Symbol:
Atg3
Name:
autophagy related 3
RGD ID:
708464
Description:
Enables Atg8-family conjugating enzyme activity. Involved in autophagy. Predicted to be part of Atg12-Atg5-Atg16 complex. Predicted to be active in cytosol and phagophore assembly site. Orthologous to human ATG3 (autophagy related 3); PARTICIPATES IN autophagy pathway; INTERACTS WITH 3,3',5,5'-tetrabromobisphenol A; 4-nonylphenol; aldehydo-D-glucose.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
APG3 autophagy 3-like; APG3 autophagy 3-like (S. cerevisiae); APG3-like; Apg3l; ATG3 autophagy related 3 homolog; ATG3 autophagy related 3 homolog (S. cerevisiae); autophagy-related 3; autophagy-related 3 (yeast); autophagy-related protein 3; PIG-1; Pig1; preconditioning-inducible gene 1 protein; ubiquitin-like-conjugating enzyme ATG3
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ATG3 (autophagy related 3) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Atg3 (autophagy related 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Atg3 (autophagy related 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ATG3 (autophagy related 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ATG3 (autophagy related 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Atg3 (autophagy related 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ATG3 (autophagy related 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ATG3 (autophagy related 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Atg3 (autophagy related 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
ATG3 (autophagy related 3)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Atg3 (autophagy related 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
atg3 (autophagy related 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
ATG3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Atg3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
atg-3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
atg3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 11 69,130,948 - 69,159,280 (-) NCBI GRCr8 mRatBN7.2 11 55,624,914 - 55,653,249 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 11 55,624,917 - 55,653,224 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 11 64,438,596 - 64,466,930 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 11 57,100,453 - 57,128,787 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 11 56,170,970 - 56,199,226 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 11 60,585,192 - 60,613,706 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 11 60,585,171 - 60,613,718 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 11 64,687,322 - 64,715,836 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 11 57,162,205 - 57,190,568 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 11 57,219,793 - 57,248,157 (-) NCBI Celera 11 55,191,074 - 55,219,238 (-) NCBI Celera Cytogenetic Map 11 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Atg3 Rat 1,2-dimethylhydrazine multiple interactions ISO RGD:1557224 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of ATG3 mRNA CTD PMID:22206623 Atg3 Rat 17beta-estradiol decreases expression ISO RGD:1557224 6480464 Estradiol results in decreased expression of ATG3 mRNA CTD PMID:39298647 Atg3 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO RGD:1353416 6480464 2,2',4,4'-tetrabromodiphenyl ether results in decreased expression of ATG3 protein CTD PMID:31675489 Atg3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1557224 6480464 Tetrachlorodibenzodioxin affects the expression of ATG3 mRNA CTD PMID:21570461 Atg3 Rat 2,4,6-tribromophenol decreases expression ISO RGD:1353416 6480464 2,4,6-tribromophenol results in decreased expression of ATG3 mRNA CTD PMID:31675489 Atg3 Rat 2-bromohexadecanoic acid multiple interactions ISO RGD:1353416 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in more ... CTD PMID:38195004 Atg3 Rat 2-deoxy-D-glucose multiple interactions ISO RGD:1353416 6480464 Deoxyglucose affects the reaction [demycarosyl-3D-digitoxosylmithramycin SK affects the expression of ATG3 mRNA] CTD PMID:26079942 Atg3 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression EXP 6480464 tetrabromobisphenol A results in decreased expression of ATG3 mRNA CTD PMID:28970181 Atg3 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO RGD:1353416 6480464 tetrabromobisphenol A results in decreased expression of ATG3 protein CTD PMID:31675489 Atg3 Rat 4,4'-sulfonyldiphenol decreases expression ISO RGD:1557224 6480464 bisphenol S results in decreased expression of ATG3 mRNA CTD PMID:29741722 Atg3 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:1353416 6480464 bisphenol S results in increased expression of ATG3 protein CTD PMID:34186270 Atg3 Rat 4-nonylphenol increases expression EXP 6480464 4-nonylphenol results in increased expression of ATG3 mRNA CTD PMID:28041982 Atg3 Rat 4-phenylbutyric acid multiple interactions ISO RGD:1353416 6480464 4-phenylbutyric acid inhibits the reaction [Cantharidin results in increased expression of ATG3 protein] CTD PMID:35398186 Atg3 Rat acrylamide increases expression ISO RGD:1557224 6480464 Acrylamide results in increased expression of ATG3 mRNA CTD PMID:34569336 Atg3 Rat aldehydo-D-glucose increases expression EXP 6480464 Glucose results in increased expression of ATG3 mRNA CTD PMID:38444079 Atg3 Rat aldehydo-D-glucose decreases expression EXP 6480464 Glucose results in decreased expression of ATG3 protein CTD PMID:39127087 Atg3 Rat aldehydo-D-glucose multiple interactions EXP 6480464 Berberine inhibits the reaction [Glucose results in decreased expression of ATG3 protein] CTD PMID:39127087 Atg3 Rat all-trans-retinoic acid multiple interactions ISO RGD:1353416 6480464 SPI1 protein affects the reaction [Tretinoin results in increased expression of ATG3 mRNA] CTD PMID:29743969 Atg3 Rat all-trans-retinoic acid increases expression ISO RGD:1353416 6480464 Tretinoin results in increased expression of ATG3 mRNA CTD PMID:29743969 Atg3 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of ATG3 mRNA CTD PMID:16483693 Atg3 Rat amphotericin B decreases expression ISO RGD:1353416 6480464 Amphotericin B results in decreased expression of ATG3 mRNA CTD PMID:20849824 Atg3 Rat arsane multiple interactions ISO RGD:1353416 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of ATG3 more ... CTD PMID:39836092 Atg3 Rat arsenic atom multiple interactions ISO RGD:1353416 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of ATG3 more ... CTD PMID:39836092 Atg3 Rat arsenite(3-) increases expression ISO RGD:1353416 6480464 arsenite results in increased expression of ATG3 mRNA CTD PMID:34929507 Atg3 Rat arsenous acid increases expression ISO RGD:1557224 6480464 Arsenic Trioxide results in increased expression of ATG3 mRNA CTD PMID:31846860|PMID:32112876|PMID:32781346 Atg3 Rat artesunate increases expression ISO RGD:1353416 6480464 Artesunate results in increased expression of ATG3 mRNA CTD PMID:30551460 Atg3 Rat atrazine multiple interactions ISO RGD:1557224 6480464 Lycopene inhibits the reaction [Atrazine results in decreased expression of ATG3 mRNA] CTD PMID:30360616 Atg3 Rat atrazine decreases expression ISO RGD:1557224 6480464 Atrazine results in decreased expression of ATG3 mRNA CTD PMID:30360616 Atg3 Rat benzo[a]pyrene increases expression ISO RGD:1557224 6480464 Benzo(a)pyrene results in increased expression of ATG3 mRNA CTD PMID:22228805 Atg3 Rat berberine multiple interactions EXP 6480464 Berberine inhibits the reaction [Glucose results in decreased expression of ATG3 protein] CTD PMID:39127087 Atg3 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ATG3 mRNA CTD PMID:25181051 Atg3 Rat bisphenol A decreases expression ISO RGD:1353416 6480464 bisphenol A results in decreased expression of ATG3 protein CTD PMID:31675489 Atg3 Rat bisphenol A decreases expression ISO RGD:1557224 6480464 bisphenol A results in decreased expression of ATG3 mRNA CTD PMID:33221593 Atg3 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of ATG3 mRNA CTD PMID:27539358 Atg3 Rat bisphenol AF increases expression ISO RGD:1353416 6480464 bisphenol AF results in increased expression of ATG3 protein CTD PMID:34186270 Atg3 Rat Bisphenol B increases expression ISO RGD:1353416 6480464 bisphenol B results in increased expression of ATG3 protein CTD PMID:34186270 Atg3 Rat butyric acid increases expression ISO RGD:1353416 6480464 Butyric Acid results in increased expression of ATG3 protein CTD PMID:26784903 Atg3 Rat cadmium atom multiple interactions ISO RGD:1353416 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in more ... CTD PMID:38195004 Atg3 Rat cadmium dichloride multiple interactions ISO RGD:1353416 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in more ... CTD PMID:38195004 Atg3 Rat cadmium dichloride decreases expression ISO RGD:1353416 6480464 Cadmium Chloride results in decreased expression of ATG3 mRNA CTD PMID:38568856 Atg3 Rat cadmium sulfide increases expression ISO RGD:1353416 6480464 cadmium sulfide results in increased expression of ATG3 mRNA CTD PMID:27866839 Atg3 Rat cantharidin increases expression ISO RGD:1353416 6480464 Cantharidin results in increased expression of ATG3 protein CTD PMID:35398186 Atg3 Rat cantharidin increases expression EXP 6480464 Cantharidin results in increased expression of ATG3 protein CTD PMID:35398186 Atg3 Rat cantharidin multiple interactions ISO RGD:1353416 6480464 4-phenylbutyric acid inhibits the reaction [Cantharidin results in increased expression of ATG3 protein] CTD PMID:35398186 Atg3 Rat captan increases expression ISO RGD:1557224 6480464 Captan results in increased expression of ATG3 mRNA CTD PMID:31558096 Atg3 Rat carbon nanotube increases expression ISO RGD:1557224 6480464 Nanotubes, Carbon analog results in increased expression of ATG3 mRNA; Nanotubes, Carbon results in increased more ... CTD PMID:25554681 Atg3 Rat choline multiple interactions ISO RGD:1557224 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression more ... CTD PMID:20938992 Atg3 Rat cisplatin increases expression ISO RGD:1353416 6480464 Cisplatin results in increased expression of ATG3 protein CTD PMID:24817946 Atg3 Rat cisplatin multiple interactions ISO RGD:1353416 6480464 [Cisplatin results in decreased susceptibility to Cisplatin] which results in increased expression of ATG3 mRNA CTD PMID:30871063 Atg3 Rat cisplatin decreases expression ISO RGD:1353416 6480464 Cisplatin results in decreased expression of ATG3 mRNA CTD PMID:20849824 Atg3 Rat copper atom multiple interactions ISO RGD:1557224 6480464 [Copper Sulfate results in increased abundance of Copper] which results in increased expression of ATG3 more ... CTD PMID:31491480 Atg3 Rat copper(0) multiple interactions ISO RGD:1557224 6480464 [Copper Sulfate results in increased abundance of Copper] which results in increased expression of ATG3 more ... CTD PMID:31491480 Atg3 Rat copper(II) sulfate multiple interactions ISO RGD:1557224 6480464 [Copper Sulfate results in increased abundance of Copper] which results in increased expression of ATG3 more ... CTD PMID:31491480 Atg3 Rat crocidolite asbestos increases expression ISO RGD:1557224 6480464 Asbestos, Crocidolite results in increased expression of ATG3 mRNA CTD PMID:19446018 Atg3 Rat cyclophosphamide decreases expression ISO RGD:1353416 6480464 Cyclophosphamide results in decreased expression of ATG3 mRNA CTD PMID:20849824 Atg3 Rat cyclosporin A increases expression ISO RGD:1353416 6480464 Cyclosporine results in increased expression of ATG3 mRNA CTD PMID:20106945|PMID:25562108 Atg3 Rat cypermethrin increases expression ISO RGD:1353416 6480464 cypermethrin results in increased expression of ATG3 mRNA CTD PMID:27704156 Atg3 Rat D-glucose increases expression EXP 6480464 Glucose results in increased expression of ATG3 mRNA CTD PMID:38444079 Atg3 Rat D-glucose decreases expression EXP 6480464 Glucose results in decreased expression of ATG3 protein CTD PMID:39127087 Atg3 Rat D-glucose multiple interactions EXP 6480464 Berberine inhibits the reaction [Glucose results in decreased expression of ATG3 protein] CTD PMID:39127087 Atg3 Rat decabromodiphenyl ether decreases expression ISO RGD:1353416 6480464 decabromobiphenyl ether results in decreased expression of ATG3 protein CTD PMID:31675489 Atg3 Rat deguelin increases expression ISO RGD:1353416 6480464 deguelin results in increased expression of ATG3 mRNA CTD PMID:33512557 Atg3 Rat diarsenic trioxide increases expression ISO RGD:1557224 6480464 Arsenic Trioxide results in increased expression of ATG3 mRNA CTD PMID:31846860|PMID:32112876|PMID:32781346 Atg3 Rat Dibutyl phosphate affects expression ISO RGD:1353416 6480464 di-n-butylphosphoric acid affects the expression of ATG3 mRNA CTD PMID:37042841 Atg3 Rat dibutyl phthalate increases expression ISO RGD:1557224 6480464 Dibutyl Phthalate results in increased expression of ATG3 mRNA CTD PMID:21266533 Atg3 Rat dorsomorphin multiple interactions ISO RGD:1353416 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Atg3 Rat enniatin decreases expression EXP 6480464 enniatins results in decreased expression of ATG3 mRNA CTD PMID:27163883 Atg3 Rat enzyme inhibitor multiple interactions ISO RGD:1353416 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation more ... CTD PMID:23301498 Atg3 Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of ATG3 mRNA CTD PMID:17920746 Atg3 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of ATG3 mRNA CTD PMID:24136188 Atg3 Rat fingolimod hydrochloride increases expression ISO RGD:1353416 6480464 Fingolimod Hydrochloride results in increased expression of ATG3 protein CTD PMID:25939952 Atg3 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of ATG3 mRNA CTD PMID:24136188 Atg3 Rat flutamide increases expression ISO RGD:1557224 6480464 Flutamide results in increased expression of ATG3 mRNA CTD PMID:32662666 Atg3 Rat folic acid multiple interactions ISO RGD:1557224 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of ATG3 mRNA; [Methionine deficiency co-treated more ... CTD PMID:20938992|PMID:22206623 Atg3 Rat folic acid decreases expression ISO RGD:1557224 6480464 Folic Acid results in decreased expression of ATG3 mRNA CTD PMID:25629700 Atg3 Rat folpet increases expression ISO RGD:1557224 6480464 folpet results in increased expression of ATG3 mRNA CTD PMID:31558096 Atg3 Rat furan increases methylation EXP 6480464 furan results in increased methylation of ATG3 gene CTD PMID:22079235 Atg3 Rat galangin multiple interactions ISO RGD:1353416 6480464 [ATG3 mutant form co-treated with galangin] results in decreased activity of CASP3 protein; LY2109761 inhibits more ... CTD PMID:25268046 Atg3 Rat galangin increases expression ISO RGD:1353416 6480464 galangin results in increased expression of ATG3 mRNA; galangin results in increased expression of ATG3 more ... CTD PMID:25268046 Atg3 Rat gentamycin decreases expression ISO RGD:1353416 6480464 Gentamicins results in decreased expression of ATG3 mRNA CTD PMID:20849824 Atg3 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of ATG3 mRNA CTD PMID:33387578 Atg3 Rat glucose increases expression EXP 6480464 Glucose results in increased expression of ATG3 mRNA CTD PMID:38444079 Atg3 Rat glucose multiple interactions EXP 6480464 Berberine inhibits the reaction [Glucose results in decreased expression of ATG3 protein] CTD PMID:39127087 Atg3 Rat glucose decreases expression EXP 6480464 Glucose results in decreased expression of ATG3 protein CTD PMID:39127087 Atg3 Rat glyphosate increases expression ISO RGD:1353416 6480464 Glyphosate results in increased expression of ATG3 mRNA CTD PMID:31874349 Atg3 Rat ivermectin decreases expression ISO RGD:1353416 6480464 Ivermectin results in decreased expression of ATG3 protein CTD PMID:32959892 Atg3 Rat L-methionine multiple interactions ISO RGD:1557224 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression more ... CTD PMID:20938992 Atg3 Rat lycopene multiple interactions ISO RGD:1557224 6480464 Lycopene inhibits the reaction [Atrazine results in decreased expression of ATG3 mRNA] CTD PMID:30360616 Atg3 Rat methidathion increases expression ISO RGD:1557224 6480464 methidathion results in increased expression of ATG3 mRNA CTD PMID:34813904 Atg3 Rat nickel atom increases expression ISO RGD:1353416 6480464 Nickel results in increased expression of ATG3 mRNA CTD PMID:25583101 Atg3 Rat oligopeptide increases expression ISO RGD:1353416 6480464 Oligopeptides analog results in increased expression of ATG3 protein CTD PMID:24875536 Atg3 Rat paracetamol affects expression ISO RGD:1557224 6480464 Acetaminophen affects the expression of ATG3 mRNA CTD PMID:17562736 Atg3 Rat perfluorobutyric acid increases expression ISO RGD:1353416 6480464 perfluorobutyric acid results in increased expression of ATG3 mRNA CTD PMID:37806615 Atg3 Rat perfluorooctanoic acid increases expression ISO RGD:1557224 6480464 perfluorooctanoic acid results in increased expression of ATG3 mRNA CTD PMID:26879310 Atg3 Rat perfluorooctanoic acid increases expression ISO RGD:1353416 6480464 perfluorooctanoic acid results in increased expression of ATG3 mRNA CTD PMID:37806615 Atg3 Rat phenobarbital multiple interactions EXP 6480464 Phenobarbital inhibits the reaction [Dietary Fats results in increased expression of ATG3 mRNA] CTD PMID:36657701 Atg3 Rat platycodin D increases expression ISO RGD:1353416 6480464 platycodin D results in increased expression of ATG3 protein CTD PMID:26078792 Atg3 Rat quercetin decreases expression ISO RGD:1353416 6480464 Quercetin results in decreased expression of ATG3 mRNA CTD PMID:21632981 Atg3 Rat resveratrol decreases expression ISO RGD:1353416 6480464 resveratrol results in decreased expression of ATG3 mRNA CTD PMID:23750556 Atg3 Rat resveratrol increases expression ISO RGD:1353416 6480464 resveratrol results in increased expression of ATG3 mRNA CTD PMID:23750556 Atg3 Rat rotenone increases expression ISO RGD:1353416 6480464 Rotenone results in increased expression of ATG3 mRNA CTD PMID:33512557 Atg3 Rat SB 431542 multiple interactions ISO RGD:1353416 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Atg3 Rat sodium arsenite multiple interactions ISO RGD:1557224 6480464 [sodium arsenite co-treated with Dietary Fats] results in increased expression of ATG3 mRNA CTD PMID:30097599 Atg3 Rat sodium arsenite multiple interactions ISO RGD:1353416 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of ATG3 more ... CTD PMID:39836092 Atg3 Rat sodium arsenite decreases expression ISO RGD:1557224 6480464 sodium arsenite results in decreased expression of ATG3 mRNA CTD PMID:30097599 Atg3 Rat sodium dichromate increases expression ISO RGD:1557224 6480464 sodium bichromate results in increased expression of ATG3 mRNA CTD PMID:31558096 Atg3 Rat sulindac increases expression EXP 6480464 Sulindac results in increased expression of ATG3 mRNA CTD PMID:24136188 Atg3 Rat syringic acid increases expression ISO RGD:1353416 6480464 syringic acid results in increased expression of ATG3 protein CTD PMID:33548266 Atg3 Rat T-2 toxin increases expression EXP 6480464 T-2 Toxin results in increased expression of ATG3 protein CTD PMID:29870751 Atg3 Rat T-2 toxin multiple interactions ISO RGD:1557224 6480464 ATG3 protein affects the reaction [T-2 Toxin results in increased expression of TNF mRNA]; ATG3 more ... CTD PMID:32240701 Atg3 Rat T-2 toxin increases expression ISO RGD:1557224 6480464 T-2 Toxin results in increased expression of ATG3 mRNA; T-2 Toxin results in increased expression more ... CTD PMID:32240701 Atg3 Rat theophylline increases expression ISO RGD:1353416 6480464 Theophylline results in increased expression of ATG3 mRNA CTD PMID:18951874 Atg3 Rat titanium dioxide decreases methylation ISO RGD:1557224 6480464 titanium dioxide results in decreased methylation of ATG3 gene CTD PMID:35295148 Atg3 Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of ATG3 gene CTD PMID:27618143 Atg3 Rat triphenyl phosphate affects expression ISO RGD:1353416 6480464 triphenyl phosphate affects the expression of ATG3 mRNA CTD PMID:37042841 Atg3 Rat trovafloxacin increases expression ISO RGD:1353416 6480464 trovafloxacin results in increased expression of ATG3 mRNA CTD PMID:33609687 Atg3 Rat trovafloxacin multiple interactions ISO RGD:1353416 6480464 [trovafloxacin co-treated with TNF protein] results in increased expression of ATG3 mRNA CTD PMID:33609687 Atg3 Rat valproic acid affects expression ISO RGD:1353416 6480464 Valproic Acid affects the expression of ATG3 mRNA CTD PMID:25979313 Atg3 Rat valproic acid increases expression ISO RGD:1353416 6480464 Valproic Acid results in increased expression of ATG3 mRNA CTD PMID:23179753|PMID:26272509|PMID:28001369|PMID:29154799 Atg3 Rat valproic acid multiple interactions ISO RGD:1353416 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
Atg3 Rat Atg12 transferase activity enables ISS UniProtKB:Q9CPX6 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Atg3 Rat Atg12 transferase activity enables ISO RGD:1557224 1624291 PMID:20723759 RGD PMID:20723759 Atg3 Rat Atg12 transferase activity enables IEA UniProtKB:Q9CPX6|ensembl:ENSMUSP00000023343 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Atg3 Rat Atg8-family conjugating enzyme activity enables IEA UniProtKB:Q9NT62|ensembl:ENSP00000283290 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Atg3 Rat Atg8-family conjugating enzyme activity enables ISO RGD:1353416 1624291 PMID:12207896, PMID:24186333, PMID:24191030, PMID:33446636, PMID:37252361 RGD PMID:12207896|PMID:24186333|PMID:24191030|PMID:33446636|PMID:37252361 Atg3 Rat Atg8-family conjugating enzyme activity enables IMP 401901225 PMID:24747438 UniProt Atg3 Rat Atg8-family conjugating enzyme activity enables IBA PANTHER:PTN000305308|RGD:708464|UniProtKB:Q9NT62 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Atg3 Rat Atg8-family conjugating enzyme activity enables ISS UniProtKB:Q9NT62 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Atg3 Rat Atg8-family ligase activity enables ISS UniProtKB:Q9CPX6 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Atg3 Rat Atg8-family ligase activity enables ISO RGD:1557224 1624291 PMID:20723759 RGD PMID:20723759 Atg3 Rat Atg8-family ligase activity enables IEA UniProtKB:Q9CPX6|ensembl:ENSMUSP00000023343 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Atg3 Rat enzyme binding enables IEA UniProtKB:Q9NT62|ensembl:ENSP00000283290 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Atg3 Rat enzyme binding enables ISO RGD:1353416 1624291 UniProtKB:O95352 PMID:11825910 RGD PMID:11825910 Atg3 Rat protein binding enables ISO RGD:1353416 1624291 UniProtKB:O94817|UniProtKB:O95166|UniProtKB:O95352|UniProtKB:P60520|UniProtKB:P62879|UniProtKB:Q676U5|UniProtKB:Q70IA6|UniProtKB:Q7Z6L1|UniProtKB:Q9GZQ8|UniProtKB:Q9H0R8|UniProtKB:Q9H1Y0|UniProtKB:Q9H492 PMID:11825910, PMID:12890687, PMID:15355958, PMID:16303767, PMID:18083104, PMID:20562859, PMID:23202584, PMID:24186333, PMID:24191030, PMID:26043688, PMID:32296183, PMID:32814053, PMID:33961781, more ... RGD PMID:11825910|PMID:12890687|PMID:15355958|PMID:16303767|PMID:18083104|PMID:20562859|PMID:23202584|PMID:24186333|PMID:24191030|PMID:26043688|PMID:32296183|PMID:32814053|PMID:33961781|PMID:35271311|PMID:37252361 Atg3 Rat protein binding enables ISO RGD:1557224 1624291 UniProtKB:Q9CQY1 PMID:18321988, PMID:20723759, PMID:25686249 RGD PMID:18321988|PMID:20723759|PMID:25686249 Atg3 Rat transferase activity enables IEA UniProtKB-KW:KW-0808 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Atg3 Rat ubiquitin-like protein transferase activity enables ISO RGD:1353416 1624291 PMID:11825910 RGD PMID:11825910 Atg3 Rat ubiquitin-like protein transferase activity enables IEA UniProtKB:Q9NT62|ensembl:ENSP00000283290 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Atg3 Rat ubiquitin-like protein transferase activity enables IEA InterPro:IPR007135 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Atg3 Rat ubiquitin-like protein transferase activity enables IEA ARBA:ARBA00027363 1600115 GO_REF:0000117 UniProt GO_REF:0000117
Imported Annotations - KEGG (archival)
1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4,6-tribromophenol (ISO) 2-bromohexadecanoic acid (ISO) 2-deoxy-D-glucose (ISO) 3,3',5,5'-tetrabromobisphenol A (EXP,ISO) 4,4'-sulfonyldiphenol (ISO) 4-nonylphenol (EXP) 4-phenylbutyric acid (ISO) acrylamide (ISO) aldehydo-D-glucose (EXP) all-trans-retinoic acid (ISO) ammonium chloride (EXP) amphotericin B (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) artesunate (ISO) atrazine (ISO) benzo[a]pyrene (ISO) berberine (EXP) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) butyric acid (ISO) cadmium atom (ISO) cadmium dichloride (ISO) cadmium sulfide (ISO) cantharidin (EXP,ISO) captan (ISO) carbon nanotube (ISO) choline (ISO) cisplatin (ISO) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) crocidolite asbestos (ISO) cyclophosphamide (ISO) cyclosporin A (ISO) cypermethrin (ISO) D-glucose (EXP) decabromodiphenyl ether (ISO) deguelin (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) dorsomorphin (ISO) enniatin (EXP) enzyme inhibitor (ISO) ethanol (EXP) finasteride (EXP) fingolimod hydrochloride (ISO) flutamide (EXP,ISO) folic acid (ISO) folpet (ISO) furan (EXP) galangin (ISO) gentamycin (EXP,ISO) glucose (EXP) glyphosate (ISO) ivermectin (ISO) L-methionine (ISO) lycopene (ISO) methidathion (ISO) nickel atom (ISO) oligopeptide (ISO) paracetamol (ISO) perfluorobutyric acid (ISO) perfluorooctanoic acid (ISO) phenobarbital (EXP) platycodin D (ISO) quercetin (ISO) resveratrol (ISO) rotenone (ISO) SB 431542 (ISO) sodium arsenite (ISO) sodium dichromate (ISO) sulindac (EXP) syringic acid (ISO) T-2 toxin (EXP,ISO) theophylline (ISO) titanium dioxide (ISO) trichloroethene (EXP) triphenyl phosphate (ISO) trovafloxacin (ISO) valproic acid (ISO)
Biological Process
autophagosome assembly (IBA,IEA,ISO,ISS) autophagy (IEA,IEP,ISO,ISS) autophagy of mitochondrion (IBA) glycophagy (IBA) macroautophagy (IEA,ISO) mitochondrial fragmentation involved in apoptotic process (IEA,ISO,ISS) negative regulation of phagocytosis (IEA,ISO) nucleophagy (IBA) protein transport (IEA) protein ubiquitination (IEA,ISO) regulation of cilium assembly (IEA,ISO)
Molecular Function
Atg12 transferase activity (IEA,ISO,ISS) Atg8-family conjugating enzyme activity (IBA,IEA,IMP,ISO,ISS) Atg8-family ligase activity (IEA,ISO,ISS) enzyme binding (IEA,ISO) protein binding (ISO) transferase activity (IEA) ubiquitin-like protein transferase activity (IEA,ISO)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
3.
Hydrogen sulfide alleviates myocardial fibrosis in mice with alcoholic cardiomyopathy by downregulating autophagy.
Liang B, etal., Int J Mol Med. 2017 Dec;40(6):1781-1791. doi: 10.3892/ijmm.2017.3191. Epub 2017 Oct 16.
4.
Lipidation of the LC3/GABARAP family of autophagy proteins relies on a membrane-curvature-sensing domain in Atg3.
Nath S, etal., Nat Cell Biol. 2014 May;16(5):415-24. doi: 10.1038/ncb2940. Epub 2014 Apr 20.
5.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
6.
GOA pipeline
RGD automated data pipeline
7.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
8.
Comprehensive gene review and curation
RGD comprehensive gene curation
9.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
10.
LC3 conjugation system in mammalian autophagy.
Tanida I, etal., Int J Biochem Cell Biol. 2004 Dec;36(12):2503-18.
11.
Human Apg3p/Aut1p homologue is an authentic E2 enzyme for multiple substrates, GATE-16, GABARAP, and MAP-LC3, and facilitates the conjugation of hApg12p to hApg5p.
Tanida I, etal., J Biol Chem 2002 Apr 19;277(16):13739-44. Epub 2002 Feb 1.
12.
The rat Apg3p/Aut1p homolog is upregulated by ischemic preconditioning in the retina.
Wu BX, etal., Mol Vis. 2006 Oct 26;12:1292-302.
13.
Mammalian autophagy: core molecular machinery and signaling regulation.
Yang Z and Klionsky DJ, Curr Opin Cell Biol. 2010 Apr;22(2):124-31. Epub 2009 Dec 23.
14.
The protective effect of puerarin-loaded mesoporous silicon nanoparticles on alcoholic hepatitis through mTOR-mediated autophagy pathway.
Zhang XX, etal., Biomed Microdevices. 2022 Oct 29;24(4):37. doi: 10.1007/s10544-022-00622-2.
Atg3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 11 69,130,948 - 69,159,280 (-) NCBI GRCr8 mRatBN7.2 11 55,624,914 - 55,653,249 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 11 55,624,917 - 55,653,224 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 11 64,438,596 - 64,466,930 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 11 57,100,453 - 57,128,787 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 11 56,170,970 - 56,199,226 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 11 60,585,192 - 60,613,706 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 11 60,585,171 - 60,613,718 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 11 64,687,322 - 64,715,836 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 11 57,162,205 - 57,190,568 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 11 57,219,793 - 57,248,157 (-) NCBI Celera 11 55,191,074 - 55,219,238 (-) NCBI Celera Cytogenetic Map 11 q21 NCBI
ATG3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 112,532,510 - 112,561,962 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 112,532,510 - 112,562,046 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 112,251,357 - 112,280,809 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 113,734,049 - 113,763,175 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 113,734,049 - 113,763,175 NCBI Celera 3 110,660,041 - 110,689,158 (-) NCBI Celera Cytogenetic Map 3 q13.2 NCBI HuRef 3 109,635,431 - 109,664,875 (-) NCBI HuRef CHM1_1 3 112,215,286 - 112,244,741 (-) NCBI CHM1_1 T2T-CHM13v2.0 3 115,253,546 - 115,282,997 (-) NCBI T2T-CHM13v2.0
Atg3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 16 44,979,192 - 45,008,901 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 16 44,979,148 - 45,008,901 (+) Ensembl GRCm39 Ensembl GRCm38 16 45,158,829 - 45,188,538 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 16 45,158,785 - 45,188,538 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 16 45,158,942 - 45,188,651 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 16 45,078,161 - 45,107,870 (+) NCBI MGSCv36 mm8 Celera 16 45,552,434 - 45,582,081 (+) NCBI Celera Cytogenetic Map 16 B5 NCBI cM Map 16 29.45 NCBI
Atg3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955427 12,881,454 - 12,906,399 (-) NCBI ChiLan1.0 ChiLan1.0
ATG3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 110,535,875 - 110,564,655 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 110,539,768 - 110,569,070 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 109,681,163 - 109,710,835 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 116,606,467 - 116,635,209 (-) NCBI panpan1.1 PanPan1.1 panPan2
ATG3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 33 17,046,951 - 17,073,203 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 33 17,046,973 - 17,073,150 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 33 17,150,094 - 17,176,355 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 33 17,290,643 - 17,316,985 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 33 17,290,665 - 17,316,925 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 33 17,095,504 - 17,121,791 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 33 17,142,968 - 17,169,265 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 33 17,692,507 - 17,718,820 (-) NCBI UU_Cfam_GSD_1.0
Atg3
ATG3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 147,279,437 - 147,309,590 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 147,279,110 - 147,309,597 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 156,876,859 - 156,907,063 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ATG3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 22 68,227,772 - 68,256,555 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 22 68,228,203 - 68,257,503 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666041 98,205,946 - 98,234,553 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Atg3
.
Predicted Target Of
Count of predictions: 26 Count of miRNA genes: 24 Interacting mature miRNAs: 26 Transcripts: ENSRNOT00000002906 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1300147 Bp187 Blood pressure QTL 187 3.67 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 11 1 69446234 Rat 724554 Iddm17 Insulin dependent diabetes mellitus QTL 17 0.001 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 11 18976208 86241447 Rat 70180 BpQTLcluster10 Blood pressure QTL cluster 10 3.19 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 11 34918041 79918041 Rat 1581565 Pur10 Proteinuria QTL 10 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 11 44803318 82846466 Rat 4889859 Pur28 Proteinuria QTL 28 19.5 0.001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 11 45459323 75190161 Rat 8694376 Bw156 Body weight QTL 156 2.25 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 11 23280456 68280456 Rat 10755497 Bp388 Blood pressure QTL 388 2.76 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 11 19456205 76331918 Rat 10058952 Gmadr6 Adrenal mass QTL 6 2.29 0.0072 adrenal gland mass (VT:0010420) both adrenal glands wet weight to body weight ratio (CMO:0002411) 11 22959403 67959403 Rat 1300130 Rf20 Renal function QTL 20 4.44 kidney glomerulus integrity trait (VT:0010546) kidney glomerulus diameter (CMO:0001166) 11 29528418 60324829 Rat 1558659 Tescar1 Testicular tumor resistance QTL 1 3.9 testis integrity trait (VT:0010572) percentage of study population developing testis tumors during a period of time (CMO:0001261) 11 1041931 66113562 Rat 2298551 Neuinf10 Neuroinflammation QTL 10 3.7 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 11 31239134 78851519 Rat 1300135 Rf19 Renal function QTL 19 3.38 blood creatinine amount (VT:0005328) creatinine clearance (CMO:0000765) 11 40946188 82566702 Rat 2312566 Glom20 Glomerulus QTL 20 3.6 0.001 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 11 44285759 82566702 Rat 724563 Uae10 Urinary albumin excretion QTL 10 6 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 11 27672410 82846715 Rat 9589032 Epfw10 Epididymal fat weight QTL 10 9.29 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 11 23280456 68280456 Rat 724561 Plsm4 Polydactyly-luxate syndrome (PLS) morphotypes QTL 4 0.0003 forelimb integrity trait (VT:0010562) front foot phalanges count (CMO:0001947) 11 54457534 86241447 Rat 9590313 Scort20 Serum corticosterone level QTL 20 6.51 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 11 23280456 68280456 Rat 4889521 Gluco62 Glucose level QTL 62 2.82 0.001 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 11 55136729 82993457 Rat 8694424 Bw162 Body weight QTL 162 3.8 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 11 23280456 68280456 Rat 1581572 Uae35 Urinary albumin excretion QTL 35 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 11 44803318 82846466 Rat 1300110 Stl7 Serum triglyceride level QTL 7 4.64 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 11 29528418 82566702 Rat
WI-22015
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 11 55,625,023 - 55,625,154 (+) MAPPER mRatBN7.2 Rnor_6.0 11 60,585,281 - 60,585,411 NCBI Rnor6.0 Rnor_5.0 11 64,687,411 - 64,687,541 UniSTS Rnor5.0 RGSC_v3.4 11 57,162,294 - 57,162,424 UniSTS RGSC3.4 Celera 11 55,191,163 - 55,191,293 UniSTS Cytogenetic Map 11 q21 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000002906 ⟹ ENSRNOP00000002906
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 55,624,935 - 55,653,224 (-) Ensembl Rnor_6.0 Ensembl 11 60,585,185 - 60,613,718 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000093292
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 55,624,917 - 55,653,054 (-) Ensembl Rnor_6.0 Ensembl 11 60,585,171 - 60,586,048 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000093379
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 11 60,594,412 - 60,597,961 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000094798 ⟹ ENSRNOP00000084764
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 55,624,935 - 55,652,930 (-) Ensembl
RefSeq Acc Id:
NM_134394 ⟹ NP_599221
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 69,130,948 - 69,159,280 (-) NCBI mRatBN7.2 11 55,624,914 - 55,653,249 (-) NCBI Rnor_6.0 11 60,585,192 - 60,613,706 (-) NCBI Rnor_5.0 11 64,687,322 - 64,715,836 (-) NCBI RGSC_v3.4 11 57,162,205 - 57,190,568 (-) RGD Celera 11 55,191,074 - 55,219,238 (-) RGD
Sequence:
GGGAAGCCGGAAGGGGTTCAAGTGGAGCTTGGGGGACGAAAGACAGCTTCGAGAAGGCCGGGGGCTGCGCGCGCACCCGTCTCTCGCTCAGCCGGCTGGGCCTCTGCTGTCGCGGCCAGGTGACAGCT
hide sequence
RefSeq Acc Id:
XM_039087948 ⟹ XP_038943876
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 69,130,982 - 69,158,923 (-) NCBI mRatBN7.2 11 55,624,928 - 55,652,943 (-) NCBI
RefSeq Acc Id:
XM_063270263 ⟹ XP_063126333
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 69,130,982 - 69,143,332 (-) NCBI
RefSeq Acc Id:
NP_599221 ⟸ NM_134394
- UniProtKB:
Q6AZ50 (UniProtKB/Swiss-Prot), Q9ESH2 (UniProtKB/Swiss-Prot), A6IQZ2 (UniProtKB/TrEMBL), A0A8I6GAZ4 (UniProtKB/TrEMBL)
- Sequence:
MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITL
hide sequence
Ensembl Acc Id:
ENSRNOP00000002906 ⟸ ENSRNOT00000002906
RefSeq Acc Id:
XP_038943876 ⟸ XM_039087948
- Peptide Label:
isoform X1
Ensembl Acc Id:
ENSRNOP00000084764 ⟸ ENSRNOT00000094798
RefSeq Acc Id:
XP_063126333 ⟸ XM_063270263
- Peptide Label:
isoform X2
- UniProtKB:
A6IQZ3 (UniProtKB/TrEMBL)
RGD ID: 13698141 Promoter ID: EPDNEW_R8665 Type: initiation region Name: Atg3_1 Description: autophagy related 3 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R8666 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 11 60,613,460 - 60,613,520 EPDNEW
RGD ID: 13698142 Promoter ID: EPDNEW_R8666 Type: initiation region Name: Atg3_2 Description: autophagy related 3 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R8665 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 11 60,613,687 - 60,613,747 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2012-06-07
Atg3
autophagy related 3
Atg3
ATG3 autophagy related 3 homolog (S. cerevisiae)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-09-25
Atg3
ATG3 autophagy related 3 homolog (S. cerevisiae)
Atg3
autophagy-related 3 (yeast)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2007-12-21
Atg3
autophagy-related 3 (yeast)
Apg3l
APG3 autophagy 3-like (S. cerevisiae)
Symbol and Name updated to reflect Human and Mouse nomenclature
1299863 APPROVED
2004-09-10
Apg3l
APG3 autophagy 3-like (S. cerevisiae)
Pig1
preconditioning-inducible gene 1 protein
Symbol and Name updated
1299863 APPROVED
