Symbol:
Msi1
Name:
musashi RNA-binding protein 1
RGD ID:
628778
Description:
Predicted to enable RNA binding activity; molecular condensate scaffold activity; and protein homodimerization activity. Involved in epithelial cell differentiation and response to hormone. Predicted to be located in nucleus. Predicted to be active in cytoplasm. Biomarker of brain infarction and brain ischemia. Orthologous to human MSI1 (musashi RNA binding protein 1); PARTICIPATES IN mRNA decay pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; alpha-Zearalanol; ammonium chloride.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Msi1h; Musashi homolog 1(Drosophila); musashi-1; RNA-binding protein Musashi homolog 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 46,815,225 - 46,911,852 (-) NCBI GRCr8 mRatBN7.2 12 41,158,301 - 41,251,134 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 41,158,599 - 41,191,076 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 42,329,615 - 42,351,639 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 42,943,282 - 42,965,305 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 42,003,827 - 42,025,850 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 46,899,835 - 46,935,335 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 46,895,447 - 46,920,952 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 48,696,700 - 48,731,989 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 42,425,957 - 42,462,517 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 42,289,344 - 42,310,487 (-) NCBI Celera 12 42,786,001 - 42,821,164 (-) NCBI Celera Cytogenetic Map 12 q16 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Imported Annotations - KEGG (archival)
1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 3,3',5-triiodo-L-thyronine (ISO) 4,4'-sulfonyldiphenol (ISO) 5-aza-2'-deoxycytidine (ISO) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) ammonium chloride (EXP) arsenous acid (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) cadmium atom (ISO) calcitriol (ISO) choline (ISO) cisplatin (ISO) diarsenic trioxide (ISO) doxorubicin (ISO) eckol (ISO) ethanol (ISO) folic acid (ISO) FR900359 (ISO) fulvestrant (ISO) genistein (ISO) gentamycin (EXP) L-methionine (ISO) lead(0) (ISO) lithium chloride (ISO) mono(2-ethylhexyl) phthalate (ISO) N,N-diethyl-m-toluamide (EXP) paracetamol (EXP,ISO) perfluorooctanoic acid (EXP) permethrin (EXP) poly(I:C) (ISO) pyriproxyfen (ISO) resveratrol (ISO) SB 431542 (ISO) tamibarotene (ISO) thioacetamide (EXP) titanium dioxide (ISO) triptonide (ISO) valproic acid (ISO)
1.
Regulation of tau RNA maturation by thyroid hormone is mediated by the neural RNA-binding protein musashi-1.
Cuadrado A, etal., Mol Cell Neurosci. 2002 Jun;20(2):198-210.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
4.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
5.
Expression of Musashi-1 in the rat stomach and changes during mucosal injury and restitution.
Nagata H, etal., FEBS Lett. 2006 Jan 9;580(1):27-33. Epub 2005 Dec 6.
6.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
7.
GOA pipeline
RGD automated data pipeline
8.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
9.
Differential expression of Musashi1 and nestin in the adult rat hippocampus after ischemia.
Yagita Y, etal., J Neurosci Res 2002 Sep 15;69(6):750-6.
10.
Proliferation and differentiation of neural stem cells in adult rats after cerebral infarction.
Zhang B, etal., Chin Med Sci J. 2004 Jun;19(2):73-7.
Msi1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 46,815,225 - 46,911,852 (-) NCBI GRCr8 mRatBN7.2 12 41,158,301 - 41,251,134 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 41,158,599 - 41,191,076 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 42,329,615 - 42,351,639 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 42,943,282 - 42,965,305 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 42,003,827 - 42,025,850 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 46,899,835 - 46,935,335 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 46,895,447 - 46,920,952 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 48,696,700 - 48,731,989 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 42,425,957 - 42,462,517 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 42,289,344 - 42,310,487 (-) NCBI Celera 12 42,786,001 - 42,821,164 (-) NCBI Celera Cytogenetic Map 12 q16 NCBI
MSI1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 120,339,662 - 120,369,164 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 120,341,330 - 120,369,164 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 120,779,133 - 120,806,967 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 119,263,516 - 119,291,341 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 119,241,852 - 119,269,678 NCBI Celera 12 120,412,237 - 120,440,052 (-) NCBI Celera Cytogenetic Map 12 q24.31 NCBI HuRef 12 117,787,331 - 117,814,272 (-) NCBI HuRef CHM1_1 12 120,747,072 - 120,774,927 (-) NCBI CHM1_1 T2T-CHM13v2.0 12 120,326,839 - 120,356,341 (-) NCBI T2T-CHM13v2.0
Msi1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 115,567,734 - 115,593,757 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 115,567,658 - 115,593,757 (+) Ensembl GRCm39 Ensembl GRCm38 5 115,359,059 - 115,455,698 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 115,429,599 - 115,455,698 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 115,879,694 - 115,904,211 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 115,690,684 - 115,715,201 (+) NCBI MGSCv36 mm8 Celera 5 112,528,152 - 112,553,235 (+) NCBI Celera Cytogenetic Map 5 F NCBI cM Map 5 56.09 NCBI
Msi1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955455 11,268,650 - 11,298,378 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955455 11,269,486 - 11,298,342 (+) NCBI ChiLan1.0 ChiLan1.0
MSI1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 128,402,554 - 128,430,509 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 128,398,931 - 128,426,786 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 117,915,879 - 117,943,772 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 121,289,281 - 121,316,276 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 121,289,281 - 121,316,276 (-) Ensembl panpan1.1 panPan2
MSI1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 26 16,266,302 - 16,288,980 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 26 16,266,586 - 16,289,012 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 26 16,270,168 - 16,292,838 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 26 16,533,308 - 16,556,005 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 26 16,533,366 - 16,555,993 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 26 16,494,719 - 16,517,389 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 26 16,571,374 - 16,594,034 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 26 16,614,085 - 16,635,848 (-) NCBI UU_Cfam_GSD_1.0
Msi1
MSI1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 40,331,377 - 40,356,788 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 40,331,371 - 40,356,793 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 14 42,789,298 - 42,812,679 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MSI1
Msi1
.
Predicted Target Of
Count of predictions: 60 Count of miRNA genes: 55 Interacting mature miRNAs: 58 Transcripts: ENSRNOT00000001532 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
631560 Apr1 Acute phase response QTL 1 6.1 orosomucoid 1 amount (VT:0010541) plasma orosomucoid 1 level (CMO:0001467) 12 19144362 46669029 Rat 8552964 Pigfal17 Plasma insulin-like growth factor 1 level QTL 17 3.5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 8693635 Alc28 Alcohol consumption QTL 28 2.7 0.439 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 12 23081340 44726024 Rat 7411641 Foco19 Food consumption QTL 19 27.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 7411643 Foco20 Food consumption QTL 20 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 20328819 46669029 Rat 61324 Eae5 Experimental allergic encephalomyelitis QTL 5 14 nervous system integrity trait (VT:0010566) percentage of study population developing relapsing-remitting experimental autoimmune encephalomyelitis during a period of time (CMO:0001402) 12 19610870 46669029 Rat 5684888 Pia42 Pristane induced arthritis QTL 42 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 19610870 42828880 Rat 1549912 Bp268 Blood pressure QTL 268 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 13182736 46669029 Rat 2302060 Pia37 Pristane induced arthritis QTL 37 6.1 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 13198157 46669029 Rat 9590147 Scort7 Serum corticosterone level QTL 7 13.61 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 12 1 42110980 Rat 1641928 Alcrsp5 Alcohol response QTL 5 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 12 12812385 46669029 Rat 1300162 Bp188 Blood pressure QTL 188 3.19 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 32103174 45899022 Rat 8552912 Pigfal6 Plasma insulin-like growth factor 1 level QTL 6 5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564498 46669029 Rat 1549829 Scl48 Serum cholesterol level QTL 48 5 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 12 9603277 46669029 Rat 10059594 Kidm46 Kidney mass QTL 46 3.79 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 12 6107579 46669029 Rat 9590086 Insglur6 Insulin/glucose ratio QTL 6 18.97 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 12 1 42110980 Rat 8552918 Pigfal7 Plasma insulin-like growth factor 1 level QTL 7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 1549902 Bp269 Blood pressure QTL 269 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 13182736 46669029 Rat 1600386 Calcic2 Intracellular calcium level QTL 2 0.001 platelet physiology trait (VT:0005464) platelet intracellular calcium level (CMO:0000922) 12 28064433 46669029 Rat 1302792 Scl21 Serum cholesterol level QTL 21 3.8 0.0011 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 12 7196730 46669029 Rat 61404 Bw120 Body weight QTL 120 5.1 body mass (VT:0001259) body mass index (BMI) (CMO:0000105) 12 12351619 46669029 Rat 1300175 Cm5 Cardiac mass QTL 5 3.78 heart mass (VT:0007028) heart left ventricle weight to body weight ratio (CMO:0000530) 12 28064433 45899022 Rat 8693658 Alc33 Alcohol consumption QTL 33 2.1 0.68 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 12 23081340 43551788 Rat 2293699 Bss49 Bone structure and strength QTL 49 5.61 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 12 10474137 46669029 Rat 1331761 Bp218 Blood pressure QTL 218 2.973 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 12 11073825 45055165 Rat 634351 Apr5 Acute phase response QTL 5 6.7 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 12 1 44503507 Rat 8694179 Bw150 Body weight QTL 150 2.9 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 634350 Apr4 Acute phase response QTL 4 6 orosomucoid 1 amount (VT:0010541) plasma orosomucoid 1 level (CMO:0001467) 12 1172005 46172005 Rat 7411545 Bw128 Body weight QTL 128 5.2 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 7411547 Bw129 Body weight QTL 129 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 6 5564495 46669029 Rat 737979 Pia22 Pristane induced arthritis QTL 22 53.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 1 44465750 Rat 2303569 Gluco44 Glucose level QTL 44 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 12812385 46669029 Rat 7411586 Foco5 Food consumption QTL 5 5.4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 2303575 Insul14 Insulin level QTL 14 4 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 12 1 42450532 Rat 7411588 Foco6 Food consumption QTL 6 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 2302042 Pia38 Pristane induced arthritis QTL 38 3.5 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 1 44503507 Rat 2300186 Bmd59 Bone mineral density QTL 59 7.1 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 12 10474137 46669029 Rat 7411595 Foco9 Food consumption QTL 9 4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 7411597 Foco10 Food consumption QTL 10 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 7411660 Foco28 Food consumption QTL 28 10.9 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat
AW533646
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 41,191,132 - 41,191,293 (+) MAPPER mRatBN7.2 mRatBN7.2 12 41,191,132 - 41,191,684 (+) MAPPER mRatBN7.2 Rnor_6.0 12 46,927,866 - 46,928,417 NCBI Rnor6.0 Rnor_6.0 12 46,927,866 - 46,928,026 NCBI Rnor6.0 Rnor_5.0 12 48,724,520 - 48,725,071 UniSTS Rnor5.0 Rnor_5.0 12 48,724,520 - 48,724,680 UniSTS Rnor5.0 RGSC_v3.4 12 42,455,048 - 42,455,208 UniSTS RGSC3.4 RGSC_v3.4 12 42,455,048 - 42,455,599 UniSTS RGSC3.4 Celera 12 42,813,849 - 42,814,400 UniSTS Celera 12 42,813,849 - 42,814,009 UniSTS RH 3.4 Map 12 772.12 UniSTS Cytogenetic Map 12 q16 UniSTS
RH134213
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 41,190,227 - 41,190,408 (+) MAPPER mRatBN7.2 Rnor_6.0 12 46,926,961 - 46,927,141 NCBI Rnor6.0 Rnor_5.0 12 48,723,615 - 48,723,795 UniSTS Rnor5.0 RGSC_v3.4 12 42,454,143 - 42,454,323 UniSTS RGSC3.4 Celera 12 42,812,944 - 42,813,124 UniSTS Cytogenetic Map 12 q16 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
90
89
58
25
58
6
217
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000001532 ⟹ ENSRNOP00000001532
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 41,158,599 - 41,191,076 (-) Ensembl Rnor_6.0 Ensembl 12 46,895,447 - 46,920,952 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000117406 ⟹ ENSRNOP00000084373
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 41,158,599 - 41,191,076 (-) Ensembl
RefSeq Acc Id:
NM_148890 ⟹ NP_683688
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 46,819,039 - 46,845,425 (-) NCBI mRatBN7.2 12 41,158,301 - 41,184,690 (-) NCBI Rnor_6.0 12 46,899,835 - 46,935,335 (-) NCBI Rnor_5.0 12 48,696,700 - 48,731,989 (-) NCBI RGSC_v3.4 12 42,425,957 - 42,462,517 (-) RGD Celera 12 42,786,001 - 42,821,164 (-) RGD
Sequence:
ATGGAGACTGACGCGCCCCAGCCCGGCCTCGCCTCCCCGGACTCGCCGCACGACCCCTGCAAGATGTTCATCGGAGGACTCAGTTGGCAGACCACGCAGGAAGGGCTGCGCGAATACTTCGGCCAGTT
hide sequence
RefSeq Acc Id:
XM_039089120 ⟹ XP_038945048
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 46,819,039 - 46,845,436 (-) NCBI mRatBN7.2 12 41,158,301 - 41,184,704 (-) NCBI
RefSeq Acc Id:
XM_039089121 ⟹ XP_038945049
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 46,819,039 - 46,845,436 (-) NCBI mRatBN7.2 12 41,158,301 - 41,184,704 (-) NCBI
RefSeq Acc Id:
XM_039089122 ⟹ XP_038945050
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 46,819,039 - 46,845,436 (-) NCBI mRatBN7.2 12 41,158,301 - 41,184,704 (-) NCBI
RefSeq Acc Id:
XM_039089123 ⟹ XP_038945051
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 46,819,039 - 46,842,452 (-) NCBI mRatBN7.2 12 41,158,301 - 41,181,749 (-) NCBI
RefSeq Acc Id:
XM_039089124 ⟹ XP_038945052
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 46,819,039 - 46,839,664 (-) NCBI mRatBN7.2 12 41,158,301 - 41,178,582 (-) NCBI
RefSeq Acc Id:
XM_039089125 ⟹ XP_038945053
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 46,819,039 - 46,911,852 (-) NCBI mRatBN7.2 12 41,158,301 - 41,251,134 (-) NCBI
RefSeq Acc Id:
XM_063271088 ⟹ XP_063127158
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 46,815,225 - 46,845,436 (-) NCBI
RefSeq Acc Id:
XM_063271090 ⟹ XP_063127160
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 46,819,039 - 46,839,669 (-) NCBI
RefSeq Acc Id:
XM_063271091 ⟹ XP_063127161
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 46,819,039 - 46,839,673 (-) NCBI
RefSeq Acc Id:
XR_010056363
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 46,815,225 - 46,845,436 (-) NCBI
RefSeq Acc Id:
XR_010056364
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 46,815,225 - 46,845,436 (-) NCBI
RefSeq Acc Id:
NP_683688 ⟸ NM_148890
- UniProtKB:
Q8K3P4 (UniProtKB/Swiss-Prot), A6J1U2 (UniProtKB/TrEMBL), F1LRH1 (UniProtKB/TrEMBL)
- Sequence:
METDAPQPGLASPDSPHDPCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSVNTTVEDVKHY
hide sequence
Ensembl Acc Id:
ENSRNOP00000001532 ⟸ ENSRNOT00000001532
RefSeq Acc Id:
XP_038945053 ⟸ XM_039089125
- Peptide Label:
isoform X7
- UniProtKB:
A6J1U2 (UniProtKB/TrEMBL), F1LRH1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038945050 ⟸ XM_039089122
- Peptide Label:
isoform X4
- UniProtKB:
A6J1U2 (UniProtKB/TrEMBL), F1LRH1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038945049 ⟸ XM_039089121
- Peptide Label:
isoform X3
- UniProtKB:
A0A8I6GAA4 (UniProtKB/TrEMBL), A6J1U2 (UniProtKB/TrEMBL), F1LRH1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038945048 ⟸ XM_039089120
- Peptide Label:
isoform X2
- UniProtKB:
A6J1U2 (UniProtKB/TrEMBL), F1LRH1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038945051 ⟸ XM_039089123
- Peptide Label:
isoform X5
- UniProtKB:
A6J1U2 (UniProtKB/TrEMBL), F1LRH1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038945052 ⟸ XM_039089124
- Peptide Label:
isoform X6
Ensembl Acc Id:
ENSRNOP00000084373 ⟸ ENSRNOT00000117406
RefSeq Acc Id:
XP_063127158 ⟸ XM_063271088
- Peptide Label:
isoform X1
- UniProtKB:
Q8K3P4 (UniProtKB/Swiss-Prot), A6J1U2 (UniProtKB/TrEMBL), F1LRH1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063127161 ⟸ XM_063271091
- Peptide Label:
isoform X9
RefSeq Acc Id:
XP_063127160 ⟸ XM_063271090
- Peptide Label:
isoform X8
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2013-01-02
Msi1
musashi RNA-binding protein 1
Msi1
Musashi homolog 1(Drosophila)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-11-16
Msi1
Musashi homolog 1(Drosophila)
Msi1h
musashi homolog 1(Drosophila)
Symbol and Name updated to reflect Human and Mouse nomenclature
1299863 APPROVED
2005-01-20
Msi1h
musashi homolog 1(Drosophila)
Musashi homolog 1(Drosophila)
Name updated
1299863 APPROVED
2003-02-27
Msi1h
Musashi homolog 1(Drosophila)
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_expression
expressed in neural stem cells
633285
