Symbol:
Hrc
Name:
histidine rich calcium binding protein
RGD ID:
727864
Description:
Predicted to enable ATPase binding activity; calcium ion binding activity; and transmembrane transporter binding activity. Involved in negative regulation of calcium ion import into sarcoplasmic reticulum and negative regulation of cytosolic calcium ion concentration. Predicted to be located in several cellular components, including Z disc; mitochondrion; and sarcoplasmic reticulum membrane. Orthologous to human HRC (histidine rich calcium binding protein); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
sarcoplasmic reticulum histidine-rich calcium-binding protein
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 104,949,750 - 104,953,475 (+) NCBI GRCr8 mRatBN7.2 1 95,813,262 - 95,816,987 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 95,813,253 - 95,816,984 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 101,198,707 - 101,202,429 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 109,671,382 - 109,675,104 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 102,961,782 - 102,965,504 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 101,324,788 - 101,328,391 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 101,324,652 - 101,328,435 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 102,388,311 - 102,391,914 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 95,805,143 - 95,808,746 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 95,883,253 - 95,886,857 (+) NCBI Celera 1 90,069,730 - 90,073,333 (+) NCBI Celera Cytogenetic Map 1 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Hrc Rat 1,2-dimethylhydrazine decreases expression ISO Hrc (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of HRC mRNA CTD PMID:22206623 Hrc Rat 17beta-estradiol decreases expression ISO Hrc (Mus musculus) 6480464 Estradiol results in decreased expression of HRC mRNA CTD PMID:19484750 Hrc Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of HRC mRNA CTD PMID:32145629 Hrc Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of HRC mRNA CTD PMID:32109520 Hrc Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of HRC mRNA CTD PMID:34747641 Hrc Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Hrc Rat 4,4'-sulfonyldiphenol increases expression ISO Hrc (Mus musculus) 6480464 bisphenol S results in increased expression of HRC mRNA CTD PMID:30951980 Hrc Rat 4,4'-sulfonyldiphenol decreases methylation ISO Hrc (Mus musculus) 6480464 bisphenol S results in decreased methylation of HRC exon CTD PMID:33297965 Hrc Rat 5-aza-2'-deoxycytidine affects expression ISO HRC (Homo sapiens) 6480464 Decitabine affects the expression of HRC mRNA CTD PMID:23300844 Hrc Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of HRC mRNA CTD PMID:24780913 Hrc Rat alpha-Zearalanol decreases expression EXP 6480464 Zeranol results in decreased expression of HRC mRNA CTD PMID:35163327 Hrc Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of HRC mRNA CTD PMID:35163327 Hrc Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of HRC mRNA CTD PMID:16483693 Hrc Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of HRC mRNA CTD PMID:30779732 Hrc Rat atrazine decreases expression EXP 6480464 Atrazine results in decreased expression of HRC mRNA CTD PMID:36841081 Hrc Rat benzo[a]pyrene decreases expression ISO Hrc (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of HRC mRNA CTD PMID:22228805 Hrc Rat benzo[a]pyrene decreases methylation ISO HRC (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of HRC 5' UTR and Benzo(a)pyrene results in decreased methylation of HRC exon CTD PMID:27901495 Hrc Rat benzo[a]pyrene affects methylation ISO HRC (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of HRC promoter CTD PMID:27901495 Hrc Rat benzo[a]pyrene increases methylation ISO HRC (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of HRC 3' UTR CTD PMID:27901495 Hrc Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of HRC mRNA CTD PMID:25181051 and PMID:32145629 Hrc Rat bisphenol A increases expression ISO HRC (Homo sapiens) 6480464 bisphenol A results in increased expression of HRC protein CTD PMID:37567409 Hrc Rat bisphenol A increases expression ISO Hrc (Mus musculus) 6480464 bisphenol A results in increased expression of HRC mRNA CTD PMID:30951980 Hrc Rat bisphenol F increases expression ISO Hrc (Mus musculus) 6480464 bisphenol F results in increased expression of HRC mRNA CTD PMID:30951980 Hrc Rat caffeine decreases phosphorylation ISO HRC (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of HRC protein CTD PMID:35688186 Hrc Rat cannabidiol decreases expression ISO HRC (Homo sapiens) 6480464 Cannabidiol results in decreased expression of HRC protein CTD PMID:34122009 Hrc Rat cantharidin decreases expression ISO Hrc (Mus musculus) 6480464 Cantharidin results in decreased expression of HRC mRNA CTD PMID:36907384 Hrc Rat carbon nanotube decreases expression ISO Hrc (Mus musculus) 6480464 Nanotubes and Carbon analog results in decreased expression of HRC mRNA CTD PMID:25620056 Hrc Rat carbon nanotube increases expression ISO Hrc (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of HRC mRNA CTD PMID:25620056 Hrc Rat cisplatin affects expression ISO HRC (Homo sapiens) 6480464 Cisplatin affects the expression of HRC mRNA CTD PMID:23300844 Hrc Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of HRC mRNA CTD PMID:27523638 Hrc Rat daunorubicin decreases expression ISO HRC (Homo sapiens) 6480464 Daunorubicin results in decreased expression of HRC mRNA CTD PMID:26537877 and PMID:28940058 Hrc Rat dioxygen multiple interactions ISO Hrc (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of HRC mRNA CTD PMID:30529165 Hrc Rat doxorubicin decreases expression ISO HRC (Homo sapiens) 6480464 Doxorubicin results in decreased expression of HRC mRNA CTD PMID:26537877 more ... Hrc Rat doxorubicin affects expression ISO HRC (Homo sapiens) 6480464 Doxorubicin affects the expression of HRC protein CTD PMID:29385562 Hrc Rat Echimidine decreases expression EXP 6480464 echimidine results in decreased expression of HRC mRNA CTD PMID:34185104 Hrc Rat ethylparaben decreases expression ISO HRC (Homo sapiens) 6480464 ethyl-p-hydroxybenzoate results in decreased expression of HRC mRNA CTD PMID:37690743 Hrc Rat flavonoids decreases expression EXP 6480464 Flavonoids results in decreased expression of HRC mRNA CTD PMID:18035473 Hrc Rat folic acid decreases expression ISO HRC (Homo sapiens) 6480464 Folic Acid results in decreased expression of HRC mRNA CTD PMID:21867686 Hrc Rat genistein increases expression ISO Hrc (Mus musculus) 6480464 Genistein results in increased expression of HRC mRNA CTD PMID:32186404 Hrc Rat Heliotrine decreases expression EXP 6480464 heliotrine results in decreased expression of HRC mRNA CTD PMID:34185104 Hrc Rat Indeno[1,2,3-cd]pyrene decreases expression ISO Hrc (Mus musculus) 6480464 indeno(1 more ... CTD PMID:26377693 Hrc Rat leflunomide increases expression ISO HRC (Homo sapiens) 6480464 leflunomide results in increased expression of HRC mRNA CTD PMID:28988120 Hrc Rat methamphetamine multiple interactions EXP 6480464 [Methamphetamine co-treated with SCH 23390] results in decreased expression of HRC mRNA CTD PMID:19564919 Hrc Rat methamphetamine decreases expression EXP 6480464 Methamphetamine results in decreased expression of HRC mRNA CTD PMID:19564919 Hrc Rat mitoxantrone decreases expression ISO HRC (Homo sapiens) 6480464 Mitoxantrone results in decreased expression of HRC mRNA CTD PMID:26537877 and PMID:28940058 Hrc Rat N-ethyl-N-nitrosourea increases mutagenesis ISO Hrc (Mus musculus) 6480464 Ethylnitrosourea results in increased mutagenesis of HRC mRNA CTD PMID:27776689 Hrc Rat N-methyl-4-phenylpyridinium increases expression ISO HRC (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of HRC mRNA CTD PMID:24810058 Hrc Rat ozone multiple interactions ISO Hrc (Mus musculus) 6480464 [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of HRC mRNA CTD PMID:34911549 Hrc Rat perfluorooctanoic acid increases expression EXP 6480464 perfluorooctanoic acid results in increased expression of HRC mRNA CTD PMID:35163327 Hrc Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of HRC mRNA CTD PMID:35163327 Hrc Rat pioglitazone multiple interactions ISO Hrc (Mus musculus) 6480464 [N-nitroso-tris-chloroethylurea co-treated with pioglitazone] results in decreased expression of HRC mRNA CTD PMID:27935865 Hrc Rat SCH 23390 decreases expression EXP 6480464 SCH 23390 results in decreased expression of HRC mRNA CTD PMID:19564919 Hrc Rat SCH 23390 multiple interactions EXP 6480464 [Methamphetamine co-treated with SCH 23390] results in decreased expression of HRC mRNA CTD PMID:19564919 Hrc Rat sulforaphane increases expression ISO Hrc (Mus musculus) 6480464 sulforaphane results in increased expression of HRC mRNA CTD PMID:30529165 Hrc Rat tetrachloromethane increases expression ISO Hrc (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of HRC mRNA and Carbon Tetrachloride results in increased expression of HRC protein CTD PMID:33309619 Hrc Rat tetrachloromethane multiple interactions ISO Hrc (Mus musculus) 6480464 Vitamin D inhibits the reaction [Carbon Tetrachloride results in increased expression of HRC mRNA] and Vitamin D inhibits the reaction [Carbon Tetrachloride results in increased expression of HRC protein] CTD PMID:33309619 Hrc Rat titanium dioxide decreases expression ISO Hrc (Mus musculus) 6480464 titanium dioxide results in decreased expression of HRC mRNA CTD PMID:23557971 Hrc Rat toluene increases expression ISO HRC (Homo sapiens) 6480464 Toluene results in increased expression of HRC mRNA CTD PMID:26717081 Hrc Rat toluene decreases methylation ISO HRC (Homo sapiens) 6480464 Toluene results in decreased methylation of HRC gene CTD PMID:26717081 Hrc Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of HRC mRNA CTD PMID:33387578 Hrc Rat triclosan decreases expression ISO HRC (Homo sapiens) 6480464 Triclosan results in decreased expression of HRC mRNA CTD PMID:30510588 Hrc Rat triptonide increases expression ISO Hrc (Mus musculus) 6480464 triptonide results in increased expression of HRC mRNA CTD PMID:33045310 Hrc Rat vitamin D multiple interactions ISO Hrc (Mus musculus) 6480464 Vitamin D inhibits the reaction [Carbon Tetrachloride results in increased expression of HRC mRNA] and Vitamin D inhibits the reaction [Carbon Tetrachloride results in increased expression of HRC protein] CTD PMID:33309619 Hrc Rat vitamin D multiple interactions ISO HRC (Homo sapiens) 6480464 HRC protein inhibits the reaction [Vitamin D inhibits the reaction [TGFB1 protein results in increased expression of SMAD3 protein]] more ... CTD PMID:33309619 Hrc Rat zinc atom decreases expression EXP 6480464 Zinc deficiency results in decreased expression of HRC mRNA CTD PMID:19111725 Hrc Rat zinc(0) decreases expression EXP 6480464 Zinc deficiency results in decreased expression of HRC mRNA CTD PMID:19111725
1,2-dimethylhydrazine (ISO) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 4,4'-sulfonyldiphenol (ISO) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP) alpha-Zearalanol (EXP) ammonium chloride (EXP) amphetamine (EXP) atrazine (EXP) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) caffeine (ISO) cannabidiol (ISO) cantharidin (ISO) carbon nanotube (ISO) cisplatin (ISO) Cuprizon (EXP) daunorubicin (ISO) dioxygen (ISO) doxorubicin (ISO) Echimidine (EXP) ethylparaben (ISO) flavonoids (EXP) folic acid (ISO) genistein (ISO) Heliotrine (EXP) Indeno[1,2,3-cd]pyrene (ISO) leflunomide (ISO) methamphetamine (EXP) mitoxantrone (ISO) N-ethyl-N-nitrosourea (ISO) N-methyl-4-phenylpyridinium (ISO) ozone (ISO) perfluorooctanoic acid (EXP) pioglitazone (ISO) SCH 23390 (EXP) sulforaphane (ISO) tetrachloromethane (ISO) titanium dioxide (ISO) toluene (ISO) trichloroethene (EXP) triclosan (ISO) triptonide (ISO) vitamin D (ISO) zinc atom (EXP) zinc(0) (EXP)
Hrc (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 104,949,750 - 104,953,475 (+) NCBI GRCr8 mRatBN7.2 1 95,813,262 - 95,816,987 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 95,813,253 - 95,816,984 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 101,198,707 - 101,202,429 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 109,671,382 - 109,675,104 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 102,961,782 - 102,965,504 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 101,324,788 - 101,328,391 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 101,324,652 - 101,328,435 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 102,388,311 - 102,391,914 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 95,805,143 - 95,808,746 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 95,883,253 - 95,886,857 (+) NCBI Celera 1 90,069,730 - 90,073,333 (+) NCBI Celera Cytogenetic Map 1 q22 NCBI
HRC (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 49,151,198 - 49,155,396 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 49,151,198 - 49,155,396 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 49,654,455 - 49,658,653 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 54,346,267 - 54,350,493 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 54,346,269 - 54,350,476 NCBI Celera 19 46,521,679 - 46,525,908 (-) NCBI Celera Cytogenetic Map 19 q13.33 NCBI HuRef 19 46,030,689 - 46,034,918 (-) NCBI HuRef CHM1_1 19 49,656,583 - 49,660,812 (-) NCBI CHM1_1 T2T-CHM13v2.0 19 52,145,932 - 52,150,133 (-) NCBI T2T-CHM13v2.0
Hrc (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 44,984,693 - 44,988,397 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 44,984,714 - 44,988,398 (+) Ensembl GRCm39 Ensembl GRCm38 7 45,335,269 - 45,338,973 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 45,335,290 - 45,338,974 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 52,590,639 - 52,594,343 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 45,203,443 - 45,207,015 (+) NCBI MGSCv36 mm8 Celera 7 40,791,527 - 40,795,231 (+) NCBI Celera Cytogenetic Map 7 B3 NCBI cM Map 7 29.26 NCBI
Hrc (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955559 1,583,876 - 1,587,355 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955559 1,583,661 - 1,587,457 (+) NCBI ChiLan1.0 ChiLan1.0
HRC (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 55,266,107 - 55,270,451 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 57,185,639 - 57,189,978 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 46,162,231 - 46,166,606 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 55,089,281 - 55,093,689 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 55,089,384 - 55,093,463 (-) Ensembl panpan1.1 panPan2
HRC (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 107,304,718 - 107,308,741 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 107,304,924 - 107,308,740 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 106,892,417 - 106,896,448 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 107,829,579 - 107,833,610 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 107,811,395 - 107,833,766 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 107,497,676 - 107,501,707 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 107,143,909 - 107,147,940 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 107,979,496 - 107,983,527 (+) NCBI UU_Cfam_GSD_1.0
Hrc (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409349 21,470,024 - 21,473,846 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936664 3,083,602 - 3,092,308 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936664 3,088,072 - 3,092,034 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
HRC (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 54,337,347 - 54,341,625 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 54,337,348 - 54,341,638 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 49,986,764 - 49,990,919 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
HRC (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 6 42,372,758 - 42,378,273 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 6 42,372,861 - 42,377,267 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666073 22,265,945 - 22,271,134 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Hrc (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 66 Count of miRNA genes: 66 Interacting mature miRNAs: 66 Transcripts: ENSRNOT00000028116 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2313059 Bss55 Bone structure and strength QTL 55 3.2 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 70209 Niddm23 Non-insulin dependent diabetes mellitus QTL 23 2.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 94494440 198324465 Rat 631688 Hcas2 Hepatocarcinoma susceptibility QTL 2 3 0.0001 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 5925874 115540829 Rat 1582234 Gluco18 Glucose level QTL 18 3.4 0.0003 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 78479925 123479925 Rat 1358359 Sradr1 Stress Responsive Adrenal Weight QTL 1 4.74 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 30882023 123479925 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 1331793 Bp200 Blood pressure QTL 200 3.71601 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94494440 172949803 Rat 1578654 Bss10 Bone structure and strength QTL 10 4 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 1 49393172 159356837 Rat 2300324 Fetw1 Fetal weight QTL 1 12.1 0.005 fetal growth trait (VT:0004201) fetal body weight (CMO:0002080) 1 85424647 100358001 Rat 1300121 Hrtrt1 Heart rate QTL 1 3.7 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 65789093 115540829 Rat 1331800 Scl25 Serum cholesterol level QTL 25 3.013 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 1 94494440 117601394 Rat 7421628 Bp361 Blood pressure QTL 361 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 66023617 118608521 Rat 631495 Bp96 Blood pressure QTL 96 4.52 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 22340647 102268831 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 2298545 Neuinf8 Neuroinflammation QTL 8 4.6 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 1 57336763 151090257 Rat 2313072 Bss53 Bone structure and strength QTL 53 4.3 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 43284731 118944897 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 2313078 Bss54 Bone structure and strength QTL 54 3.5 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 1302788 Scl19 Serum cholesterol QTL 19 4.6 0.001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 90532338 123479925 Rat 1549903 Bp267 Blood pressure QTL 267 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 77876254 106047988 Rat 2313083 Bmd74 Bone mineral density QTL 74 4 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 1 82174743 118944897 Rat 2313402 Anxrr24 Anxiety related response QTL 24 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 1 48963584 144267916 Rat 4889494 Scort2 Serum corticosterone level QTL 2 4.2 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 80592172 125592172 Rat 724567 Tcas6 Tongue tumor susceptibility QTL 6 6.85 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 1 92948896 144267916 Rat 61342 Bp27 Blood pressure QTL 27 3.4 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 56732668 98773277 Rat 61344 Bp29 Blood pressure QTL 29 7.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 78350581 123350581 Rat 724521 Uae1 Urinary albumin excretion QTL 1 3.8 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 90508614 173018436 Rat 1358902 Bw47 Body weight QTL 47 1.67 body mass (VT:0001259) body weight (CMO:0000012) 1 90508614 180359386 Rat 1358192 Ept13 Estrogen-induced pituitary tumorigenesis QTL 13 3.4 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 77494165 122494165 Rat 2313094 Bss58 Bone structure and strength QTL 58 3.7 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 43284731 118944897 Rat 2300164 Bmd44 Bone mineral density QTL 44 5.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 1 56949932 101949932 Rat 2313099 Bss56 Bone structure and strength QTL 56 2.4 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 1 43284731 118944897 Rat 2313098 Bmd70 Bone mineral density QTL 70 3.6 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 43284731 118944897 Rat 1300153 Bp171 Blood pressure QTL 171 3.37 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 90664883 143200202 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 738022 Anxrr13 Anxiety related response QTL 13 4.6 0.00039 locomotor behavior trait (VT:0001392) number of 20 x 20 cm floor squares crossed into, out of or within a discrete space in an experimental apparatus (CMO:0001514) 1 83547917 128547917 Rat 152025249 Scl82 Serum cholesterol level QTL 82 4.77 blood cholesterol amount (VT:0000180) 1 50343510 99980958 Rat 10054135 Gmadr2 Adrenal mass QTL 2 1.97 0.0129 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 77857876 122857876 Rat 7411712 Strs4 Sensitivity to stroke QTL 4 8.7 cerebrum integrity trait (VT:0010549) percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932) 1 78430536 123430536 Rat 1331749 Hrtrt11 Heart rate QTL 11 2.973 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 94494440 198211706 Rat 1331751 Bp199 Blood pressure QTL 199 3.60022 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 94494440 181830018 Rat 2293142 Bp314 Blood pressure QTL 314 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 92184926 137184926 Rat 2313051 Bss57 Bone structure and strength QTL 57 3.7 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 43284731 118944897 Rat 724529 Cm16 Cardiac mass QTL 16 2.7 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 1 87580395 150700247 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000028116 ⟹ ENSRNOP00000028116
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 95,813,253 - 95,816,977 (+) Ensembl Rnor_6.0 Ensembl 1 101,324,652 - 101,328,435 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000112846 ⟹ ENSRNOP00000097166
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 95,813,422 - 95,815,889 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000113100 ⟹ ENSRNOP00000084422
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 95,813,253 - 95,816,984 (+) Ensembl
RefSeq Acc Id:
NM_181369 ⟹ NP_852034
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 104,949,750 - 104,953,475 (+) NCBI mRatBN7.2 1 95,813,262 - 95,816,987 (+) NCBI Rnor_6.0 1 101,324,788 - 101,328,391 (+) NCBI Rnor_5.0 1 102,388,311 - 102,391,914 (+) NCBI RGSC_v3.4 1 95,805,143 - 95,808,746 (+) RGD Celera 1 90,069,730 - 90,073,333 (+) RGD
Sequence:
AGGCACAAGGACCCATCAGAGGCAGCTGAAGCCAGCCTGGTTAGACGCTCAGCTGCTAAACGAACGTCCCCATGGGCTTCCAGGAGCCATGGTTGTACAGTTGTCTCCTTTGGGCCACAGTGGCCATC CTGCTGGTCCCTCCAGTGGTGACCCAGGAGCTGAGAGGGACTGGGCTGGGCCTCGGCAACTGGAACAACAACGCAGGTATCCCTGGGTCCTCAGAGGACCTATCAACTGAGTATGGTCACCACATCCA CAGCCACGGGGCCTATCAAGGTGAGAAGGACAGACACCACAGAGAAGAAGATGAAGACTTCTCCAGGGAATATGGCCACCAAGTCCAAGACCACAGGTACCCTGGCCATGAAGTTGGGGAGGAGAATG TCTCAGAAGAGGTCTTCAGAGGGCATGTTAGACAGCTCCATGGGCACCACAAACCTAACAGTGAAGATTTAGGGGACTCAGCAGAGAGCCACTTCCCCAGACAGCAGAGCCACAACCGTGAAGAAGAG GACGGCGTTGTCTCCGGTGAGGATCACCGTCACATCCCCAGGCATGACCACCATGGCAACGAAGAGGAGGATGATGATGGAGAGGAGGAGGAGAGGGTGGGAGTGATGGAGAACTCTGATGATAAGCA CCAGGCCCACGGCCACCACAGCCACTCAAAAGAAAGAGATGGACTCCATCATGCCCACAGCCACAGGCACCAAGGGCACCATGATGAAGATGATGATGATGAAGATGGTGTCTCCACTGAGGGTGAAC ACCAAGCTCACAGATATCAAGACCATGATGAGGAAGACGATGATGACTCAGATGAAGAGAGTCATGCCCACAGACTTCAAGGCCAAGAAGATGAAAATGATGATGAAGATGGTGACTCCAGTGAAAAT GGACACCAGACCCAGGACCACCAAGGCCATAAAGAACAAGATGATGATGACGATGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGACGA TGACGACGACTCCACTGAGCACAGGCACAGGCACCAGACCCAAGGCCACAGGAAGGGAAAAGATGAGGATGAGTCAGATGAAGATGATCATGTCACCCGGCATGGCCGCCGAGGCCATGAAGATGAAG ATGATGACGATGACGATGACGATGACGATGATGACGACAATGATGGTGGCTCTACTGAGAATGTGCACCAAGCCCACAGACACAGAGGCCATGAGCACGAAGACGATGGGGATGACTCAGAAGAAGAC TACCATCATGTCCCCAGCCATGGTCACCAAAGCCATCAAAATGAGGAAGAGGAAGATGAGGCTGTCTCCACTGAACACTGGCACCAGTCTCCTAGACATGCTCACCATGATCTTGGACGTGAGAATCA AGAAGAGGCAACAGTCAAGTACAGCCGCCATGTTGCAAGCCATCGACCCCAAGGCCACAGTGCGGAGGAGGACTCTCTAGAAGACTCTACCAATGAAGTCCCTGGACATCACCACCACAGAGTCTCCA GGGATGGCGACGAAGACATTTCTACTGAGTTTGGCCACAAGGCCCCCAGACACAGGCTACAAGATCAAGATGAATGGACCAGGCAGGGTCACGGAAAATCTGTCCAGGAAGACATTGGTCATCAGCCC CTGCAGCCCACAGGTCCTGGTTCTGGAGAATCAAGGAAGGAAGATGACCACAGCTCTCAAGAGGGAGATGAGGACTTAAAGCAGAGACAAGAAGCCCACAGTGAGGAGGAGGAGGAGGAAGAGGAGGG CCATGGCCTCCCCATGAGCCTGGAAGATGAAGAGGAGGAAGAAAAAGATAAGAAAGAGAGCAAGGGAGACAGGGCTGCAGTTTCGGCTCCACTGAGTCATCACAGGAAGCATGATGATGATGATGACG GCGACGGTGATGATGATGATGACGACAATGACGACGATGATGAGATCCTGGAGGAAAACCTGCTACCTTTCACCATTATCCCAAACCCACTGGCTGGGAGGGAGGTGGCCAGAGAAGGTTCCAGTGAG GAGGAGAGCCGCGAGGTCACAGGTCAGCAGGATGCCCAGGAGTATGAGAACTACCAGCCAGGGTCCCTGTGTGGCTACTGTTCTTTCTGCAACCGATGTAGTGAATGTGAAAGCTGCCACTGTGATGA GGAGAACATGGGGGAACACTGTGACCAGTGTCAGCACTGCCAATTCTGCTACCTCTGCCCGCTGGTCTGTGACACACTCTGCACTCCAGGAAGCTACGTTGACTATTTCTCCTCCTCTGTGTATCAAG CTGTGGCTGACATGCTGGAGACGCAAGAGCCCTGATCTGGCCACCTGGCAAGAGCCGCATTTA
hide sequence
RefSeq Acc Id:
NP_852034 ⟸ NM_181369
- Peptide Label:
precursor
- UniProtKB:
G3V8S6 (UniProtKB/TrEMBL), A6JB08 (UniProtKB/TrEMBL), Q80W59 (UniProtKB/TrEMBL)
- Sequence:
MGFQEPWLYSCLLWATVAILLVPPVVTQELRGTGLGLGNWNNNAGIPGSSEDLSTEYGHHIHSHGAYQGEKDRHHREEDEDFSREYGHQVQDHRYPGHEVGEENVSEEVFRGHVRQLHGHHKPNSEDL GDSAESHFPRQQSHNREEEDGVVSGEDHRHIPRHDHHGNEEEDDDGEEEERVGVMENSDDKHQAHGHHSHSKERDGLHHAHSHRHQGHHDEDDDDEDGVSTEGEHQAHRYQDHDEEDDDDSDEESHAH RLQGQEDENDDEDGDSSENGHQTQDHQGHKEQDDDDDEEEEEEEEEEEEEEEEEEEEEEEDDDDDSTEHRHRHQTQGHRKGKDEDESDEDDHVTRHGRRGHEDEDDDDDDDDDDDDDNDGGSTENVHQ AHRHRGHEHEDDGDDSEEDYHHVPSHGHQSHQNEEEEDEAVSTEHWHQSPRHAHHDLGRENQEEATVKYSRHVASHRPQGHSAEEDSLEDSTNEVPGHHHHRVSRDGDEDISTEFGHKAPRHRLQDQD EWTRQGHGKSVQEDIGHQPLQPTGPGSGESRKEDDHSSQEGDEDLKQRQEAHSEEEEEEEEGHGLPMSLEDEEEEEKDKKESKGDRAAVSAPLSHHRKHDDDDDGDGDDDDDDNDDDDEILEENLLPF TIIPNPLAGREVAREGSSEEESREVTGQQDAQEYENYQPGSLCGYCSFCNRCSECESCHCDEENMGEHCDQCQHCQFCYLCPLVCDTLCTPGSYVDYFSSSVYQAVADMLETQEP
hide sequence
Ensembl Acc Id:
ENSRNOP00000028116 ⟸ ENSRNOT00000028116
Ensembl Acc Id:
ENSRNOP00000084422 ⟸ ENSRNOT00000113100
Ensembl Acc Id:
ENSRNOP00000097166 ⟸ ENSRNOT00000112846
RGD ID: 13690034
Promoter ID: EPDNEW_R559
Type: multiple initiation site
Name: Hrc_1
Description: histidine rich calcium binding protein
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 101,324,712 - 101,324,772 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-09-10
Hrc
histidine rich calcium binding protein
Symbol and Name status set to approved
1299863
APPROVED