Symbol:
ATG3
Name:
autophagy related 3
RGD ID:
1353416
HGNC Page
HGNC:20962
Description:
Enables Atg8-family conjugating enzyme activity and enzyme binding activity. Involved in autophagosome assembly and protein ubiquitination. Located in cytosol. Part of Atg12-Atg5-Atg16 complex. Is active in cytoplasm.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
2610016C12Rik; APG3; APG3 autophagy 3-like; apg3 autophagy 3-like (s. cerevisiae); APG3-LIKE; APG3L; ATG3 autophagy related 3 homolog; autophagy Apg3p/Aut1p-like; autophagy-related protein 3; DKFZp564M1178; FLJ22125; hApg3; MGC15201; PC3-96; ubiquitin-like-conjugating enzyme ATG3
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Atg3 (autophagy related 3) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Atg3 (autophagy related 3) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Chinchilla lanigera (long-tailed chinchilla):
Atg3 (autophagy related 3) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
ATG3 (autophagy related 3) NCBI
Ortholog
Canis lupus familiaris (dog):
ATG3 (autophagy related 3) HGNC
EggNOG, HomoloGene, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Atg3 (autophagy related 3) NCBI
Ortholog
Sus scrofa (pig):
ATG3 (autophagy related 3) HGNC
EggNOG, Ensembl, NCBI, OMA, OrthoDB, Panther, Treefam
Chlorocebus sabaeus (green monkey):
ATG3 (autophagy related 3) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Atg3 (autophagy related 3) NCBI
Ortholog
Other homologs 2
Rattus norvegicus (Norway rat):
Aipl1 (aryl hydrocarbon receptor-interacting protein-like 1) HGNC
OMA
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Atg3 (autophagy related 3)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Atg3 (autophagy related 3)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
atg3 (autophagy related 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Saccharomyces cerevisiae (baker's yeast):
ATG3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Atg3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
atg-3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus laevis (African clawed frog):
atg3.L
Alliance
DIOPT (Xenbase)
Xenopus tropicalis (tropical clawed frog):
atg3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus laevis (African clawed frog):
atg3.S
Alliance
DIOPT (Xenbase)
Related Pseudogenes:
ATG3P1
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 112,532,510 - 112,561,962 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 112,532,510 - 112,562,046 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 112,251,357 - 112,280,809 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 113,734,049 - 113,763,175 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 113,734,049 - 113,763,175 NCBI Celera 3 110,660,041 - 110,689,158 (-) NCBI Celera Cytogenetic Map 3 q13.2 NCBI HuRef 3 109,635,431 - 109,664,875 (-) NCBI HuRef CHM1_1 3 112,215,286 - 112,244,741 (-) NCBI CHM1_1 T2T-CHM13v2.0 3 115,253,546 - 115,282,997 (-) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
ATG3 Human 1,2-dimethylhydrazine multiple interactions ISO RGD:1557224 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of ATG3 mRNA CTD PMID:22206623 ATG3 Human 17beta-estradiol decreases expression ISO RGD:1557224 6480464 Estradiol results in decreased expression of ATG3 mRNA CTD PMID:39298647 ATG3 Human 2,2',4,4'-Tetrabromodiphenyl ether decreases expression EXP 6480464 2,2',4,4'-tetrabromodiphenyl ether results in decreased expression of ATG3 protein CTD PMID:31675489 ATG3 Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1557224 6480464 Tetrachlorodibenzodioxin affects the expression of ATG3 mRNA CTD PMID:21570461 ATG3 Human 2,4,6-tribromophenol decreases expression EXP 6480464 2,4,6-tribromophenol results in decreased expression of ATG3 mRNA CTD PMID:31675489 ATG3 Human 2-bromohexadecanoic acid multiple interactions EXP 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in more ... CTD PMID:38195004 ATG3 Human 2-deoxy-D-glucose multiple interactions EXP 6480464 Deoxyglucose affects the reaction [demycarosyl-3D-digitoxosylmithramycin SK affects the expression of ATG3 mRNA] CTD PMID:26079942 ATG3 Human 3,3',5,5'-tetrabromobisphenol A decreases expression ISO RGD:708464 6480464 tetrabromobisphenol A results in decreased expression of ATG3 mRNA CTD PMID:28970181 ATG3 Human 3,3',5,5'-tetrabromobisphenol A decreases expression EXP 6480464 tetrabromobisphenol A results in decreased expression of ATG3 protein CTD PMID:31675489 ATG3 Human 4,4'-sulfonyldiphenol decreases expression ISO RGD:1557224 6480464 bisphenol S results in decreased expression of ATG3 mRNA CTD PMID:29741722 ATG3 Human 4,4'-sulfonyldiphenol increases expression EXP 6480464 bisphenol S results in increased expression of ATG3 protein CTD PMID:34186270 ATG3 Human 4-nonylphenol increases expression ISO RGD:708464 6480464 4-nonylphenol results in increased expression of ATG3 mRNA CTD PMID:28041982 ATG3 Human 4-phenylbutyric acid multiple interactions EXP 6480464 4-phenylbutyric acid inhibits the reaction [Cantharidin results in increased expression of ATG3 protein] CTD PMID:35398186 ATG3 Human acrylamide increases expression ISO RGD:1557224 6480464 Acrylamide results in increased expression of ATG3 mRNA CTD PMID:34569336 ATG3 Human aldehydo-D-glucose increases expression ISO RGD:708464 6480464 Glucose results in increased expression of ATG3 mRNA CTD PMID:38444079 ATG3 Human aldehydo-D-glucose decreases expression ISO RGD:708464 6480464 Glucose results in decreased expression of ATG3 protein CTD PMID:39127087 ATG3 Human aldehydo-D-glucose multiple interactions ISO RGD:708464 6480464 Berberine inhibits the reaction [Glucose results in decreased expression of ATG3 protein] CTD PMID:39127087 ATG3 Human all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of ATG3 mRNA CTD PMID:29743969 ATG3 Human all-trans-retinoic acid multiple interactions EXP 6480464 SPI1 protein affects the reaction [Tretinoin results in increased expression of ATG3 mRNA] CTD PMID:29743969 ATG3 Human ammonium chloride affects expression ISO RGD:708464 6480464 Ammonium Chloride affects the expression of ATG3 mRNA CTD PMID:16483693 ATG3 Human amphotericin B decreases expression EXP 6480464 Amphotericin B results in decreased expression of ATG3 mRNA CTD PMID:20849824 ATG3 Human arsane multiple interactions EXP 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of ATG3 more ... CTD PMID:39836092 ATG3 Human arsenic atom multiple interactions EXP 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of ATG3 more ... CTD PMID:39836092 ATG3 Human arsenite(3-) increases expression EXP 6480464 arsenite results in increased expression of ATG3 mRNA CTD PMID:34929507 ATG3 Human arsenous acid increases expression ISO RGD:1557224 6480464 Arsenic Trioxide results in increased expression of ATG3 mRNA CTD PMID:31846860|PMID:32112876|PMID:32781346 ATG3 Human artesunate increases expression EXP 6480464 Artesunate results in increased expression of ATG3 mRNA CTD PMID:30551460 ATG3 Human atrazine multiple interactions ISO RGD:1557224 6480464 Lycopene inhibits the reaction [Atrazine results in decreased expression of ATG3 mRNA] CTD PMID:30360616 ATG3 Human atrazine decreases expression ISO RGD:1557224 6480464 Atrazine results in decreased expression of ATG3 mRNA CTD PMID:30360616 ATG3 Human benzo[a]pyrene increases expression ISO RGD:1557224 6480464 Benzo(a)pyrene results in increased expression of ATG3 mRNA CTD PMID:22228805 ATG3 Human berberine multiple interactions ISO RGD:708464 6480464 Berberine inhibits the reaction [Glucose results in decreased expression of ATG3 protein] CTD PMID:39127087 ATG3 Human bisphenol A increases expression ISO RGD:708464 6480464 bisphenol A results in increased expression of ATG3 mRNA CTD PMID:25181051 ATG3 Human bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ATG3 protein CTD PMID:31675489 ATG3 Human bisphenol A decreases expression ISO RGD:1557224 6480464 bisphenol A results in decreased expression of ATG3 mRNA CTD PMID:33221593 ATG3 Human bisphenol A affects expression ISO RGD:708464 6480464 bisphenol A affects the expression of ATG3 mRNA CTD PMID:27539358 ATG3 Human bisphenol AF increases expression EXP 6480464 bisphenol AF results in increased expression of ATG3 protein CTD PMID:34186270 ATG3 Human Bisphenol B increases expression EXP 6480464 bisphenol B results in increased expression of ATG3 protein CTD PMID:34186270 ATG3 Human butyric acid increases expression EXP 6480464 Butyric Acid results in increased expression of ATG3 protein CTD PMID:26784903 ATG3 Human cadmium atom multiple interactions EXP 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in more ... CTD PMID:38195004 ATG3 Human cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of ATG3 mRNA CTD PMID:38568856 ATG3 Human cadmium dichloride multiple interactions EXP 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in more ... CTD PMID:38195004 ATG3 Human cadmium sulfide increases expression EXP 6480464 cadmium sulfide results in increased expression of ATG3 mRNA CTD PMID:27866839 ATG3 Human cantharidin increases expression ISO RGD:708464 6480464 Cantharidin results in increased expression of ATG3 protein CTD PMID:35398186 ATG3 Human cantharidin multiple interactions EXP 6480464 4-phenylbutyric acid inhibits the reaction [Cantharidin results in increased expression of ATG3 protein] CTD PMID:35398186 ATG3 Human cantharidin increases expression EXP 6480464 Cantharidin results in increased expression of ATG3 protein CTD PMID:35398186 ATG3 Human captan increases expression ISO RGD:1557224 6480464 Captan results in increased expression of ATG3 mRNA CTD PMID:31558096 ATG3 Human carbon nanotube increases expression ISO RGD:1557224 6480464 Nanotubes, Carbon analog results in increased expression of ATG3 mRNA; Nanotubes, Carbon results in increased more ... CTD PMID:25554681 ATG3 Human choline multiple interactions ISO RGD:1557224 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression more ... CTD PMID:20938992 ATG3 Human cisplatin increases expression EXP 6480464 Cisplatin results in increased expression of ATG3 protein CTD PMID:24817946 ATG3 Human cisplatin multiple interactions EXP 6480464 [Cisplatin results in decreased susceptibility to Cisplatin] which results in increased expression of ATG3 mRNA CTD PMID:30871063 ATG3 Human cisplatin decreases expression EXP 6480464 Cisplatin results in decreased expression of ATG3 mRNA CTD PMID:20849824 ATG3 Human copper atom multiple interactions ISO RGD:1557224 6480464 [Copper Sulfate results in increased abundance of Copper] which results in increased expression of ATG3 more ... CTD PMID:31491480 ATG3 Human copper(0) multiple interactions ISO RGD:1557224 6480464 [Copper Sulfate results in increased abundance of Copper] which results in increased expression of ATG3 more ... CTD PMID:31491480 ATG3 Human copper(II) sulfate multiple interactions ISO RGD:1557224 6480464 [Copper Sulfate results in increased abundance of Copper] which results in increased expression of ATG3 more ... CTD PMID:31491480 ATG3 Human crocidolite asbestos increases expression ISO RGD:1557224 6480464 Asbestos, Crocidolite results in increased expression of ATG3 mRNA CTD PMID:19446018 ATG3 Human cyclophosphamide decreases expression EXP 6480464 Cyclophosphamide results in decreased expression of ATG3 mRNA CTD PMID:20849824 ATG3 Human cyclosporin A increases expression EXP 6480464 Cyclosporine results in increased expression of ATG3 mRNA CTD PMID:20106945|PMID:25562108 ATG3 Human cypermethrin increases expression EXP 6480464 cypermethrin results in increased expression of ATG3 mRNA CTD PMID:27704156 ATG3 Human D-glucose increases expression ISO RGD:708464 6480464 Glucose results in increased expression of ATG3 mRNA CTD PMID:38444079 ATG3 Human D-glucose decreases expression ISO RGD:708464 6480464 Glucose results in decreased expression of ATG3 protein CTD PMID:39127087 ATG3 Human D-glucose multiple interactions ISO RGD:708464 6480464 Berberine inhibits the reaction [Glucose results in decreased expression of ATG3 protein] CTD PMID:39127087 ATG3 Human decabromodiphenyl ether decreases expression EXP 6480464 decabromobiphenyl ether results in decreased expression of ATG3 protein CTD PMID:31675489 ATG3 Human deguelin increases expression EXP 6480464 deguelin results in increased expression of ATG3 mRNA CTD PMID:33512557 ATG3 Human diarsenic trioxide increases expression ISO RGD:1557224 6480464 Arsenic Trioxide results in increased expression of ATG3 mRNA CTD PMID:31846860|PMID:32112876|PMID:32781346 ATG3 Human Dibutyl phosphate affects expression EXP 6480464 di-n-butylphosphoric acid affects the expression of ATG3 mRNA CTD PMID:37042841 ATG3 Human dibutyl phthalate increases expression ISO RGD:1557224 6480464 Dibutyl Phthalate results in increased expression of ATG3 mRNA CTD PMID:21266533 ATG3 Human dorsomorphin multiple interactions EXP 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 ATG3 Human enniatin decreases expression ISO RGD:708464 6480464 enniatins results in decreased expression of ATG3 mRNA CTD PMID:27163883 ATG3 Human enzyme inhibitor multiple interactions EXP 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation more ... CTD PMID:23301498 ATG3 Human ethanol decreases expression ISO RGD:708464 6480464 Ethanol results in decreased expression of ATG3 mRNA CTD PMID:17920746 ATG3 Human finasteride increases expression ISO RGD:708464 6480464 Finasteride results in increased expression of ATG3 mRNA CTD PMID:24136188 ATG3 Human fingolimod hydrochloride increases expression EXP 6480464 Fingolimod Hydrochloride results in increased expression of ATG3 protein CTD PMID:25939952 ATG3 Human flutamide increases expression ISO RGD:708464 6480464 Flutamide results in increased expression of ATG3 mRNA CTD PMID:24136188 ATG3 Human flutamide increases expression ISO RGD:1557224 6480464 Flutamide results in increased expression of ATG3 mRNA CTD PMID:32662666 ATG3 Human folic acid multiple interactions ISO RGD:1557224 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of ATG3 mRNA; [Methionine deficiency co-treated more ... CTD PMID:20938992|PMID:22206623 ATG3 Human folic acid decreases expression ISO RGD:1557224 6480464 Folic Acid results in decreased expression of ATG3 mRNA CTD PMID:25629700 ATG3 Human folpet increases expression ISO RGD:1557224 6480464 folpet results in increased expression of ATG3 mRNA CTD PMID:31558096 ATG3 Human furan increases methylation ISO RGD:708464 6480464 furan results in increased methylation of ATG3 gene CTD PMID:22079235 ATG3 Human galangin increases expression EXP 6480464 galangin results in increased expression of ATG3 mRNA; galangin results in increased expression of ATG3 more ... CTD PMID:25268046 ATG3 Human galangin multiple interactions EXP 6480464 [ATG3 mutant form co-treated with galangin] results in decreased activity of CASP3 protein; LY2109761 inhibits more ... CTD PMID:25268046 ATG3 Human gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of ATG3 mRNA CTD PMID:20849824 ATG3 Human gentamycin increases expression ISO RGD:708464 6480464 Gentamicins results in increased expression of ATG3 mRNA CTD PMID:33387578 ATG3 Human glucose increases expression ISO RGD:708464 6480464 Glucose results in increased expression of ATG3 mRNA CTD PMID:38444079 ATG3 Human glucose multiple interactions ISO RGD:708464 6480464 Berberine inhibits the reaction [Glucose results in decreased expression of ATG3 protein] CTD PMID:39127087 ATG3 Human glucose decreases expression ISO RGD:708464 6480464 Glucose results in decreased expression of ATG3 protein CTD PMID:39127087 ATG3 Human glyphosate increases expression EXP 6480464 Glyphosate results in increased expression of ATG3 mRNA CTD PMID:31874349 ATG3 Human ivermectin decreases expression EXP 6480464 Ivermectin results in decreased expression of ATG3 protein CTD PMID:32959892 ATG3 Human L-methionine multiple interactions ISO RGD:1557224 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression more ... CTD PMID:20938992 ATG3 Human lycopene multiple interactions ISO RGD:1557224 6480464 Lycopene inhibits the reaction [Atrazine results in decreased expression of ATG3 mRNA] CTD PMID:30360616 ATG3 Human methidathion increases expression ISO RGD:1557224 6480464 methidathion results in increased expression of ATG3 mRNA CTD PMID:34813904 ATG3 Human nickel atom increases expression EXP 6480464 Nickel results in increased expression of ATG3 mRNA CTD PMID:25583101 ATG3 Human oligopeptide increases expression EXP 6480464 Oligopeptides analog results in increased expression of ATG3 protein CTD PMID:24875536 ATG3 Human paracetamol affects expression ISO RGD:1557224 6480464 Acetaminophen affects the expression of ATG3 mRNA CTD PMID:17562736 ATG3 Human perfluorobutyric acid increases expression EXP 6480464 perfluorobutyric acid results in increased expression of ATG3 mRNA CTD PMID:37806615 ATG3 Human perfluorooctanoic acid increases expression ISO RGD:1557224 6480464 perfluorooctanoic acid results in increased expression of ATG3 mRNA CTD PMID:26879310 ATG3 Human perfluorooctanoic acid increases expression EXP 6480464 perfluorooctanoic acid results in increased expression of ATG3 mRNA CTD PMID:37806615 ATG3 Human phenobarbital multiple interactions ISO RGD:708464 6480464 Phenobarbital inhibits the reaction [Dietary Fats results in increased expression of ATG3 mRNA] CTD PMID:36657701 ATG3 Human platycodin D increases expression EXP 6480464 platycodin D results in increased expression of ATG3 protein CTD PMID:26078792 ATG3 Human quercetin decreases expression EXP 6480464 Quercetin results in decreased expression of ATG3 mRNA CTD PMID:21632981 ATG3 Human resveratrol decreases expression EXP 6480464 resveratrol results in decreased expression of ATG3 mRNA CTD PMID:23750556 ATG3 Human resveratrol increases expression EXP 6480464 resveratrol results in increased expression of ATG3 mRNA CTD PMID:23750556 ATG3 Human rotenone increases expression EXP 6480464 Rotenone results in increased expression of ATG3 mRNA CTD PMID:33512557 ATG3 Human SB 431542 multiple interactions EXP 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 ATG3 Human sodium arsenite multiple interactions ISO RGD:1557224 6480464 [sodium arsenite co-treated with Dietary Fats] results in increased expression of ATG3 mRNA CTD PMID:30097599 ATG3 Human sodium arsenite multiple interactions EXP 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of ATG3 more ... CTD PMID:39836092 ATG3 Human sodium arsenite decreases expression ISO RGD:1557224 6480464 sodium arsenite results in decreased expression of ATG3 mRNA CTD PMID:30097599 ATG3 Human sodium dichromate increases expression ISO RGD:1557224 6480464 sodium bichromate results in increased expression of ATG3 mRNA CTD PMID:31558096 ATG3 Human sulindac increases expression ISO RGD:708464 6480464 Sulindac results in increased expression of ATG3 mRNA CTD PMID:24136188 ATG3 Human syringic acid increases expression EXP 6480464 syringic acid results in increased expression of ATG3 protein CTD PMID:33548266 ATG3 Human T-2 toxin increases expression ISO RGD:708464 6480464 T-2 Toxin results in increased expression of ATG3 protein CTD PMID:29870751 ATG3 Human T-2 toxin multiple interactions ISO RGD:1557224 6480464 ATG3 protein affects the reaction [T-2 Toxin results in increased expression of TNF mRNA]; ATG3 more ... CTD PMID:32240701 ATG3 Human T-2 toxin increases expression ISO RGD:1557224 6480464 T-2 Toxin results in increased expression of ATG3 mRNA; T-2 Toxin results in increased expression more ... CTD PMID:32240701 ATG3 Human theophylline increases expression EXP 6480464 Theophylline results in increased expression of ATG3 mRNA CTD PMID:18951874 ATG3 Human titanium dioxide decreases methylation ISO RGD:1557224 6480464 titanium dioxide results in decreased methylation of ATG3 gene CTD PMID:35295148 ATG3 Human trichloroethene increases methylation ISO RGD:708464 6480464 Trichloroethylene results in increased methylation of ATG3 gene CTD PMID:27618143 ATG3 Human triphenyl phosphate affects expression EXP 6480464 triphenyl phosphate affects the expression of ATG3 mRNA CTD PMID:37042841 ATG3 Human trovafloxacin multiple interactions EXP 6480464 [trovafloxacin co-treated with TNF protein] results in increased expression of ATG3 mRNA CTD PMID:33609687 ATG3 Human trovafloxacin increases expression EXP 6480464 trovafloxacin results in increased expression of ATG3 mRNA CTD PMID:33609687 ATG3 Human valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of ATG3 mRNA CTD PMID:25979313 ATG3 Human valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of ATG3 mRNA CTD PMID:23179753|PMID:26272509|PMID:28001369|PMID:29154799 ATG3 Human valproic acid multiple interactions EXP 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386
Imported Annotations - KEGG (archival)
1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4,6-tribromophenol (EXP) 2-bromohexadecanoic acid (EXP) 2-deoxy-D-glucose (EXP) 3,3',5,5'-tetrabromobisphenol A (EXP,ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 4-nonylphenol (ISO) 4-phenylbutyric acid (EXP) acrylamide (ISO) aldehydo-D-glucose (ISO) all-trans-retinoic acid (EXP) ammonium chloride (ISO) amphotericin B (EXP) arsane (EXP) arsenic atom (EXP) arsenite(3-) (EXP) arsenous acid (ISO) artesunate (EXP) atrazine (ISO) benzo[a]pyrene (ISO) berberine (ISO) bisphenol A (EXP,ISO) bisphenol AF (EXP) Bisphenol B (EXP) butyric acid (EXP) cadmium atom (EXP) cadmium dichloride (EXP) cadmium sulfide (EXP) cantharidin (EXP,ISO) captan (ISO) carbon nanotube (ISO) choline (ISO) cisplatin (EXP) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) crocidolite asbestos (ISO) cyclophosphamide (EXP) cyclosporin A (EXP) cypermethrin (EXP) D-glucose (ISO) decabromodiphenyl ether (EXP) deguelin (EXP) diarsenic trioxide (ISO) Dibutyl phosphate (EXP) dibutyl phthalate (ISO) dorsomorphin (EXP) enniatin (ISO) enzyme inhibitor (EXP) ethanol (ISO) finasteride (ISO) fingolimod hydrochloride (EXP) flutamide (ISO) folic acid (ISO) folpet (ISO) furan (ISO) galangin (EXP) gentamycin (EXP,ISO) glucose (ISO) glyphosate (EXP) ivermectin (EXP) L-methionine (ISO) lycopene (ISO) methidathion (ISO) nickel atom (EXP) oligopeptide (EXP) paracetamol (ISO) perfluorobutyric acid (EXP) perfluorooctanoic acid (EXP,ISO) phenobarbital (ISO) platycodin D (EXP) quercetin (EXP) resveratrol (EXP) rotenone (EXP) SB 431542 (EXP) sodium arsenite (EXP,ISO) sodium dichromate (ISO) sulindac (ISO) syringic acid (EXP) T-2 toxin (ISO) theophylline (EXP) titanium dioxide (ISO) trichloroethene (ISO) triphenyl phosphate (EXP) trovafloxacin (EXP) valproic acid (EXP)
1.
GOAs Human GO annotations
GOA_HUMAN data from the GO Consortium
2.
Hydrogen sulfide alleviates myocardial fibrosis in mice with alcoholic cardiomyopathy by downregulating autophagy.
Liang B, etal., Int J Mol Med. 2017 Dec;40(6):1781-1791. doi: 10.3892/ijmm.2017.3191. Epub 2017 Oct 16.
3.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
4.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
5.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
6.
LC3 conjugation system in mammalian autophagy.
Tanida I, etal., Int J Biochem Cell Biol. 2004 Dec;36(12):2503-18.
7.
The rat Apg3p/Aut1p homolog is upregulated by ischemic preconditioning in the retina.
Wu BX, etal., Mol Vis. 2006 Oct 26;12:1292-302.
8.
Mammalian autophagy: core molecular machinery and signaling regulation.
Yang Z and Klionsky DJ, Curr Opin Cell Biol. 2010 Apr;22(2):124-31. Epub 2009 Dec 23.
9.
The protective effect of puerarin-loaded mesoporous silicon nanoparticles on alcoholic hepatitis through mTOR-mediated autophagy pathway.
Zhang XX, etal., Biomed Microdevices. 2022 Oct 29;24(4):37. doi: 10.1007/s10544-022-00622-2.
ATG3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 112,532,510 - 112,561,962 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 112,532,510 - 112,562,046 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 112,251,357 - 112,280,809 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 113,734,049 - 113,763,175 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 113,734,049 - 113,763,175 NCBI Celera 3 110,660,041 - 110,689,158 (-) NCBI Celera Cytogenetic Map 3 q13.2 NCBI HuRef 3 109,635,431 - 109,664,875 (-) NCBI HuRef CHM1_1 3 112,215,286 - 112,244,741 (-) NCBI CHM1_1 T2T-CHM13v2.0 3 115,253,546 - 115,282,997 (-) NCBI T2T-CHM13v2.0
Atg3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 16 44,979,192 - 45,008,901 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 16 44,979,148 - 45,008,901 (+) Ensembl GRCm39 Ensembl GRCm38 16 45,158,829 - 45,188,538 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 16 45,158,785 - 45,188,538 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 16 45,158,942 - 45,188,651 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 16 45,078,161 - 45,107,870 (+) NCBI MGSCv36 mm8 Celera 16 45,552,434 - 45,582,081 (+) NCBI Celera Cytogenetic Map 16 B5 NCBI cM Map 16 29.45 NCBI
Atg3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 11 69,130,948 - 69,159,280 (-) NCBI GRCr8 mRatBN7.2 11 55,624,914 - 55,653,249 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 11 55,624,917 - 55,653,224 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 11 64,438,596 - 64,466,930 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 11 57,100,453 - 57,128,787 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 11 56,170,970 - 56,199,226 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 11 60,585,192 - 60,613,706 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 11 60,585,171 - 60,613,718 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 11 64,687,322 - 64,715,836 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 11 57,162,205 - 57,190,568 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 11 57,219,793 - 57,248,157 (-) NCBI Celera 11 55,191,074 - 55,219,238 (-) NCBI Celera Cytogenetic Map 11 q21 NCBI
Atg3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955427 12,881,454 - 12,906,399 (-) NCBI ChiLan1.0 ChiLan1.0
ATG3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 110,535,875 - 110,564,655 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 110,539,768 - 110,569,070 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 109,681,163 - 109,710,835 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 116,606,467 - 116,635,209 (-) NCBI panpan1.1 PanPan1.1 panPan2
ATG3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 33 17,046,951 - 17,073,203 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 33 17,046,973 - 17,073,150 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 33 17,150,094 - 17,176,355 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 33 17,290,643 - 17,316,985 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 33 17,290,665 - 17,316,925 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 33 17,095,504 - 17,121,791 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 33 17,142,968 - 17,169,265 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 33 17,692,507 - 17,718,820 (-) NCBI UU_Cfam_GSD_1.0
Atg3
ATG3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 147,279,437 - 147,309,590 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 147,279,110 - 147,309,597 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 156,876,859 - 156,907,063 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ATG3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 22 68,227,772 - 68,256,555 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 22 68,228,203 - 68,257,503 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666041 98,205,946 - 98,234,553 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Atg3
.
Predicted Target Of
Count of predictions: 1185 Count of miRNA genes: 715 Interacting mature miRNAs: 815 Transcripts: ENST00000283290, ENST00000402314, ENST00000465980, ENST00000467275, ENST00000488910, ENST00000492886, ENST00000494571, ENST00000495756, ENST00000496423 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
407124811 GWAS773787_H childhood onset asthma QTL GWAS773787 (human) 0.000002 childhood onset asthma 3 112550440 112550441 Human
WI-22015
Human Assembly Chr Position (strand) Source JBrowse GRCh37 3 112,251,469 - 112,251,599 UniSTS GRCh37 Build 36 3 113,734,159 - 113,734,289 RGD NCBI36 Celera 3 110,660,151 - 110,660,281 RGD Cytogenetic Map 3 q13.2 UniSTS HuRef 3 109,635,546 - 109,635,676 UniSTS GeneMap99-GB4 RH Map 3 403.19 UniSTS Whitehead-RH Map 3 496.6 UniSTS
RH120928
Human Assembly Chr Position (strand) Source JBrowse GRCh37 3 112,260,991 - 112,261,293 UniSTS GRCh37 Build 36 3 113,743,681 - 113,743,983 RGD NCBI36 Celera 3 110,669,656 - 110,669,958 RGD Cytogenetic Map 3 q13.2 UniSTS HuRef 3 109,645,052 - 109,645,354 UniSTS TNG Radiation Hybrid Map 3 33515.0 UniSTS
GDB:372310
Human Assembly Chr Position (strand) Source JBrowse GRCh37 3 112,277,934 - 112,278,058 UniSTS GRCh37 Build 36 3 113,760,624 - 113,760,748 RGD NCBI36 Celera 3 110,686,607 - 110,686,731 RGD Cytogenetic Map 3 q13.2 UniSTS HuRef 3 109,661,999 - 109,662,123 UniSTS
G20743
Human Assembly Chr Position (strand) Source JBrowse GRCh37 3 112,251,433 - 112,251,579 UniSTS GRCh37 Build 36 3 113,734,123 - 113,734,269 RGD NCBI36 Celera 3 110,660,115 - 110,660,261 RGD Cytogenetic Map 3 q13.2 UniSTS HuRef 3 109,635,510 - 109,635,656 UniSTS
A006E19
Human Assembly Chr Position (strand) Source JBrowse GRCh37 3 112,251,433 - 112,251,579 UniSTS GRCh37 Build 36 3 113,734,123 - 113,734,269 RGD NCBI36 Celera 3 110,660,115 - 110,660,261 RGD Cytogenetic Map 3 q13.2 UniSTS HuRef 3 109,635,510 - 109,635,656 UniSTS TNG Radiation Hybrid Map 3 33486.0 UniSTS GeneMap99-GB4 RH Map 3 403.87 UniSTS NCBI RH Map 3 900.4 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1204
2439
2788
2253
4974
1726
2351
6
624
1951
465
2270
7306
6472
53
3734
1
852
1744
1617
175
1
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000283290 ⟹ ENSP00000283290
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 112,532,510 - 112,561,962 (-) Ensembl
Ensembl Acc Id:
ENST00000402314 ⟹ ENSP00000385943
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 112,532,510 - 112,561,916 (-) Ensembl
Ensembl Acc Id:
ENST00000465980
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 112,543,995 - 112,561,633 (-) Ensembl
Ensembl Acc Id:
ENST00000467275
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 112,537,531 - 112,538,344 (-) Ensembl
Ensembl Acc Id:
ENST00000488910
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 112,558,138 - 112,561,857 (-) Ensembl
Ensembl Acc Id:
ENST00000492886 ⟹ ENSP00000420378
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 112,538,146 - 112,562,046 (-) Ensembl
Ensembl Acc Id:
ENST00000494571
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 112,532,522 - 112,536,767 (-) Ensembl
Ensembl Acc Id:
ENST00000495756
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 112,536,210 - 112,561,924 (-) Ensembl
Ensembl Acc Id:
ENST00000496423 ⟹ ENSP00000420259
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 112,537,735 - 112,561,652 (-) Ensembl
RefSeq Acc Id:
NM_001278712 ⟹ NP_001265641
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 3 112,532,510 - 112,561,962 (-) NCBI HuRef 3 109,635,431 - 109,664,875 (-) NCBI CHM1_1 3 112,215,286 - 112,244,741 (-) NCBI T2T-CHM13v2.0 3 115,253,546 - 115,282,997 (-) NCBI
Sequence:
AGTGTCACGTGAGGCCCCGGTGGCGGCGCAGCTACGGCAAGAGAGTGAGAAGGAAGGGAAGCCGGAAGGGGCGCGAGTGAAGCAAAGCGAGGACAGACAGCTCGCAGAGGGCGAGGGGTGCGTGTGCG
hide sequence
RefSeq Acc Id:
NM_022488 ⟹ NP_071933
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 3 112,532,510 - 112,561,962 (-) NCBI GRCh37 3 112,251,354 - 112,280,810 (-) NCBI Build 36 3 113,734,049 - 113,763,175 (-) NCBI Archive Celera 3 110,660,041 - 110,689,158 (-) RGD HuRef 3 109,635,431 - 109,664,875 (-) NCBI CHM1_1 3 112,215,286 - 112,244,741 (-) NCBI T2T-CHM13v2.0 3 115,253,546 - 115,282,997 (-) NCBI
Sequence:
AGTGTCACGTGAGGCCCCGGTGGCGGCGCAGCTACGGCAAGAGAGTGAGAAGGAAGGGAAGCCGGAAGGGGCGCGAGTGAAGCAAAGCGAGGACAGACAGCTCGCAGAGGGCGAGGGGTGCGTGTGCG
hide sequence
RefSeq Acc Id:
XM_011513074 ⟹ XP_011511376
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 3 112,532,510 - 112,561,962 (-) NCBI
Sequence:
AGTGTCACGTGAGGCCCCGGTGGCGGCGCAGCTACGGCAAGAGAGTGAGAAGGAAGGGAAGCCG
hide sequence
RefSeq Acc Id:
NP_071933 ⟸ NM_022488
- Peptide Label:
isoform 1
- UniProtKB:
C9JNW8 (UniProtKB/Swiss-Prot), Q6PKC5 (UniProtKB/Swiss-Prot), Q9H6L9 (UniProtKB/Swiss-Prot), Q9NT62 (UniProtKB/Swiss-Prot)
- Sequence:
MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITL
hide sequence
RefSeq Acc Id:
NP_001265641 ⟸ NM_001278712
- Peptide Label:
isoform 2
- UniProtKB:
Q9NT62 (UniProtKB/Swiss-Prot)
- Sequence:
MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVK
hide sequence
RefSeq Acc Id:
XP_011511376 ⟸ XM_011513074
- Peptide Label:
isoform X1
- Sequence:
MEYSDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLENKDNIRLQDCSALCEEEEDEDEGEAADMEEYEESGLLETDEATLDTRKIVEACKAKTDAGGEDAILQTRTYDLYITYDKYYQTPRL
hide sequence
Ensembl Acc Id:
ENSP00000420378 ⟸ ENST00000492886
Ensembl Acc Id:
ENSP00000283290 ⟸ ENST00000283290
Ensembl Acc Id:
ENSP00000385943 ⟸ ENST00000402314
Ensembl Acc Id:
ENSP00000420259 ⟸ ENST00000496423
RGD ID: 6865246 Promoter ID: EPDNEW_H5788 Type: initiation region Name: ATG3_1 Description: autophagy related 3 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 3 112,561,935 - 112,561,995 EPDNEW
RGD ID: 6800936 Promoter ID: HG_KWN:45836 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, CD4+TCell_12Hour, CD4+TCell_2Hour, HeLa_S3, Jurkat, K562, Lymphoblastoid, NB4 Transcripts: ENST00000283290, ENST00000402314, NM_017945, UC010HQE.1 Position: Human Assembly Chr Position (strand) Source Build 36 3 113,762,831 - 113,763,957 (-) MPROMDB
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2012-06-12
ATG3
autophagy related 3
ATG3
ATG3 autophagy related 3 homolog (S. cerevisiae)
Symbol and/or name change
5135510 APPROVED
