Symbol:
Khdrbs1
Name:
KH RNA binding domain containing, signal transduction associated 1
RGD ID:
621459
Description:
Enables SH3 domain binding activity and identical protein binding activity. Involved in cell surface receptor signaling pathway; regulation of alternative mRNA splicing, via spliceosome; and spermatogenesis. Located in nucleus. Part of Grb2-Sos complex. Orthologous to human KHDRBS1 (KH RNA binding domain containing, signal transduction associated 1); INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
GAP-associated tyrosine phosphoprotein p62; KH domain containing, RNA binding, signal transduction associated 1; KH domain-containing, RNA-binding, signal transduction-associated protein 1; KH domain-containing, RNA-binding, signal transduction-associated protein 1-like; LOC100361306; p21 Ras GTPase-activating protein-associated p62; P62; p68; Sam68; src associated in mitosis, 68 kDa; src-associated in mitosis 68 kDa protein
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
KHDRBS1 (KH RNA binding domain containing, signal transduction associated 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB
Mus musculus (house mouse):
Khdrbs1 (KH domain containing, RNA binding, signal transduction associated 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Khdrbs1 (KH RNA binding domain containing, signal transduction associated 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
KHDRBS1 (KH RNA binding domain containing, signal transduction associated 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
KHDRBS1 (KH RNA binding domain containing, signal transduction associated 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Khdrbs1 (KH RNA binding domain containing, signal transduction associated 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
KHDRBS1 (KH RNA binding domain containing, signal transduction associated 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
KHDRBS1 (KH RNA binding domain containing, signal transduction associated 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Khdrbs1 (KH RNA binding domain containing, signal transduction associated 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
KHDRBS1 (KH RNA binding domain containing, signal transduction associated 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Khdrbs1 (KH domain containing, RNA binding, signal transduction associated 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
khdrbs1b (KH domain containing, RNA binding, signal transduction associated 1b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
khdrbs1a (KH domain containing, RNA binding, signal transduction associated 1a)
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
qkr54B
Alliance
DIOPT (Hieranoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG4021
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
qkr58E-1
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
khdrbs1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 147,337,048 - 147,374,604 (-) NCBI GRCr8 mRatBN7.2 5 142,051,844 - 142,089,175 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 142,063,570 - 142,089,180 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 144,764,372 - 144,790,877 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 146,534,194 - 146,560,697 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 146,530,842 - 146,557,424 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 147,927,145 - 147,953,093 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 147,927,152 - 147,953,093 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 151,655,530 - 151,680,547 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 148,801,685 - 148,802,351 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 148,882,113 - 148,909,264 (-) NCBI Celera 5 140,536,987 - 140,562,345 (-) NCBI Celera Cytogenetic Map 5 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Khdrbs1 Rat 1,2-dimethylhydrazine affects expression ISO RGD:734417 6480464 1,2-Dimethylhydrazine affects the expression of KHDRBS1 mRNA CTD PMID:22206623 Khdrbs1 Rat 1,2-dimethylhydrazine multiple interactions ISO RGD:734417 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of KHDRBS1 mRNA CTD PMID:22206623 Khdrbs1 Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of KHDRBS1 mRNA CTD PMID:17557909 Khdrbs1 Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of KHDRBS1 mRNA CTD PMID:26496021 Khdrbs1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:734417 6480464 Tetrachlorodibenzodioxin results in decreased expression of KHDRBS1 mRNA CTD PMID:15328365 Khdrbs1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of KHDRBS1 mRNA CTD PMID:33387578 Khdrbs1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:734417 6480464 Tetrachlorodibenzodioxin affects the expression of KHDRBS1 mRNA CTD PMID:21570461 Khdrbs1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of KHDRBS1 mRNA; Tetrachlorodibenzodioxin results in increased expression of KHDRBS1 more ... CTD PMID:16548065|PMID:34747641 Khdrbs1 Rat 2,4,6-tribromophenol decreases expression ISO RGD:734416 6480464 2,4,6-tribromophenol results in decreased expression of KHDRBS1 mRNA CTD PMID:31675489 Khdrbs1 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2,4-dinitrotoluene affects the expression of KHDRBS1 mRNA CTD PMID:21346803 Khdrbs1 Rat 2,6-dimethoxyphenol multiple interactions ISO RGD:734416 6480464 [Sodium Chloride co-treated with pyrogallol 1,3-dimethyl ether] results in decreased expression of KHDRBS1 protein; [Sodium more ... CTD PMID:38598786 Khdrbs1 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2,6-dinitrotoluene affects the expression of KHDRBS1 mRNA CTD PMID:21346803 Khdrbs1 Rat 3,4-methylenedioxymethamphetamine increases expression ISO RGD:734417 6480464 N-Methyl-3,4-methylenedioxyamphetamine results in increased expression of KHDRBS1 mRNA CTD PMID:20188158 Khdrbs1 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of KHDRBS1 protein CTD PMID:34915118 Khdrbs1 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:734417 6480464 bisphenol S results in increased expression of KHDRBS1 mRNA CTD PMID:39298647 Khdrbs1 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:734416 6480464 bisphenol S results in increased expression of KHDRBS1 protein CTD PMID:34186270 Khdrbs1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of KHDRBS1 mRNA CTD PMID:24780913 Khdrbs1 Rat acrylamide increases expression ISO RGD:734416 6480464 Acrylamide results in increased expression of KHDRBS1 mRNA CTD PMID:32763439 Khdrbs1 Rat aflatoxin B1 increases methylation ISO RGD:734416 6480464 Aflatoxin B1 results in increased methylation of KHDRBS1 gene CTD PMID:28458013 Khdrbs1 Rat all-trans-retinoic acid decreases expression ISO RGD:734416 6480464 Tretinoin results in decreased expression of KHDRBS1 mRNA CTD PMID:33167477 Khdrbs1 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of KHDRBS1 mRNA CTD PMID:38685447 Khdrbs1 Rat Aroclor 1254 decreases expression ISO RGD:734417 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of KHDRBS1 mRNA CTD PMID:23650126 Khdrbs1 Rat arsenite(3-) increases methylation ISO RGD:734416 6480464 arsenite results in increased methylation of KHDRBS1 promoter CTD PMID:23974009 Khdrbs1 Rat astragaloside IV multiple interactions ISO RGD:734416 243048424 astragaloside IV inhibits the reaction [beta-Glycerophosphate astragaloside IV increases expression of KHDRBS1 protein in more ... RGD Khdrbs1 Rat astragaloside IV decreases expression ISO RGD:734417 243048424 astragaloside IV decreases expression of Khdrbs1 protein in thoracic aorta RGD Khdrbs1 Rat atrazine decreases expression ISO RGD:734416 6480464 Atrazine results in decreased expression of KHDRBS1 mRNA CTD PMID:22378314 Khdrbs1 Rat benzatropine decreases expression ISO RGD:734416 6480464 Benztropine results in decreased expression of KHDRBS1 protein CTD PMID:34122009 Khdrbs1 Rat benzo[a]pyrene affects expression ISO RGD:734417 6480464 Benzo(a)pyrene affects the expression of KHDRBS1 mRNA CTD PMID:22342234 Khdrbs1 Rat benzo[b]fluoranthene decreases expression ISO RGD:734417 6480464 benzo(b)fluoranthene results in decreased expression of KHDRBS1 mRNA CTD PMID:26377693 Khdrbs1 Rat beta-lapachone decreases expression ISO RGD:734416 6480464 beta-lapachone results in decreased expression of KHDRBS1 mRNA CTD PMID:38218311 Khdrbs1 Rat bis(2-ethylhexyl) phthalate decreases expression ISO RGD:734417 6480464 Diethylhexyl Phthalate results in decreased expression of KHDRBS1 mRNA CTD PMID:33754040 Khdrbs1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of KHDRBS1 mRNA CTD PMID:26496021 Khdrbs1 Rat bisphenol A decreases expression ISO RGD:734416 6480464 bisphenol A results in decreased expression of KHDRBS1 protein CTD PMID:31675489 Khdrbs1 Rat bisphenol A multiple interactions ISO RGD:734416 6480464 [[ginger extract results in increased abundance of Oils, Volatile] which co-treated with bisphenol A] affects more ... CTD PMID:33376534 Khdrbs1 Rat bisphenol A decreases expression ISO RGD:734417 6480464 bisphenol A results in decreased expression of KHDRBS1 mRNA CTD PMID:33221593 Khdrbs1 Rat bisphenol A decreases methylation ISO RGD:734417 6480464 bisphenol A results in decreased methylation of KHDRBS1 promoter CTD PMID:27312807 Khdrbs1 Rat bisphenol A increases methylation ISO RGD:734417 6480464 bisphenol A results in increased methylation of KHDRBS1 promoter CTD PMID:27312807 Khdrbs1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of KHDRBS1 mRNA CTD PMID:30816183|PMID:32528016|PMID:34947998 Khdrbs1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of KHDRBS1 mRNA CTD PMID:25181051 Khdrbs1 Rat bisphenol AF increases expression ISO RGD:734416 6480464 bisphenol AF results in increased expression of KHDRBS1 protein CTD PMID:34186270 Khdrbs1 Rat Bisphenol B increases expression ISO RGD:734416 6480464 bisphenol B results in increased expression of KHDRBS1 protein CTD PMID:34186270 Khdrbs1 Rat bisphenol F increases expression ISO RGD:734416 6480464 bisphenol F results in increased expression of KHDRBS1 protein CTD PMID:34186270 Khdrbs1 Rat buspirone decreases expression EXP 6480464 Buspirone results in decreased expression of KHDRBS1 mRNA CTD PMID:24136188 Khdrbs1 Rat caffeine affects phosphorylation ISO RGD:734416 6480464 Caffeine affects the phosphorylation of KHDRBS1 protein CTD PMID:35688186 Khdrbs1 Rat carbamazepine affects expression ISO RGD:734416 6480464 Carbamazepine affects the expression of KHDRBS1 mRNA CTD PMID:25979313 Khdrbs1 Rat carbon nanotube multiple interactions ISO RGD:734416 6480464 [Nanotubes, Carbon co-treated with calfactant] results in increased expression of KHDRBS1 protein CTD PMID:23026733 Khdrbs1 Rat chloropicrin affects expression ISO RGD:734416 6480464 chloropicrin affects the expression of KHDRBS1 mRNA CTD PMID:26352163 Khdrbs1 Rat chlorpyrifos decreases expression ISO RGD:734417 6480464 Chlorpyrifos results in decreased expression of KHDRBS1 mRNA CTD PMID:37019170 Khdrbs1 Rat clobetasol decreases expression ISO RGD:734417 6480464 Clobetasol results in decreased expression of KHDRBS1 mRNA CTD PMID:27462272 Khdrbs1 Rat clozapine decreases expression ISO RGD:734416 6480464 Clozapine results in decreased expression of KHDRBS1 protein CTD PMID:34122009 Khdrbs1 Rat cobalt dichloride increases expression ISO RGD:734416 6480464 cobaltous chloride results in increased expression of KHDRBS1 mRNA CTD PMID:19376846 Khdrbs1 Rat cocaine affects expression EXP 6480464 Cocaine affects the expression of KHDRBS1 mRNA CTD PMID:20187946 Khdrbs1 Rat copper atom increases expression ISO RGD:734417 6480464 Copper results in increased expression of KHDRBS1 protein CTD PMID:21146535 Khdrbs1 Rat copper(0) increases expression ISO RGD:734417 6480464 Copper results in increased expression of KHDRBS1 protein CTD PMID:21146535 Khdrbs1 Rat copper(II) sulfate increases expression ISO RGD:734416 6480464 Copper Sulfate results in increased expression of KHDRBS1 mRNA CTD PMID:19549813 Khdrbs1 Rat coumarin increases phosphorylation ISO RGD:734416 6480464 coumarin results in increased phosphorylation of KHDRBS1 protein CTD PMID:35688186 Khdrbs1 Rat cyclosporin A increases expression ISO RGD:734416 6480464 Cyclosporine results in increased expression of KHDRBS1 mRNA CTD PMID:25562108 Khdrbs1 Rat DDE increases expression ISO RGD:734416 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of KHDRBS1 mRNA CTD PMID:38568856 Khdrbs1 Rat decabromodiphenyl ether decreases expression ISO RGD:734416 6480464 decabromobiphenyl ether results in decreased expression of KHDRBS1 protein CTD PMID:31675489 Khdrbs1 Rat diethylstilbestrol increases expression ISO RGD:734416 6480464 Diethylstilbestrol results in increased expression of KHDRBS1 mRNA CTD PMID:36621641 Khdrbs1 Rat disodium selenite increases expression ISO RGD:734416 6480464 Sodium Selenite results in increased expression of KHDRBS1 mRNA CTD PMID:18175754 Khdrbs1 Rat dorsomorphin multiple interactions ISO RGD:734416 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Khdrbs1 Rat enzyme inhibitor multiple interactions ISO RGD:734416 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation more ... CTD PMID:23301498 Khdrbs1 Rat ethyl methanesulfonate increases expression ISO RGD:734416 6480464 Ethyl Methanesulfonate results in increased expression of KHDRBS1 mRNA CTD PMID:23649840 Khdrbs1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of KHDRBS1 mRNA CTD PMID:24136188 Khdrbs1 Rat folic acid multiple interactions ISO RGD:734417 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of KHDRBS1 mRNA CTD PMID:22206623 Khdrbs1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of KHDRBS1 mRNA CTD PMID:22061828 Khdrbs1 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of KHDRBS1 mRNA CTD PMID:33387578 Khdrbs1 Rat geraniol decreases expression ISO RGD:734416 6480464 geraniol results in decreased expression of KHDRBS1 mRNA CTD PMID:27683099 Khdrbs1 Rat hexane decreases methylation EXP 6480464 n-hexane results in decreased methylation of KHDRBS1 promoter CTD PMID:23740543 Khdrbs1 Rat irinotecan decreases expression ISO RGD:734416 6480464 Irinotecan analog results in decreased expression of KHDRBS1 mRNA CTD PMID:18927307 Khdrbs1 Rat ivermectin decreases expression ISO RGD:734416 6480464 Ivermectin results in decreased expression of KHDRBS1 protein CTD PMID:32959892 Khdrbs1 Rat menadione affects expression ISO RGD:734416 6480464 Vitamin K 3 affects the expression of KHDRBS1 mRNA CTD PMID:20044591 Khdrbs1 Rat methyl methanesulfonate increases expression ISO RGD:734416 6480464 Methyl Methanesulfonate results in increased expression of KHDRBS1 mRNA CTD PMID:23649840 Khdrbs1 Rat methylmercury chloride increases expression ISO RGD:734416 6480464 methylmercuric chloride results in increased expression of KHDRBS1 mRNA CTD PMID:28001369 Khdrbs1 Rat methylparaben increases expression ISO RGD:734416 6480464 methylparaben results in increased expression of KHDRBS1 mRNA CTD PMID:31745603 Khdrbs1 Rat miconazole decreases expression ISO RGD:734417 6480464 Miconazole results in decreased expression of KHDRBS1 mRNA CTD PMID:27462272 Khdrbs1 Rat nitrates multiple interactions ISO RGD:734417 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of KHDRBS1 more ... CTD PMID:35964746 Khdrbs1 Rat ozone increases expression EXP 6480464 Ozone results in increased expression of KHDRBS1 protein CTD PMID:33146391 Khdrbs1 Rat paracetamol affects expression ISO RGD:734417 6480464 Acetaminophen affects the expression of KHDRBS1 mRNA CTD PMID:17562736 Khdrbs1 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of KHDRBS1 mRNA CTD PMID:33387578 Khdrbs1 Rat paracetamol increases expression ISO RGD:734416 6480464 Acetaminophen results in increased expression of KHDRBS1 mRNA CTD PMID:21420995 Khdrbs1 Rat pentachlorophenol increases expression ISO RGD:734417 6480464 Pentachlorophenol results in increased expression of KHDRBS1 mRNA CTD PMID:23892564 Khdrbs1 Rat perfluorohexanesulfonic acid decreases expression ISO RGD:734417 6480464 perfluorohexanesulfonic acid results in decreased expression of KHDRBS1 mRNA CTD PMID:37995155 Khdrbs1 Rat perfluorooctanoic acid decreases expression ISO RGD:734416 6480464 perfluorooctanoic acid results in decreased expression of KHDRBS1 protein CTD PMID:26879310 Khdrbs1 Rat phenylmercury acetate increases expression ISO RGD:734416 6480464 Phenylmercuric Acetate results in increased expression of KHDRBS1 mRNA CTD PMID:26272509 Khdrbs1 Rat phenylmercury acetate multiple interactions ISO RGD:734416 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Khdrbs1 Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of KHDRBS1 mRNA CTD PMID:19162173 Khdrbs1 Rat potassium dichromate increases expression ISO RGD:734417 6480464 Potassium Dichromate results in increased expression of KHDRBS1 mRNA CTD PMID:23608068 Khdrbs1 Rat progesterone affects expression ISO RGD:734417 6480464 Progesterone affects the expression of KHDRBS1 mRNA CTD PMID:17251523 Khdrbs1 Rat resveratrol increases expression ISO RGD:734416 6480464 resveratrol results in increased expression of KHDRBS1 protein CTD PMID:18089832 Khdrbs1 Rat SB 431542 multiple interactions ISO RGD:734416 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Khdrbs1 Rat silicon dioxide increases expression ISO RGD:734416 6480464 Silicon Dioxide results in increased expression of KHDRBS1 mRNA CTD PMID:25351596 Khdrbs1 Rat sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of KHDRBS1 mRNA CTD PMID:19072884 Khdrbs1 Rat sodium arsenite decreases expression ISO RGD:734416 6480464 sodium arsenite results in decreased expression of KHDRBS1 mRNA CTD PMID:38568856 Khdrbs1 Rat sodium chloride multiple interactions ISO RGD:734416 6480464 [Sodium Chloride co-treated with pyrogallol 1,3-dimethyl ether] results in decreased expression of KHDRBS1 protein; [Sodium more ... CTD PMID:38598786 Khdrbs1 Rat titanium dioxide increases expression ISO RGD:734417 6480464 titanium dioxide results in increased expression of KHDRBS1 mRNA CTD PMID:23557971 Khdrbs1 Rat titanium dioxide decreases methylation ISO RGD:734417 6480464 titanium dioxide results in decreased methylation of KHDRBS1 gene; titanium dioxide results in decreased methylation more ... CTD PMID:35295148 Khdrbs1 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of KHDRBS1 mRNA CTD PMID:33387578 Khdrbs1 Rat trimellitic anhydride increases expression ISO RGD:734417 6480464 trimellitic anhydride results in increased expression of KHDRBS1 mRNA CTD PMID:19042947 Khdrbs1 Rat troglitazone decreases expression ISO RGD:734417 6480464 troglitazone results in decreased expression of KHDRBS1 mRNA CTD PMID:28973697 Khdrbs1 Rat valproic acid increases expression ISO RGD:734416 6480464 Valproic Acid results in increased expression of KHDRBS1 mRNA CTD PMID:28001369 Khdrbs1 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of KHDRBS1 mRNA CTD PMID:19015723 Khdrbs1 Rat vitamin E decreases expression ISO RGD:734416 6480464 Vitamin E results in decreased expression of KHDRBS1 mRNA CTD PMID:19244175
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
Khdrbs1 Rat identical protein binding enables IPI UniProtKB:Q91V33 1358238 PMID:15345239 UniProt Khdrbs1 Rat identical protein binding enables ISO RGD:734417 1624291 UniProtKB:Q60749 PMID:10077576, PMID:20211142 RGD PMID:10077576|PMID:20211142 Khdrbs1 Rat identical protein binding enables IEA UniProtKB:Q07666|ensembl:ENSP00000313829 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Khdrbs1 Rat identical protein binding enables IEA UniProtKB:Q60749|ensembl:ENSMUSP00000066516 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Khdrbs1 Rat identical protein binding enables ISO RGD:734416 1624291 UniProtKB:Q07666 PMID:10332027, PMID:10749975, PMID:20186123, PMID:22365833, PMID:24514149, PMID:31413325 RGD PMID:10332027|PMID:10749975|PMID:20186123|PMID:22365833|PMID:24514149|PMID:31413325 Khdrbs1 Rat molecular function inhibitor activity enables ISO RGD:734416 1624291 PMID:36537190 RGD PMID:36537190 Khdrbs1 Rat mRNA binding enables IBA FB:FBgn0264491|MGI:97837|PANTHER:PTN000129548|TAIR:locus:2064097|UniProtKB:Q96PU8|WB:WBGene00001595|ZFIN:ZDB-GENE-000210-25|ZFIN:ZDB-GENE-040426-1462|ZFIN:ZDB-GENE-040426-2344|ZFIN:ZDB-GENE-990415-230 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Khdrbs1 Rat nucleic acid binding enables IEA InterPro:IPR004087 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Khdrbs1 Rat poly(A) binding enables ISO RGD:734416 1624291 PMID:21984414 RGD PMID:21984414 Khdrbs1 Rat poly(A) binding enables IEA UniProtKB:Q07666|ensembl:ENSP00000313829 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Khdrbs1 Rat poly(A) binding enables IBA PANTHER:PTN002598463|UniProtKB:Q07666 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Khdrbs1 Rat poly(U) RNA binding enables ISO RGD:734416 1624291 PMID:21984414 RGD PMID:21984414 Khdrbs1 Rat poly(U) RNA binding enables IEA UniProtKB:Q07666|ensembl:ENSP00000313829 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Khdrbs1 Rat protein binding IPI RGD:1565256 2316827 RGD Khdrbs1 Rat protein binding enables ISO RGD:734416 1624291 UniProtKB:O75525|UniProtKB:O95365|UniProtKB:P06239|UniProtKB:P06240|UniProtKB:P06241|UniProtKB:P08631|UniProtKB:P09651|UniProtKB:P0DJD4|UniProtKB:P12931|UniProtKB:P15498|UniProtKB:P19174|UniProtKB:P23727|UniProtKB:P25054|UniProtKB:P38159|UniProtKB:P40763|UniProtKB:P51531|UniProtKB:P52333|UniProtKB:P61978|UniProtKB:P62993|UniProtKB:Q13882|UniProtKB:Q5VWX1 PMID:10332027, PMID:10749975, PMID:10913193, PMID:11278465, PMID:11585385, PMID:12029088, PMID:16107303, PMID:16169070, PMID:16341228, PMID:16888650, PMID:17141806, PMID:17371836, PMID:17855053, more ... RGD PMID:10332027|PMID:10749975|PMID:10913193|PMID:11278465|PMID:11585385|PMID:12029088|PMID:16107303|PMID:16169070|PMID:16341228|PMID:16888650|PMID:17141806|PMID:17371836|PMID:17855053|PMID:20186123|PMID:20936779|PMID:21706016|PMID:21988832|PMID:22000517|PMID:22365833|PMID:22641034|PMID:24514149|PMID:26496610|PMID:31413325|PMID:31980649|PMID:33961781|PMID:35271311|PMID:39251607|PMID:7537265|PMID:7852312|PMID:9045636 Khdrbs1 Rat protein binding enables IPI UniProtKB:Q63787 8553603 PMID:10437794 IntAct Khdrbs1 Rat protein binding enables IPI UniProtKB:Q96MU7 1358238 PMID:15345239 UniProt Khdrbs1 Rat protein binding enables IPI UniProtKB:Q15424 1358238 PMID:15345239 UniProt Khdrbs1 Rat protein binding enables ISO RGD:734417 1624291 UniProtKB:P10686|UniProtKB:P39688|UniProtKB:P45481|UniProtKB:Q60631|UniProtKB:Q9JIF0 PMID:10077576, PMID:12496368, PMID:12529443, PMID:15102471 RGD PMID:10077576|PMID:12496368|PMID:12529443|PMID:15102471 Khdrbs1 Rat protein binding IPI RGD:621706 634512 RGD Khdrbs1 Rat protein binding IPI RGD:3537 634064 RGD Khdrbs1 Rat protein domain specific binding enables ISO RGD:734416 1624291 UniProtKB:P0DJD4 PMID:10749975 RGD PMID:10749975 Khdrbs1 Rat protein domain specific binding enables IEA UniProtKB:Q07666|ensembl:ENSP00000313829 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Khdrbs1 Rat protein tyrosine kinase binding enables ISO RGD:734417 1624291 UniProtKB:P39688 PMID:7799925 RGD PMID:7799925 Khdrbs1 Rat protein tyrosine kinase binding enables IEA UniProtKB:Q60749|ensembl:ENSMUSP00000066516 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Khdrbs1 Rat protein tyrosine kinase binding enables IEA UniProtKB:Q07666|ensembl:ENSP00000313829 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Khdrbs1 Rat protein tyrosine kinase binding enables ISO RGD:734416 1624291 UniProtKB:P06239 PMID:9045636 RGD PMID:9045636 Khdrbs1 Rat protein-containing complex binding IDA 634064 RGD Khdrbs1 Rat RNA binding TAS 634064 RGD Khdrbs1 Rat RNA binding enables IEA InterPro:IPR036612 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Khdrbs1 Rat RNA binding enables IEA UniProtKB-KW:KW-0694 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Khdrbs1 Rat RNA binding enables IEA UniProtKB:Q07666|ensembl:ENSP00000313829 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Khdrbs1 Rat RNA binding enables ISO RGD:734416 1624291 PMID:1374686, PMID:36537190 RGD PMID:1374686|PMID:36537190 Khdrbs1 Rat RNA binding enables IEA UniProtKB:Q60749|ensembl:ENSMUSP00000066516 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Khdrbs1 Rat RNA binding enables ISO RGD:734417 1624291 PMID:9315629 RGD PMID:9315629 Khdrbs1 Rat RNA binding enables ISS UniProtKB:Q07666 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Khdrbs1 Rat SH2 domain binding enables ISO RGD:734416 1624291 PMID:9045636 RGD PMID:9045636 Khdrbs1 Rat SH2 domain binding enables IEA UniProtKB:Q07666|ensembl:ENSP00000313829 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Khdrbs1 Rat SH3 domain binding IDA 634064 RGD Khdrbs1 Rat SH3 domain binding enables IEA UniProtKB-KW:KW-0729 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Khdrbs1 Rat SH3 domain binding enables IEA UniProtKB:Q07666|ensembl:ENSP00000313829 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Khdrbs1 Rat SH3 domain binding enables ISO RGD:734416 1624291 PMID:9045636 RGD PMID:9045636 Khdrbs1 Rat signaling adaptor activity enables ISO RGD:734416 1624291 PMID:9045636 RGD PMID:9045636 Khdrbs1 Rat signaling adaptor activity enables IEA UniProtKB:Q07666|ensembl:ENSP00000313829 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Khdrbs1 Rat signaling adaptor activity enables ISO RGD:734417 1624291 PMID:7799925 RGD PMID:7799925 Khdrbs1 Rat signaling adaptor activity enables IEA UniProtKB:Q60749|ensembl:ENSMUSP00000066516 1600115 GO_REF:0000107 Ensembl GO_REF:0000107
1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (ISO) 2,4-dinitrotoluene (EXP) 2,6-dimethoxyphenol (ISO) 2,6-dinitrotoluene (EXP) 3,4-methylenedioxymethamphetamine (ISO) 3-chloropropane-1,2-diol (EXP) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) acrylamide (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) amitrole (EXP) Aroclor 1254 (ISO) arsenite(3-) (ISO) astragaloside IV (ISO) atrazine (ISO) benzatropine (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) buspirone (EXP) caffeine (ISO) carbamazepine (ISO) carbon nanotube (ISO) chloropicrin (ISO) chlorpyrifos (ISO) clobetasol (ISO) clozapine (ISO) cobalt dichloride (ISO) cocaine (EXP) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) coumarin (ISO) cyclosporin A (ISO) DDE (ISO) decabromodiphenyl ether (ISO) diethylstilbestrol (ISO) disodium selenite (ISO) dorsomorphin (ISO) enzyme inhibitor (ISO) ethyl methanesulfonate (ISO) flutamide (EXP) folic acid (ISO) gentamycin (EXP) geraniol (ISO) hexane (EXP) irinotecan (ISO) ivermectin (ISO) menadione (ISO) methyl methanesulfonate (ISO) methylmercury chloride (ISO) methylparaben (ISO) miconazole (ISO) nitrates (ISO) ozone (EXP) paracetamol (EXP,ISO) pentachlorophenol (ISO) perfluorohexanesulfonic acid (ISO) perfluorooctanoic acid (ISO) phenylmercury acetate (ISO) pirinixic acid (EXP) potassium dichromate (ISO) progesterone (ISO) resveratrol (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (EXP,ISO) sodium chloride (ISO) titanium dioxide (ISO) trichloroethene (EXP) trimellitic anhydride (ISO) troglitazone (ISO) valproic acid (ISO) vinclozolin (EXP) vitamin E (ISO)
Biological Process
cell surface receptor signaling pathway (IDA,IEA,ISO) G2/M transition of mitotic cell cycle (ISS) mRNA processing (IEA) negative regulation of DNA-templated transcription (ISS) negative regulation of transcription by RNA polymerase II (IEA,ISO) positive regulation of RNA export from nucleus (IEA,ISO,ISS) positive regulation of translational initiation (IEA,ISO,ISS) regulation of alternative mRNA splicing, via spliceosome (IBA,IDA,IEA,ISO,ISS) regulation of apoptotic process (IEA,ISO) regulation of cell cycle (IEA,ISO) regulation of mRNA splicing, via spliceosome (IEA,ISO) regulation of protein stability (ISO) regulation of RNA export from nucleus (IEA,ISO,ISS) regulation of RNA splicing (IEA,ISO) regulation of signal transduction (NAS) spermatogenesis (IEP) T cell receptor signaling pathway (IEA,ISO)
Molecular Function
identical protein binding (IEA,IPI,ISO) molecular function inhibitor activity (ISO) mRNA binding (IBA) nucleic acid binding (IEA) poly(A) binding (IBA,IEA,ISO) poly(U) RNA binding (IEA,ISO) protein binding (IPI,ISO) protein domain specific binding (IEA,ISO) protein tyrosine kinase binding (IEA,ISO) protein-containing complex binding (IDA) RNA binding (IEA,ISO,ISS,TAS) SH2 domain binding (IEA,ISO) SH3 domain binding (IDA,IEA,ISO) signaling adaptor activity (IEA,ISO)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
3.
The interaction and colocalization of Sam68 with the splicing-associated factor YT521-B in nuclear dots is regulated by the Src family kinase p59(fyn).
Hartmann AM, etal., Mol Biol Cell 1999 Nov;10(11):3909-26.
4.
Heterogeneous nuclear ribonucleoprotein G regulates splice site selection by binding to CC(A/C)-rich regions in pre-mRNA.
Heinrich B, etal., J Biol Chem. 2009 May 22;284(21):14303-15. Epub 2009 Mar 12.
5.
Effect of long-term exercise on gene expression of insulin signaling pathway intermediates in skeletal muscle.
Kim YB, etal., Biochem Biophys Res Commun 1999 Jan 27;254(3):720-7.
6.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
7.
Protein-tyrosine kinases regulate the phosphorylation, protein interactions, subcellular distribution, and activity of p21ras GTPase-activating protein.
Moran MF, etal., Mol Cell Biol. 1991 Apr;11(4):1804-12.
8.
Sam68 associates with the SH3 domains of Grb2 recruiting GAP to the Grb2-SOS complex in insulin receptor signaling.
Najib S and Sanchez-Margalet V, J Cell Biochem 2002;86(1):99-106.
9.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
10.
GOA pipeline
RGD automated data pipeline
11.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
12.
p68 Sam is a substrate of the insulin receptor and associates with the SH2 domains of p85 PI3K.
Sanchez-Margalet V and Najib S, FEBS Lett. 1999 Jul 23;455(3):307-10.
13.
Association of astragaloside IV-inhibited autophagy and mineralization in vascular smooth muscle cells with lncRNA H19 and DUSP5-mediated ERK signaling.
Song Z, etal., Toxicol Appl Pharmacol. 2019 Feb 1;364:45-54. doi: 10.1016/j.taap.2018.12.002. Epub 2018 Dec 5.
14.
p59(fyn)-mediated phosphorylation regulates the activity of the tissue-specific splicing factor rSLM-1.
Stoss O, etal., Mol Cell Neurosci 2004 Sep;27(1):8-21.
15.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
16.
T-STAR/ETOILE: a novel relative of SAM68 that interacts with an RNA-binding protein implicated in spermatogenesis.
Venables JP, etal., Hum Mol Genet. 1999 Jun;8(6):959-69.
Khdrbs1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 147,337,048 - 147,374,604 (-) NCBI GRCr8 mRatBN7.2 5 142,051,844 - 142,089,175 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 142,063,570 - 142,089,180 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 144,764,372 - 144,790,877 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 146,534,194 - 146,560,697 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 146,530,842 - 146,557,424 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 147,927,145 - 147,953,093 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 147,927,152 - 147,953,093 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 151,655,530 - 151,680,547 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 148,801,685 - 148,802,351 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 148,882,113 - 148,909,264 (-) NCBI Celera 5 140,536,987 - 140,562,345 (-) NCBI Celera Cytogenetic Map 5 q36 NCBI
KHDRBS1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 32,013,868 - 32,060,850 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 32,013,868 - 32,060,850 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 32,479,469 - 32,526,451 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 32,252,078 - 32,282,059 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 32,148,583 - 32,178,565 NCBI Celera 1 30,749,379 - 30,779,362 (+) NCBI Celera Cytogenetic Map 1 p35.2 NCBI HuRef 1 30,595,973 - 30,643,133 (+) NCBI HuRef CHM1_1 1 32,594,894 - 32,642,040 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 31,871,794 - 31,918,779 (+) NCBI T2T-CHM13v2.0
Khdrbs1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 129,596,143 - 129,637,402 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 129,596,957 - 129,636,096 (-) Ensembl GRCm39 Ensembl GRCm38 4 129,702,380 - 129,743,878 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 129,703,164 - 129,742,303 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 129,392,103 - 129,419,526 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 129,218,078 - 129,244,570 (-) NCBI MGSCv36 mm8 Celera 4 128,049,339 - 128,077,091 (-) NCBI Celera Cytogenetic Map 4 D2.2 NCBI cM Map 4 63.34 NCBI
Khdrbs1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955452 10,413,883 - 10,440,678 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955452 10,413,883 - 10,458,518 (+) NCBI ChiLan1.0 ChiLan1.0
KHDRBS1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 194,768,104 - 194,817,464 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 193,889,907 - 193,939,241 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 31,297,843 - 31,345,148 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 32,312,598 - 32,342,587 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 32,312,598 - 32,342,582 (+) Ensembl panpan1.1 panPan2
KHDRBS1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 69,108,822 - 69,148,067 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 69,123,663 - 69,148,073 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 65,689,332 - 65,728,750 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 69,675,445 - 69,714,910 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 69,689,360 - 69,714,870 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 66,511,546 - 66,550,990 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 67,507,703 - 67,547,145 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 68,506,957 - 68,546,417 (-) NCBI UU_Cfam_GSD_1.0
Khdrbs1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 49,264,153 - 49,292,459 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936474 15,088,816 - 15,118,310 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936474 15,088,815 - 15,131,048 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
KHDRBS1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 88,530,385 - 88,572,463 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 88,530,364 - 88,572,467 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 82,393,560 - 82,435,657 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
KHDRBS1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 100,831,307 - 100,859,609 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 100,832,461 - 100,859,630 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666033 15,832,445 - 15,860,835 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Khdrbs1
.
Predicted Target Of
Count of predictions: 507 Count of miRNA genes: 275 Interacting mature miRNAs: 320 Transcripts: ENSRNOT00000075270 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1331796 Thshl2 Thyroid stimulating hormone level QTL 2 2.3 blood thyroid-stimulating hormone amount (VT:0005119) serum thyroid stimulating hormone level (CMO:0001248) 5 97059760 147465714 Rat 10053720 Scort26 Serum corticosterone level QTL 26 2.06 0.0147 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 124965598 166875058 Rat 1549845 Scl44 Serum cholesterol level QTL 44 6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 40128307 148607290 Rat 8552960 Pigfal15 Plasma insulin-like growth factor 1 level QTL 15 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 111416838 156416838 Rat 631562 Apr2 Acute phase response QTL 2 3.7 blood murinoglobulin 1 amount (VT:0010597) plasma murinoglobulin 1 level (CMO:0001931) 5 135927956 166875058 Rat 61444 Strs2 Sensitivity to stroke QTL 2 4.7 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 5 135929696 166875058 Rat 61452 Ciaa5 CIA Autoantibody QTL 5 3.5 blood autoantibody amount (VT:0003725) calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281) 5 94858972 143070159 Rat 70156 Niddm30 Non-insulin dependent diabetes mellitus QTL 30 3.98 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 5 129132447 151006154 Rat 8552908 Pigfal4 Plasma insulin-like growth factor 1 level QTL 4 6.6 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 128506074 166875058 Rat 1331803 Rf32 Renal function QTL 32 2.798 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 5 129132428 143070159 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 7794791 Mcs33 Mammary carcinoma susceptibility QTL 33 1.93 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 5 131345754 166875058 Rat 7207486 Bss109 Bone structure and strength QTL 109 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 5 106906205 151906205 Rat 7207481 Bss106 Bone structure and strength QTL 106 7.9 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 106906205 151906205 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1598861 Cm64 Cardiac mass QTL 64 2.9 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 127798274 166875058 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 631505 Bp103 Blood pressure QTL 103 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 132717196 165560427 Rat 1549838 Bss4 Bone structure and strength QTL 4 9.2 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 5 106906205 151906205 Rat 1641920 Colcs1 Colorectal carcinoma susceptibility QTL 1 2.99 0.0055 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 5 121846814 166846814 Rat 8694169 Bw148 Body weight QTL 148 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 128506074 166875058 Rat 8657050 Bw146 Body weight QTL 146 19.84 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 108938288 153938288 Rat 1581510 Cm54 Cardiac mass QTL 54 3.4 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 5 120740824 143608494 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 2317056 Wbc3 White blood cell count QTL 3 2.51 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 5 105999803 150999803 Rat 634349 Bp139 Blood pressure QTL 139 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128924607 166875058 Rat 724525 Bp147 Blood pressure QTL 147 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 126424772 166875058 Rat 1598847 Cm62 Cardiac mass QTL 62 3.4 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 108845856 153845856 Rat 2293642 Bss37 Bone structure and strength QTL 37 4.64 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 120740824 151018848 Rat 1578673 Bmd13 Bone mineral density QTL 13 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 5 103689353 148689353 Rat 738018 Anxrr4 Anxiety related response QTL 4 5.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 5 130130159 166875058 Rat 7207488 Bss110 Bone structure and strength QTL 1 8.4 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 5 106906205 151906205 Rat 8694441 Bw169 Body weight QTL 169 17.61 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 5 111416838 156416838 Rat 7207491 Bss112 Bone structure and strength QTL 112 7 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 5 106906205 151906205 Rat 8694389 Bw160 Body weight QTL 160 6.17 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 5 111416838 156416838 Rat 61426 Scl2 Serum cholesterol level QTL 2 7.3 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 59793399 143070159 Rat 1354598 Srn6 Serum renin concentration QTL 6 3.8 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 5 69540295 151018848 Rat 8694198 Abfw3 Abdominal fat weight QTL 3 16.13 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 5 111416838 156416838 Rat 1298089 Scl14 Serum cholesterol level QTL 14 5.8 0.0004 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 108845856 153845856 Rat 1598819 Bp292 Blood pressure QTL 292 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 127798274 166875058 Rat 1358187 Emca1 Estrogen-induced mammary cancer QTL 1 4.4 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 5 99216724 148607142 Rat
BF396566
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 142,083,316 - 142,083,446 (+) MAPPER mRatBN7.2 Rnor_6.0 5 147,947,305 - 147,947,434 NCBI Rnor6.0 Rnor_5.0 5 151,674,759 - 151,674,888 UniSTS Rnor5.0 Celera 5 140,556,557 - 140,556,686 UniSTS RH 3.4 Map 5 960.31 UniSTS Cytogenetic Map 5 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000075270 ⟹ ENSRNOP00000066894
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 142,063,570 - 142,089,180 (-) Ensembl Rnor_6.0 Ensembl 5 147,927,152 - 147,953,093 (-) Ensembl
RefSeq Acc Id:
NM_130405 ⟹ NP_569089
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 147,347,904 - 147,373,448 (-) NCBI mRatBN7.2 5 142,063,559 - 142,089,106 (-) NCBI Rnor_6.0 5 147,927,145 - 147,953,093 (-) NCBI Rnor_5.0 5 151,655,530 - 151,680,547 (-) NCBI RGSC_v3.4 5 148,801,685 - 148,802,351 (+) RGD Celera 5 140,536,987 - 140,562,345 (-) RGD
Sequence:
GCCCTTTCCACCCCCGCCAACCGCCGCTCGGGCCTCAGCGCCGTCGCGTCGCTTCCTCGCTCGCTCGCCACACATCATTCCTGATGCAGCGCCGGGACGACCCTGCCGCGCGCCTCACCCGGTCCTCG
hide sequence
RefSeq Acc Id:
XR_005504357
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 147,337,048 - 147,374,604 (-) NCBI mRatBN7.2 5 142,051,844 - 142,089,175 (-) NCBI
RefSeq Acc Id:
NP_569089 ⟸ NM_130405
- UniProtKB:
Q91V33 (UniProtKB/Swiss-Prot), A6ISL8 (UniProtKB/TrEMBL)
- Sequence:
MQRRDDPAARLTRSSGRSCSKDPSGAHPSVRLTPSRPSPLPHRSRGGGGGPRGGARASPATQPPPLLPPSNPGPDATVVGSAPTPLLPPSATAAAKMEPENKYLPELMAEKDSLDPSFTHAMQLLSVE
hide sequence
Ensembl Acc Id:
ENSRNOP00000066894 ⟸ ENSRNOT00000075270
RGD ID: 13694076 Promoter ID: EPDNEW_R4601 Type: initiation region Name: Khdrbs1_1 Description: KH RNA binding domain containing, signal transduction associated1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 147,953,141 - 147,953,201 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-06-01
Khdrbs1
KH RNA binding domain containing, signal transduction associated 1
Khdrbs1
KH domain containing, RNA binding, signal transduction associated 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2015-07-29
Khdrbs1
KH domain containing, RNA binding, signal transduction associated 1
LOC100361306
KH domain-containing, RNA-binding, signal transduction-associated protein 1-like
Data merged from RGD:2320359
737654 PROVISIONAL
2010-05-05
LOC100361306
KH domain-containing, RNA-binding, signal transduction-associated protein 1-like
Symbol and Name status set to provisional
70820 PROVISIONAL
2006-03-30
Khdrbs1
KH domain containing, RNA binding, signal transduction associated 1
src associated in mitosis, 68 kDa
Name updated
1299863 APPROVED
2004-09-10
Khdrbs1
src associated in mitosis, 68 kDa
Sam68
Symbol and Name updated
1299863 APPROVED
2002-08-07
Sam68
src associated in mitosis, 68 kDa
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_cellular_localization
translocates from the nucleus to the cytoplasm
634064
gene_domains
contains Src homology (SH) 2 and 3 domain binding sites
634064
gene_physical_interaction
interacts with Grb2 via SH3 domains
634064
