	ISS	UniProtKB:Q14154-PRO_0000450308	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Dele1	Rat	cytosol	located_in	ISO	DELE1 (Homo sapiens) and UniProtKB:Q14154-PRO_0000450308	1624291	PMID:32132706 and PMID:32132707	RGD	PMID:32132706 and PMID:32132707
Dele1	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Dele1	Rat	mitochondrial inner membrane	located_in	ISO	DELE1 (Homo sapiens) and UniProtKB:Q14154-PRO_0000050721	1624291	PMID:32132707	RGD	PMID:32132707
Dele1	Rat	mitochondrial inner membrane	located_in	IEA	UniProtKB-KW:KW-0999	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Dele1	Rat	mitochondrial inner membrane	located_in	ISS	UniProtKB:Q14154-PRO_0000050721	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Dele1	Rat	mitochondrial inner membrane	located_in	IEA	UniProtKB-SubCell:SL-0168	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Dele1	Rat	mitochondrial outer membrane	is_active_in	ISO	DELE1 (Homo sapiens) and UniProtKB:Q14154-0000050721	1624291	PMID:37327776	RGD	PMID:37327776
Dele1	Rat	mitochondrial outer membrane	located_in	IEA	UniProtKB-SubCell:SL-0172	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Dele1	Rat	mitochondrial outer membrane	is_active_in	IEA	UniProtKB:Q14154 and ensembl:ENSP00000396225	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Dele1	Rat	mitochondrial outer membrane	located_in	IEA	UniProtKB-KW:KW-1000	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Dele1	Rat	mitochondrion	located_in	ISO	DELE1 (Homo sapiens)	1624291	PMID:10942595 and PMID:20563667	RGD	PMID:10942595 and PMID:20563667
Dele1	Rat	mitochondrion	located_in	IEA	UniProtKB:Q14154 and ensembl:ENSP00000396225	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Dele1	Rat	mitochondrion	located_in	IEA	UniProtKB-KW:KW-0496	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Dele1	Rat	mitochondrion	is_active_in	IBA	PANTHER:PTN002894916 and UniProtKB:Q14154	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Dele1	Rat	mitochondrion	located_in	ISS	UniProtKB:Q14154	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Dele1	Rat	mitochondrion	located_in	ISS	UniProtKB:Q14154-PRO_0000050721	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Dele1	Rat	mitochondrion	located_in	IEA	UniProtKB-SubCell:SL-0173	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Dele1	Rat	mitochondrion	located_in	ISO	DELE1 (Homo sapiens) and UniProtKB:Q14154-PRO_0000050721	1624291	PMID:32132706	RGD	PMID:32132706

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dele1	Rat	protein binding	enables	ISO	DELE1 (Homo sapiens)	1624291	UniProtKB:O14656-2 more ...	RGD	PMID:20563667 more ...
Dele1	Rat	protein kinase binding	enables	ISO	DELE1 (Homo sapiens) and UniProtKB:Q14154-PRO_0000450308	1624291	UniProtKB:Q9BQI3 more ...	RGD	PMID:32132706 and PMID:32132707
Dele1	Rat	protein serine/threonine kinase activator activity	enables	ISO	DELE1 (Homo sapiens) more ...	1624291	PMID:37327776	RGD	PMID:37327776
Dele1	Rat	protein serine/threonine kinase activator activity	enables	IEA	UniProtKB:Q14154 and ensembl:ENSP00000396225	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Dele1	Rat	protein serine/threonine kinase activator activity	enables	ISS	UniProtKB:Q14154-PRO_0000450308	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Dele1	Rat	protein serine/threonine kinase activator activity	enables	ISO	DELE1 (Homo sapiens) and UniProtKB:Q14154-PRO_0000050721	1624291	PMID:37550454 and PMID:37832546	RGD	PMID:37550454 and PMID:37832546
Dele1	Rat	protein serine/threonine kinase activator activity	enables	ISO	DELE1 (Homo sapiens) and UniProtKB:Q14154-PRO_0000050721	1624291	PMID:38340717	RGD	PMID:38340717
Dele1	Rat	protein serine/threonine kinase activator activity	enables	ISO	DELE1 (Homo sapiens) and UniProtKB:Q14154-PRO_0000450308	1624291	PMID:32132706 and PMID:32132707	RGD	PMID:32132706 and PMID:32132707

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	GOA pipeline	RGD automated data pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

PMID:10942595	PMID:15489334	PMID:18614015	PMID:20563667

Dele1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	30,325,369 - 30,349,285 (+)	NCBI		GRCr8
mRatBN7.2	18	30,085,093 - 30,098,105 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	30,085,126 - 30,098,756 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	18	30,189,458 - 30,202,379 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	30,952,103 - 30,965,028 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	30,287,407 - 30,300,332 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	31,396,897 - 31,409,914 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	31,396,922 - 31,409,907 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	31,076,930 - 31,089,931 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	18	31,178,792 - 31,191,713 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	18	31,205,437 - 31,218,358 (+)	NCBI
Celera	18	29,725,992 - 29,738,913 (+)	NCBI		Celera
Cytogenetic Map	18	p11	NCBI

DELE1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	141,923,871 - 141,942,047 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	141,923,855 - 141,942,047 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	141,303,436 - 141,321,612 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	141,283,593 - 141,299,901 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	5	141,283,592 - 141,299,900	NCBI
Celera	5	137,380,524 - 137,398,745 (+)	NCBI		Celera
Cytogenetic Map	5	q31.3	NCBI
HuRef	5	136,446,876 - 136,465,048 (+)	NCBI		HuRef
CHM1_1	5	140,736,724 - 140,754,952 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	5	142,449,834 - 142,468,003 (+)	NCBI		T2T-CHM13v2.0

Dele1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	18	38,383,302 - 38,395,682 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	18	38,383,308 - 38,398,514 (+)	Ensembl		GRCm39 Ensembl
GRCm38	18	38,250,249 - 38,262,629 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	18	38,250,255 - 38,265,461 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	18	38,409,903 - 38,422,283 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	18	38,376,233 - 38,388,600 (+)	NCBI		MGSCv36	mm8
Celera	18	39,594,596 - 39,606,862 (+)	NCBI		Celera
Cytogenetic Map	18	B3	NCBI
cM Map	18	20.15	NCBI

Dele1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955415	11,854,526 - 11,869,777 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955415	11,851,023 - 11,869,905 (-)	NCBI	ChiLan1.0	ChiLan1.0

DELE1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	137,170,572 - 137,193,649 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	135,310,106 - 135,327,726 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	137,283,938 - 137,302,203 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	143,394,554 - 143,412,532 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	143,394,554 - 143,412,532 (+)	Ensembl	panpan1.1		panPan2

DELE1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	36,865,275 - 36,880,304 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	36,865,289 - 36,879,840 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	33,918,130 - 33,933,164 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	37,320,373 - 37,335,410 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	37,320,392 - 37,335,410 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	34,395,044 - 34,410,073 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	35,206,130 - 35,221,162 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	36,013,644 - 36,028,679 (+)	NCBI		UU_Cfam_GSD_1.0

Dele1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	150,673,611 - 150,686,004 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936504	12,245,776 - 12,259,851 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936504	12,247,584 - 12,259,962 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

DELE1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	143,529,988 - 143,545,856 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	143,527,865 - 143,545,862 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	149,730,902 - 149,747,355 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

DELE1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	23	44,554,027 - 44,571,738 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	23	44,554,705 - 44,570,352 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666034	33,279,224 - 33,296,061 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Dele1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624774	1,136,731 - 1,150,625 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624774	1,135,680 - 1,154,628 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Dele1
62 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	195
Count of miRNA genes:	124
Interacting mature miRNAs:	162
Transcripts:	ENSRNOT00000026273
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331733	Bp233	Blood pressure QTL 233	3.97196		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	24796977	79788953	Rat
1358358	Sradr6	Stress Responsive Adrenal Weight QTL 6	2.49		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	18	11944299	59330563	Rat
1331735	Rf44	Renal function QTL 44	2.981		urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	18	18234564	31359530	Rat
61382	Bp46	Blood pressure QTL 46	18.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	11941791	31393320	Rat
2301413	Bp318	Blood pressure QTL 318		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	26548082	46969551	Rat
1331741	Bp232	Blood pressure QTL 232	3.59112		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	21372893	83213037	Rat
61388	Bp2	Blood pressure QTL 2	3.23		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	1	35374722	Rat
6903359	Bp355	Blood pressure QTL 355	3.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	11944544	59796478	Rat
12904668	Bw188	Body weight QTL 188		0.03	body mass (VT:0001259)	body weight (CMO:0000012)	18	26548082	46969551	Rat
2313082	Bss85	Bone structure and strength QTL 85	0.8	0.0001	long bone metaphysis morphology trait (VT:0000133)	tibia midshaft total cross-sectional area (CMO:0001715)	18	14951337	59951337	Rat
12904669	Cm125	Cardiac mass QTL 125		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	18	26548082	46969551	Rat
1641923	Colcr8	Colorectal carcinoma resistance QTL 8	3.1	0.0014	intestine integrity trait (VT:0010554)	poorly differentiated malignant colorectal tumor number (CMO:0002076)	18	22066242	52293055	Rat
12904670	Cm126	Cardiac mass QTL 126		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	18	26548082	46969551	Rat
2312568	Glom21	Glomerulus QTL 21	2	0.005	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	18	5185858	40503530	Rat
2300157	Bmd66	Bone mineral density QTL 66	13.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	18	28964853	73964853	Rat
738005	Anxrr11	Anxiety related response QTL 11	3.4		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	18	30039813	75039813	Rat
12904677	Kidm72	Kidney mass QTL 72		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	18	26548082	46969551	Rat
1331766	Bp236	Blood pressure QTL 236	3.022		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	11944299	31359530	Rat
1358193	Emca2	Estrogen-induced mammary cancer QTL 2	1.6		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	18	18007599	63571040	Rat
12904673	Cm127	Cardiac mass QTL 127		0.005	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	18	26548082	46969551	Rat
12904675	Am19	Aortic mass QTL 19		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	18	26548082	46969551	Rat
631264	Scl22	Serum cholesterol level QTL 22	6.2		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	18	11941791	31393320	Rat
2293704	Bss35	Bone structure and strength QTL 35	4.59	0.0002	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	18	28964853	73964853	Rat
9589816	Gluco68	Glucose level QTL 68	7.25	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	18	29792965	74792965	Rat
1331775	Bp235	Blood pressure QTL 235	3.201		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	18234564	31359530	Rat
2325839	Bp348	Blood pressure QTL 348		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	25570985	70570985	Rat
1600373	Mamtr6	Mammary tumor resistance QTL 6			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	18	19278901	83218561	Rat
2293708	Bss46	Bone structure and strength QTL 46	8.8	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	18	11791518	63636873	Rat
8694378	Bw157	Body weight QTL 157	3.59	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	18	29792965	74792965	Rat
2300177	Bmd65	Bone mineral density QTL 65	19.7	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	18	28964853	73964853	Rat
9589153	Insul31	Insulin level QTL 31	7.15	0.05	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	18	1	42547119	Rat
1578667	Bss21	Bone structure and strength QTL 21	3.5		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	18	11791518	83218561	Rat
2312598	Bp340	Blood pressure QTL 340		0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	1	30558703	Rat
2300180	Bmd67	Bone mineral density QTL 67	4.8	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	18	1	34291613	Rat
2299160	Iddm35	Insulin dependent diabetes mellitus QTL 35	2.79		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	18	4207941	60377792	Rat
9590318	Scort22	Serum corticosterone level QTL 22	7.64	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	18	29792965	74792965	Rat
1578661	Bss20	Bone structure and strength QTL 20	3.7		femur morphology trait (VT:0000559)	femoral neck cross-sectional area (CMO:0001697)	18	11791518	83218561	Rat
1331753	Bp231	Blood pressure QTL 231	3.643		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	11944299	52293055	Rat
1331754	Bp230	Blood pressure QTL 230	4.61609		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	29792965	74792965	Rat
2293661	Bss50	Bone structure and strength QTL 50	4.64	0.0003	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	18	1	34291613	Rat
61375	Bp41	Blood pressure QTL 41	2.4		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	18	11944299	41122201	Rat

RH130159

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	30,090,244 - 30,090,450 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	31,402,050 - 31,402,255	NCBI	Rnor6.0
Rnor_5.0	18	31,082,071 - 31,082,276	UniSTS	Rnor5.0
RGSC_v3.4	18	31,183,855 - 31,184,060	UniSTS	RGSC3.4
Celera	18	29,731,055 - 29,731,260	UniSTS
RH 3.4 Map	18	435.2	UniSTS
Cytogenetic Map	18	p11	UniSTS

RH134338

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	30,097,765 - 30,097,958 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	31,409,571 - 31,409,763	NCBI	Rnor6.0
Rnor_5.0	18	31,089,592 - 31,089,784	UniSTS	Rnor5.0
RGSC_v3.4	18	31,191,376 - 31,191,568	UniSTS	RGSC3.4
Celera	18	29,738,576 - 29,738,768	UniSTS
RH 3.4 Map	18	435.7	UniSTS
Cytogenetic Map	18	p11	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_199493	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006254634	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063277368	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC064660	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473974	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ211991	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000018	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000026273 ⟹ ENSRNOP00000026273

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	30,085,126 - 30,098,756 (+)	Ensembl
Rnor_6.0 Ensembl	18	31,396,922 - 31,409,907 (+)	Ensembl

RefSeq Acc Id:

NM_199493 ⟹ NP_955787

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	30,336,364 - 30,349,285 (+)	NCBI
mRatBN7.2	18	30,085,182 - 30,098,103 (+)	NCBI
Rnor_6.0	18	31,396,987 - 31,409,908 (+)	NCBI
Rnor_5.0	18	31,076,930 - 31,089,931 (+)	NCBI
RGSC_v3.4	18	31,178,792 - 31,191,713 (+)	RGD
Celera	18	29,725,992 - 29,738,913 (+)	RGD

Sequence:

show sequence

CCTCGATCCCTTGGCTGCAAGCTCTATGGTGCTGCTACGACATGTGGCGCCTGACAGGGATCCTGGGGCGAGCTCTTCCTCGCCTGCTGGGACCAGGCTTCCGAGGGATAACACCCAAACCCACCAGT
TCAGATGGGCCTCAGACAACCTCCACTACCCTGCTACTCCCTAGGGTCAACTTTGACAGATCAGGCTCCCATGGTTCAAAGAGGAACAGGGACCCAAAGTGCTGTGGATGGAAAGAGGCCTTCCACTG
GATGTCTGCTCATGTCTCCCCAAACACTCTGCGGGATGCCGTCTCCTGGGGCACTCTGGCCGTGCTGGCCTTGCACCTGGCGAGGCAGATTCACTTCCATGCACCTCTGGTAGCAGGACCTCAGTCAG
CTGAACGCTGCTCTTGGCACAGTCCCCTGTACCGCTTCCTCTCCTCTTCCTGGTGGCACCCGCACTCCTCACTTCGGAGGTATGTTCTTCCCAGTCCTGACTGCCCGGCTCCCAGGAACACTGGCCTG
AGGGAACCAAGACTGGGCCAGGAAGAACCCGCAGCTCGATCCCAGGGCCTTCCTTCAGATAGCTCCCTGAAACCTGGCCTTCTGAACCTACCTGAAGAAGAGCCCAGTGACTTTGGCTTCCTGAATGC
TAGCAGGGACTTCACATCCCAGGCAAAGGCAGCTGAGGCCGGCCCCCCTGGAGGAAAAAATGAGCAAGACAAGCCCAAGGCTCTTCCTCTGGAGGAGGCTGTGACTTCCATCCAGCAACTCTTTCAGC
TCAGCGTTGCCATTGCTTTCAACTTCCTGGGGACAGAGAACATAAAGACAGGGGACTACACAGCAGCCTTCTCCTACTTCCAGAAAGCCGCAGACCGTGGCTACAGCAAAGCACAGTACAATGTGGGC
TTGTGCCTAGAGCATGGCAGAGGCACCCCCAGGGACCTCAGCAAGGCTGTCCTCTTTTACCACCTGGCTGCTGTCCAGGGCCACAGCCTGGCTCAGTACCGCTATGCCAGGTGCCTGCTGCAAAGTCC
AGGCTCTATGTCAGACCCCGAGCGACAGAGGGCTGTCTCTCTGCTGAAGCAGGCTGCAGACTCTGGCTTGACAGAGGCCCAGGCTTTCCTTGGGGTACTGTTTACCAAGGAACCACACCTGGATGAAC
AGAAAGCTGTAAAATACTTTTGGCTGGCAGCCAGCAATGGGGACTCTCAGAGCAGATTCCACTTGGGAATTTGCTATGAGAAGGGCCTTGGTGTACAGAGGAATCTGGGAGAGGCTGTGAAGTGCTAC
CAGAAGTCAGCGGCTATGGGGAACGAACCCGCCCAGGAGAGGCTTCGGACCCTCTTTAATGTGGAAGCAGCAGGGCCCAGCCACCTGGCTATAGGACTGAAGTCTTTCTCCAGCCCCTCCCTCTGTAG
CCTGAACACCTTCTTGGCTGGCGCCTCAGGCCTCCCTCATGCCTCAAGCACTGGAAACCTAGGCCTCCTCTGCAGAAGTGGCCATCTTGGAACCAGCCATGGAGCCCCCAGCAGGGCTATGCCATCCT
TGGAAAGGAGTCTCGTAAGACTGGGTTTTGGCTAAGACCTCGTCCTTAGGAATGAGAGTTCTCAGAGACAGCACAATTTGAGTCCCAAAGAAGAGGCAAGTTAGCTACTTACCCTCCCAGAAACCATC
AGCACCTCCCAGCTCCATAAAGAAGAGGAAGGTGTGTGAAGAGCTAGAGGGCTGTGCCACCTGGAAGCGATGACCGGATTTCTACCATGCTTCCTCAGTTGTAGACTGAAGGCTCCTGCCTTAAAGAT
TGAGGTGCAACCATTTCCCTGCAGAAAGATCCTTACTCCTTGCTTAGGTTCCCAAAGACAGACTGGTGCCTGCAGTTCCACGGCCTTAAGAATCACCAGGCTGCTGGGGTGGTGACCCACGCCCAATC
CCAGCACTCAGGAGGCAGAGGGGCAGGCAGATGTCTATGAATTCAAGGCCAGCCTGGTCTACAAAGTGAGTTCCAGGACAGCCAAGGCTGTAATCACAGAGAAACCCTGTCTCAAATCACCACCACCA
CCACCATATAAAACAAAAAGAACAAAACAAAAAAAGAAGAGGAGGAGGAGGAGGAAGAGGAATTACCAGGTCAAGATGAAGATCAAAACTGACATCATGACTCTGGCCCAGACTTCTGGTCTACCAGT
CCACACTGCCATGTTATTTGAAAACATTATCTATTGTCACCCTGTAGAACAGTTGAGATTAGGCACCTGGAGTCTTGGAGCCAGAGGGTGGAGACCATGAGTCCTTTTTAGGAAAGGTCAGGTAGGGA
TATATAAGTGTTTAATAAAACAGATGGTGGATTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_006254634 ⟹ XP_006254696

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	30,325,369 - 30,349,285 (+)	NCBI
mRatBN7.2	18	30,085,093 - 30,098,105 (+)	NCBI
Rnor_6.0	18	31,396,897 - 31,409,914 (+)	NCBI
Rnor_5.0	18	31,076,930 - 31,089,931 (+)	NCBI

Sequence:

show sequence

CCGGCAGGGCTCCTTGCTAATTGGCTGGCTGGGGACTCGGCTGCTAGGGACTGCGCAGTATCAA
CTCTGGTCCCTGTCCTGTCCTTCGGACCTCGATCCCTTGGCTGCAAGCTCTATGGTGCTGCTACGACATGTGGCGCCTGACAGGGATCCTGGGGCGAGGTAGGGGCTGTCTGCAAGCTCTTCCTCGCC
TGCTGGGACCAGGCTTCCGAGGGATAACACCCAAACCCACCAGTTCAGATGGGCCTCAGACAACCTCCACTACCCTGCCACTCCCTAGGGTCAACTTTGACAGATCAGGCTCCCATGGTTCAAAGAGG
AACAGGGACCCAAAGTGCTGTGGATGGAAAGAGGCCTTCCACTGGATGTCTGCTCATGTCTCCCCAAACACTCTGCGGGATGCCGTCTCCTGGGGCACTCTGGCCGTGCTGGCCTTGCACCTGGCGAG
GCAGATTCACTTCCATGCACCTCTGGTAGCAGGACCTCAGTCAGCTGAACGCTGCTCTTGGCACAGTCCCCTGTACCGCTTCCTCTCCTCTTCCTGGTGGCACCCGCACTCCTCACTTCGGAGGCATG
TTCTTCCCAGTCCTGACTGCCCGGCTCCCAGGAACACTGGCCTGAGGGAACCAAGACTGGGCCAGGAAGAACCCGCAGCTCGATCCCAGGGCCTTCCTTCAGATAGCTCCCTGAAACCTGGCCTTCTG
AACCTACCTGAAGAAGAGCCCAGTGACTTTGGCTTCCTGAATGCTAGCAGGGACTTCACATCCCAGGCAAAGGCAGCTGAGGCCGGCCCCCCTGGAGGAAAAAATGAGCAAGACAAGCCCAAGGCTCT
TCCTCTGGAGGAGGCTGTGACTTCCATCCAGCAACTCTTTCAGCTCAGCGTTGCCATTGCTTTCAACTTCCTGGGGACAGAGAACATAAAGACAGGGGACTACACAGCAGCCTTCTCCTACTTCCAGA
AAGCTGCAGACCGTGGCTACAGCAAAGCACAGTACAATGTGGGCTTGTGCCTAGAGCATGGCAGAGGCACCCCCAGGGACCTCAGCAAGGCTGTCCTCTTTTACCACCTGGCTGCTGTCCAGGGCCAC
AGCCTGGCTCAGTACCGCTATGCCAGGTGCCTGCTGCAAAGTCCAGGCTCTATGTCAGACCCCGAGCGACAGAGGGCTGTCTCTCTGCTGAAGCAGGCTGCAGACTCTGGCTTGACAGAGGCCCAGGC
TTTCCTTGGGGTACTGTTTACCAAGGAACCACACCTGGATGAACAGAAAGCTGTAAAATACTTTTGGCTGGCAGCCAGCAATGGGGACTCTCAGAGCAGATTCCACTTGGGAATTTGCTATGAGAAGG
GCCTTGGTGTACAGAGGAATCTGGGAGAGGCTGTGAAGTGCTACCAGAAGTCAGCGGCTATGGGGAACGAACCCGCCCAGGAGAGGCTTCGGACCCTCTTTAATGTGGAAGCAGCAGGGCCCAGCCAC
CTGGCTATAGGACTGAAGTCTTTCTCCAGCCCCTCCCTCTGTAGCCTGAACACCTTCTTGGCTGGCGCCTCAGGCCTCCCTCATGCCTCAAGCACTGGAAACCTAGGCCTCCTCTGCAGAAGTGGCCA
TCTTGGAACCAGCCATGGAGCCCCCAGCAGGGCTATGCCATCCTTGGAAAGGAGTCTCGTAAGACTGGGTTTTGGCTAAGACCTCGTCCTTAGGAATGAGAGTTCTCAGAGACAGCACAATTTGAGTC
CCAAAGAAGAGGCAAGTTAGCTACTTACCCTCCCAGAAACCATCAGCACCTCCCAGCTCCATAAAGAAGAGGAAGGTGTGTGAAGAGCTAGAGGGCTGTGCCACCTGGAAGCGATGACCGGATTTCTA
CCATGCTTCCTCAGTTGTAGACTGAAGGCTCCTGCCTTAAAGATTGAGGTGCAACCATTTCCCTGCAGAAAGATCCTTACTCCTTGCTTAGGTTCCCAAAGACAGACTGGTGCCTGCAGTTCCACGGC
CTTAAGAATCACCAGGCTGCTGGGGTGGTGACCCACGCCCAATCCCAGCACTCAGGAGGCAGAGGGGCAGGCAGATGTCTATGAATTCAAGGCCAGCCTGGTCTACAAAGTGAGTTCCAGGACAGCCA
AGGCTGTAATCACAGAGAAACCCTGTCTCAAATCACCACCACCACCACCATATAAAACAAAAAGAACAAAACAAAAAAAGAAGAGGAGGAGGAGGAGGAAGAGGAATTACCAGGTCAAGATGAAGATC
AAAACTGACATCATGACTCTGGCCCAGACTTCTGGTCTACCAGTCCACACTGCCATGTTATTTGAAAACATTATCTATTGTCACCCTGTAGAACAGTGGAGATTAGGCACCTGGAGTCTTGGAGCCAG
AGGGTGGAGACCATGAGTCCTTTTTAGGAAAGGTCAGGTAGGGATATATAAGTGTTTAATAAAACAGATGGTGGATTACCTCTC

hide sequence

RefSeq Acc Id:

XM_063277368 ⟹ XP_063133438

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	30,325,369 - 30,348,490 (+)	NCBI


Protein RefSeqs	NP_955787	(Get FASTA)	NCBI Sequence Viewer
	XP_006254696	(Get FASTA)	NCBI Sequence Viewer
	XP_063133438	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH64660	(Get FASTA)	NCBI Sequence Viewer
	EDL76433	(Get FASTA)	NCBI Sequence Viewer
	EDL76434	(Get FASTA)	NCBI Sequence Viewer
	EDL76435	(Get FASTA)	NCBI Sequence Viewer
	EDL76436	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000026273
	ENSRNOP00000026273.4
GenBank Protein	P60924	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_955787 ⟸ NM_199493

- Sequence:

show sequence

MWRLTGILGRALPRLLGPGFRGITPKPTSSDGPQTTSTTLLLPRVNFDRSGSHGSKRNRDPKCCGWKEAFHWMSAHVSPNTLRDAVSWGTLAVLALHLARQIHFHAPLVAGPQSAERCSWHSPLYRFL
SSSWWHPHSSLRRYVLPSPDCPAPRNTGLREPRLGQEEPAARSQGLPSDSSLKPGLLNLPEEEPSDFGFLNASRDFTSQAKAAEAGPPGGKNEQDKPKALPLEEAVTSIQQLFQLSVAIAFNFLGTEN
IKTGDYTAAFSYFQKAADRGYSKAQYNVGLCLEHGRGTPRDLSKAVLFYHLAAVQGHSLAQYRYARCLLQSPGSMSDPERQRAVSLLKQAADSGLTEAQAFLGVLFTKEPHLDEQKAVKYFWLAASNG
DSQSRFHLGICYEKGLGVQRNLGEAVKCYQKSAAMGNEPAQERLRTLFNVEAAGPSHLAIGLKSFSSPSLCSLNTFLAGASGLPHASSTGNLGLLCRSGHLGTSHGAPSRAMPSLERSLVRLGFG

hide sequence

RefSeq Acc Id:

XP_006254696 ⟸ XM_006254634

- Peptide Label:

isoform X1

- Sequence:

show sequence

MWRLTGILGRGRGCLQALPRLLGPGFRGITPKPTSSDGPQTTSTTLPLPRVNFDRSGSHGSKRNRDPKCCGWKEAFHWMSAHVSPNTLRDAVSWGTLAVLALHLARQIHFHAPLVAGPQSAERCSWHS
PLYRFLSSSWWHPHSSLRRHVLPSPDCPAPRNTGLREPRLGQEEPAARSQGLPSDSSLKPGLLNLPEEEPSDFGFLNASRDFTSQAKAAEAGPPGGKNEQDKPKALPLEEAVTSIQQLFQLSVAIAFN
FLGTENIKTGDYTAAFSYFQKAADRGYSKAQYNVGLCLEHGRGTPRDLSKAVLFYHLAAVQGHSLAQYRYARCLLQSPGSMSDPERQRAVSLLKQAADSGLTEAQAFLGVLFTKEPHLDEQKAVKYFW
LAASNGDSQSRFHLGICYEKGLGVQRNLGEAVKCYQKSAAMGNEPAQERLRTLFNVEAAGPSHLAIGLKSFSSPSLCSLNTFLAGASGLPHASSTGNLGLLCRSGHLGTSHGAPSRAMPSLERSLVRL
GFG

hide sequence

Ensembl Acc Id:

ENSRNOP00000026273 ⟸ ENSRNOT00000026273

RefSeq Acc Id:	XP_063133438 ⟸ XM_063277368
- Peptide Label:	isoform X2
- UniProtKB:	P60924 (UniProtKB/Swiss-Prot), G3V8I7 (UniProtKB/Swiss-Prot)

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P60924-F1-model_v2	AlphaFold	P60924	1-509	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13700739

Promoter ID:

EPDNEW_R11263

Type:

initiation region

Name:

RGD735029_1

Description:

SEL1 domain containing protein RGD735029

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	18	31,396,972 - 31,397,032	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-7779	BioCyc
Ensembl Genes	ENSRNOG00000019276	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000026273	ENTREZGENE
	ENSRNOT00000026273.8	UniProtKB/Swiss-Prot
Gene3D-CATH	1.25.40.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:5623815	IMAGE-MGC_LOAD
InterPro	ISR_Activator	UniProtKB/Swiss-Prot
	Sel1-like	UniProtKB/Swiss-Prot
	TPR-like_helical_dom_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:307480	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72566	IMAGE-MGC_LOAD
NCBI Gene	307480	ENTREZGENE
PANTHER	DAP3-BINDING CELL DEATH ENHANCER 1	UniProtKB/Swiss-Prot
	DAP3-BINDING CELL DEATH ENHANCER 1	UniProtKB/Swiss-Prot
Pfam	Sel1	UniProtKB/Swiss-Prot
PhenoGen	Dele1	PhenoGen
RatGTEx	ENSRNOG00000019276	RatGTEx
SMART	SEL1	UniProtKB/Swiss-Prot
Superfamily-SCOP	HCP-like	UniProtKB/Swiss-Prot
UniProt	DELE1_RAT	UniProtKB/Swiss-Prot
	G3V8I7	ENTREZGENE
	P60924	ENTREZGENE
UniProt Secondary	G3V8I7	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2018-03-01	Dele1	DAP3 binding cell death enhancer 1	RGD735029	SEL1 domain containing protein RGD735029	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-11-17	RGD735029	SEL1 domain containing protein RGD735029	MGC72566	similar to Hypothetical protein KIAA0141	Symbol and Name updated	1299863	APPROVED
2005-09-30	MGC72566				Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar