Symbol:
Kcne3
Name:
potassium voltage-gated channel subfamily E regulatory subunit 3
RGD ID:
621384
Description:
Enables potassium channel regulator activity and transmembrane transporter binding activity. Involved in negative regulation of delayed rectifier potassium channel activity and positive regulation of voltage-gated calcium channel activity. Located in plasma membrane. Part of voltage-gated potassium channel complex. Human ortholog(s) of this gene implicated in Brugada syndrome 6 and hypokalemic periodic paralysis. Orthologous to human KCNE3 (potassium voltage-gated channel subfamily E regulatory subunit 3); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; all-trans-retinoic acid.
Type:
protein-coding (Ensembl: lncRNA)
RefSeq Status:
PROVISIONAL
Previously known as:
MGC105432; minimum potassium ion channel-related peptide 2; mink-related peptide 2; MiRP2; potassium channel subunit beta MiRP2; potassium channel, voltage gated subfamily E regulatory beta subunit 3; potassium channel, voltage-gated Isk-related subfamily E regulatory beta subunit 3; potassium voltage-gated channel subfamily E member 3; potassium voltage-gated channel, Isk-related family, member 3; potassium voltage-gated channel, Isk-related subfamily, gene 3; potassium voltage-gated channel, Isk-related subfamily, member 3
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
KCNE3 (potassium voltage-gated channel subfamily E regulatory subunit 3) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Kcne3 (potassium voltage-gated channel, Isk-related subfamily, gene 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Kcne3 (potassium voltage-gated channel subfamily E regulatory subunit 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
KCNE3 (potassium voltage-gated channel subfamily E regulatory subunit 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
KCNE3 (potassium voltage-gated channel subfamily E regulatory subunit 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Kcne3 (potassium voltage-gated channel subfamily E regulatory subunit 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
KCNE3 (potassium voltage-gated channel subfamily E regulatory subunit 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
KCNE3 (potassium voltage-gated channel subfamily E regulatory subunit 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Kcne3 (potassium voltage-gated channel subfamily E regulatory subunit 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Kcne3 (potassium voltage-gated channel, Isk-related subfamily, gene 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
KCNE3 (potassium voltage-gated channel subfamily E regulatory subunit 3)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
kcne3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 163,936,035 - 163,942,998 (+) NCBI GRCr8 mRatBN7.2 1 154,523,903 - 154,530,865 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 154,523,830 - 154,532,020 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 162,518,249 - 162,525,206 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 169,698,347 - 169,705,304 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 162,571,923 - 162,578,879 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 165,189,934 - 165,196,949 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 165,189,985 - 165,196,948 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 171,390,138 - 171,397,804 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 157,558,044 - 157,565,008 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 157,636,337 - 157,643,300 (+) NCBI Celera 1 152,607,926 - 152,614,889 (+) NCBI Celera Cytogenetic Map 1 q32 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Kcne3 Rat (1->4)-beta-D-glucan multiple interactions ISO Kcne3 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of KCNE3 mRNA CTD PMID:36331819 Kcne3 Rat 1,1-dichloroethene increases expression ISO Kcne3 (Mus musculus) 6480464 vinylidene chloride results in increased expression of KCNE3 mRNA CTD PMID:26682919 Kcne3 Rat 1,2-dichloroethane decreases expression ISO Kcne3 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of KCNE3 mRNA CTD PMID:28960355 Kcne3 Rat 1,2-dimethylhydrazine multiple interactions ISO Kcne3 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of KCNE3 mRNA CTD PMID:22206623 Kcne3 Rat 1,2-dimethylhydrazine decreases expression ISO Kcne3 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of KCNE3 mRNA CTD PMID:22206623 Kcne3 Rat 17beta-estradiol multiple interactions ISO KCNE3 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in decreased expression of KCNE3 mRNA CTD PMID:20660070 Kcne3 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of KCNE3 mRNA CTD PMID:19490992 Kcne3 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO KCNE3 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of KCNE3 mRNA CTD PMID:21632981 Kcne3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Kcne3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of KCNE3 mRNA CTD PMID:16467188 Kcne3 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Kcne3 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Kcne3 Rat 4,4'-sulfonyldiphenol increases expression ISO Kcne3 (Mus musculus) 6480464 bisphenol S results in increased expression of KCNE3 mRNA CTD PMID:30951980 Kcne3 Rat 4,4'-sulfonyldiphenol affects methylation ISO Kcne3 (Mus musculus) 6480464 bisphenol S affects the methylation of KCNE3 gene CTD PMID:31683443 Kcne3 Rat 4,4'-sulfonyldiphenol increases methylation ISO Kcne3 (Mus musculus) 6480464 bisphenol S results in increased methylation of KCNE3 exon and bisphenol S results in increased methylation of KCNE3 promoter CTD PMID:33297965 Kcne3 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of KCNE3 mRNA CTD PMID:30047161 Kcne3 Rat aflatoxin B1 increases methylation ISO KCNE3 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of KCNE3 gene CTD PMID:27153756 Kcne3 Rat all-trans-retinoic acid decreases expression EXP 6480464 Tretinoin results in decreased expression of KCNE3 mRNA CTD PMID:20488242 Kcne3 Rat all-trans-retinoic acid increases expression ISO KCNE3 (Homo sapiens) 6480464 Tretinoin results in increased expression of KCNE3 mRNA CTD PMID:33167477 Kcne3 Rat amiodarone increases expression ISO Kcne3 (Mus musculus) 6480464 Amiodarone results in increased expression of KCNE3 mRNA CTD PMID:15520326 Kcne3 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of KCNE3 mRNA CTD PMID:30047161 Kcne3 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of KCNE3 mRNA CTD PMID:16483693 Kcne3 Rat arsane affects methylation ISO KCNE3 (Homo sapiens) 6480464 Arsenic affects the methylation of KCNE3 gene CTD PMID:25304211 Kcne3 Rat arsenic atom affects methylation ISO KCNE3 (Homo sapiens) 6480464 Arsenic affects the methylation of KCNE3 gene CTD PMID:25304211 Kcne3 Rat Azoxymethane multiple interactions ISO Kcne3 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of KCNE3 mRNA CTD PMID:29950665 Kcne3 Rat benzo[a]pyrene increases expression ISO Kcne3 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of KCNE3 mRNA CTD PMID:21964900 Kcne3 Rat benzo[a]pyrene multiple interactions ISO Kcne3 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of KCNE3 mRNA CTD PMID:27858113 Kcne3 Rat benzo[b]fluoranthene multiple interactions ISO Kcne3 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of KCNE3 mRNA CTD PMID:27858113 Kcne3 Rat Benzo[ghi]perylene increases expression ISO Kcne3 (Mus musculus) 6480464 1 and 12-benzoperylene results in increased expression of KCNE3 mRNA CTD PMID:26377693 Kcne3 Rat beta-lapachone decreases expression ISO KCNE3 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of KCNE3 mRNA CTD PMID:38218311 Kcne3 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of KCNE3 mRNA CTD PMID:25181051 Kcne3 Rat bisphenol A increases expression ISO Kcne3 (Mus musculus) 6480464 bisphenol A results in increased expression of KCNE3 mRNA CTD PMID:32156529 Kcne3 Rat bisphenol A decreases methylation ISO KCNE3 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of KCNE3 gene CTD PMID:31601247 Kcne3 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of KCNE3 mRNA CTD PMID:32145629 Kcne3 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of KCNE3 mRNA CTD PMID:30816183 and PMID:32528016 Kcne3 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of KCNE3 gene CTD PMID:28505145 Kcne3 Rat bisphenol F decreases expression ISO Kcne3 (Mus musculus) 6480464 bisphenol F results in decreased expression of KCNE3 mRNA CTD PMID:38685157 Kcne3 Rat butanal decreases expression ISO KCNE3 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of KCNE3 mRNA CTD PMID:26079696 Kcne3 Rat cadmium dichloride increases expression ISO KCNE3 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of KCNE3 mRNA CTD PMID:38568856 Kcne3 Rat carbon nanotube decreases expression ISO Kcne3 (Mus musculus) 6480464 Nanotubes and Carbon analog results in decreased expression of KCNE3 mRNA CTD PMID:25620056 Kcne3 Rat carbon nanotube increases expression ISO Kcne3 (Mus musculus) 6480464 Nanotubes and Carbon analog results in increased expression of KCNE3 mRNA CTD PMID:25554681 Kcne3 Rat CGP 52608 multiple interactions ISO KCNE3 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to KCNE3 gene] CTD PMID:28238834 Kcne3 Rat chlorpyrifos increases expression ISO Kcne3 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of KCNE3 mRNA CTD PMID:32715474 Kcne3 Rat choline multiple interactions ISO Kcne3 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of KCNE3 mRNA CTD PMID:20938992 Kcne3 Rat Chromanol 293B multiple interactions ISO Kcne3 (Mus musculus) 6480464 6-cyano-4-(N-ethylsulfonyl-N-methylamino)-3-hydroxy-2 and 2-dimethylchromane inhibits the reaction [[KCNQ1 protein binds to KCNE3 protein] which affects the transport of Potassium] CTD PMID:11527966 Kcne3 Rat chrysene multiple interactions ISO Kcne3 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of KCNE3 mRNA CTD PMID:27858113 Kcne3 Rat cisplatin increases expression ISO KCNE3 (Homo sapiens) 6480464 Cisplatin results in increased expression of KCNE3 mRNA CTD PMID:27594783 Kcne3 Rat copper atom increases expression EXP 6480464 Copper results in increased expression of KCNE3 mRNA CTD PMID:30556269 Kcne3 Rat copper(0) increases expression EXP 6480464 Copper results in increased expression of KCNE3 mRNA CTD PMID:30556269 Kcne3 Rat cyclosporin A increases expression ISO KCNE3 (Homo sapiens) 6480464 Cyclosporine results in increased expression of KCNE3 mRNA CTD PMID:25562108 Kcne3 Rat decabromodiphenyl ether increases expression EXP 6480464 decabromobiphenyl ether results in increased expression of KCNE3 mRNA CTD PMID:23914054 Kcne3 Rat dextran sulfate multiple interactions ISO Kcne3 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of KCNE3 mRNA CTD PMID:29950665 Kcne3 Rat dibenz[a,h]anthracene increases expression ISO Kcne3 (Mus musculus) 6480464 1 more ... CTD PMID:26377693 Kcne3 Rat diethyl maleate decreases expression ISO Kcne3 (Mus musculus) 6480464 diethyl maleate results in decreased expression of KCNE3 mRNA CTD PMID:25270620 Kcne3 Rat dioxygen increases expression ISO Kcne3 (Mus musculus) 6480464 Oxygen deficiency results in increased expression of KCNE3 mRNA CTD PMID:20880076 Kcne3 Rat dorsomorphin multiple interactions ISO KCNE3 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Kcne3 Rat entinostat increases expression ISO KCNE3 (Homo sapiens) 6480464 entinostat results in increased expression of KCNE3 mRNA CTD PMID:26272509 Kcne3 Rat entinostat multiple interactions ISO KCNE3 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of KCNE3 mRNA CTD PMID:27188386 Kcne3 Rat etoposide decreases expression ISO Kcne3 (Mus musculus) 6480464 Etoposide results in decreased expression of KCNE3 mRNA CTD PMID:25270620 Kcne3 Rat folic acid multiple interactions ISO Kcne3 (Mus musculus) 6480464 [1 more ... CTD PMID:20938992 and PMID:22206623 Kcne3 Rat furan increases methylation EXP 6480464 furan results in increased methylation of KCNE3 gene CTD PMID:22079235 Kcne3 Rat furan increases expression EXP 6480464 furan results in increased expression of KCNE3 mRNA CTD PMID:27387713 Kcne3 Rat genistein decreases expression ISO KCNE3 (Homo sapiens) 6480464 Genistein results in decreased expression of KCNE3 mRNA CTD PMID:26865667 Kcne3 Rat genistein decreases expression ISO Kcne3 (Mus musculus) 6480464 Genistein results in decreased expression of KCNE3 mRNA CTD PMID:32186404 Kcne3 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of KCNE3 mRNA CTD PMID:33387578 Kcne3 Rat iron atom increases expression EXP 6480464 Iron deficiency results in increased expression of KCNE3 mRNA CTD PMID:16629162 Kcne3 Rat iron(0) increases expression EXP 6480464 Iron deficiency results in increased expression of KCNE3 mRNA CTD PMID:16629162 Kcne3 Rat L-methionine multiple interactions ISO Kcne3 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of KCNE3 mRNA CTD PMID:20938992 Kcne3 Rat leflunomide increases expression ISO KCNE3 (Homo sapiens) 6480464 leflunomide results in increased expression of KCNE3 mRNA CTD PMID:28988120 Kcne3 Rat leflunomide decreases expression ISO Kcne3 (Mus musculus) 6480464 leflunomide results in decreased expression of KCNE3 mRNA CTD PMID:19751817 Kcne3 Rat lipopolysaccharide multiple interactions ISO KCNE3 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine inhibits the reaction [Lipopolysaccharides results in decreased expression of KCNE3 mRNA] CTD PMID:35811015 Kcne3 Rat lipopolysaccharide decreases expression ISO KCNE3 (Homo sapiens) 6480464 Lipopolysaccharides results in decreased expression of KCNE3 mRNA CTD PMID:35811015 Kcne3 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of KCNE3 mRNA CTD PMID:30047161 Kcne3 Rat methylmercury chloride decreases expression ISO KCNE3 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of KCNE3 mRNA CTD PMID:28001369 Kcne3 Rat mitomycin C decreases expression ISO Kcne3 (Mus musculus) 6480464 Mitomycin results in decreased expression of KCNE3 mRNA CTD PMID:25270620 Kcne3 Rat ozone multiple interactions ISO Kcne3 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of KCNE3 mRNA CTD PMID:34911549 Kcne3 Rat paracetamol affects expression ISO Kcne3 (Mus musculus) 6480464 Acetaminophen affects the expression of KCNE3 mRNA CTD PMID:17562736 Kcne3 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of KCNE3 mRNA CTD PMID:33387578 Kcne3 Rat pentanal decreases expression ISO KCNE3 (Homo sapiens) 6480464 pentanal results in decreased expression of KCNE3 mRNA CTD PMID:26079696 Kcne3 Rat perfluorohexanesulfonic acid increases expression ISO Kcne3 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of KCNE3 mRNA CTD PMID:37995155 Kcne3 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Kcne3 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of KCNE3 mRNA CTD PMID:36331819 Kcne3 Rat phenylmercury acetate multiple interactions ISO KCNE3 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of KCNE3 mRNA CTD PMID:27188386 Kcne3 Rat pirinixic acid decreases expression ISO Kcne3 (Mus musculus) 6480464 pirinixic acid results in decreased expression of KCNE3 mRNA CTD PMID:17426115 Kcne3 Rat pirinixic acid increases expression ISO Kcne3 (Mus musculus) 6480464 pirinixic acid results in increased expression of KCNE3 mRNA CTD PMID:23811191 Kcne3 Rat potassium atom multiple interactions ISO Kcne3 (Mus musculus) 6480464 6-cyano-4-(N-ethylsulfonyl-N-methylamino)-3-hydroxy-2 more ... CTD PMID:11527966 Kcne3 Rat progesterone multiple interactions ISO KCNE3 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in decreased expression of KCNE3 mRNA CTD PMID:20660070 Kcne3 Rat progesterone decreases expression ISO Kcne3 (Mus musculus) 6480464 Progesterone results in decreased expression of KCNE3 mRNA CTD PMID:22238285 Kcne3 Rat protein kinase inhibitor multiple interactions ISO KCNE3 (Homo sapiens) 6480464 Protein Kinase Inhibitors inhibits the reaction [gardiquimod results in decreased expression of KCNE3 mRNA] CTD PMID:28003376 Kcne3 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO KCNE3 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine inhibits the reaction [Lipopolysaccharides results in decreased expression of KCNE3 mRNA] CTD PMID:35811015 Kcne3 Rat SB 431542 multiple interactions ISO KCNE3 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Kcne3 Rat silicon dioxide decreases expression ISO KCNE3 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of KCNE3 mRNA CTD PMID:25895662 Kcne3 Rat silicon dioxide increases expression EXP 6480464 Silicon Dioxide results in increased expression of KCNE3 mRNA CTD PMID:32721576 Kcne3 Rat sodium arsenite increases expression ISO KCNE3 (Homo sapiens) 6480464 sodium arsenite results in increased expression of KCNE3 mRNA CTD PMID:29301061 and PMID:38568856 Kcne3 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of KCNE3 mRNA CTD PMID:30047161 Kcne3 Rat tetraphene increases expression ISO Kcne3 (Mus musculus) 6480464 benz(a)anthracene results in increased expression of KCNE3 mRNA CTD PMID:26377693 Kcne3 Rat tetraphene multiple interactions ISO Kcne3 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of KCNE3 mRNA CTD PMID:27858113 Kcne3 Rat Theaflavin 3,3'-digallate affects expression ISO KCNE3 (Homo sapiens) 6480464 theaflavin-3 and 3'-digallate affects the expression of KCNE3 mRNA CTD PMID:34925699 Kcne3 Rat titanium dioxide decreases expression ISO Kcne3 (Mus musculus) 6480464 titanium dioxide results in decreased expression of KCNE3 mRNA CTD PMID:23557971 Kcne3 Rat titanium dioxide increases expression ISO Kcne3 (Mus musculus) 6480464 titanium dioxide results in increased expression of KCNE3 mRNA CTD PMID:35295148 Kcne3 Rat titanium dioxide multiple interactions ISO Kcne3 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of KCNE3 mRNA CTD PMID:29950665 Kcne3 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of KCNE3 mRNA CTD PMID:33387578 Kcne3 Rat triclosan increases expression ISO KCNE3 (Homo sapiens) 6480464 Triclosan results in increased expression of KCNE3 mRNA CTD PMID:30510588 Kcne3 Rat trovafloxacin decreases expression ISO Kcne3 (Mus musculus) 6480464 trovafloxacin results in decreased expression of KCNE3 mRNA CTD PMID:35537566 Kcne3 Rat urethane decreases expression ISO KCNE3 (Homo sapiens) 6480464 Urethane results in decreased expression of KCNE3 mRNA CTD PMID:28818685 Kcne3 Rat valproic acid increases expression ISO KCNE3 (Homo sapiens) 6480464 Valproic Acid results in increased expression of KCNE3 mRNA CTD PMID:28001369
(1->4)-beta-D-glucan (ISO) 1,1-dichloroethene (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (EXP,ISO) amiodarone (ISO) amitrole (EXP) ammonium chloride (EXP) arsane (ISO) arsenic atom (ISO) Azoxymethane (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) Benzo[ghi]perylene (ISO) beta-lapachone (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) butanal (ISO) cadmium dichloride (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chlorpyrifos (ISO) choline (ISO) Chromanol 293B (ISO) chrysene (ISO) cisplatin (ISO) copper atom (EXP) copper(0) (EXP) cyclosporin A (ISO) decabromodiphenyl ether (EXP) dextran sulfate (ISO) dibenz[a,h]anthracene (ISO) diethyl maleate (ISO) dioxygen (ISO) dorsomorphin (ISO) entinostat (ISO) etoposide (ISO) folic acid (ISO) furan (EXP) genistein (ISO) gentamycin (EXP) iron atom (EXP) iron(0) (EXP) L-methionine (ISO) leflunomide (ISO) lipopolysaccharide (ISO) methimazole (EXP) methylmercury chloride (ISO) mitomycin C (ISO) ozone (ISO) paracetamol (EXP,ISO) pentanal (ISO) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) phenylmercury acetate (ISO) pirinixic acid (ISO) potassium atom (ISO) progesterone (ISO) protein kinase inhibitor (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) silicon dioxide (EXP,ISO) sodium arsenite (ISO) sulfadimethoxine (EXP) tetraphene (ISO) Theaflavin 3,3'-digallate (ISO) titanium dioxide (ISO) trichloroethene (EXP) triclosan (ISO) trovafloxacin (ISO) urethane (ISO) valproic acid (ISO)
Cellular Component
basolateral part of cell (IEA,ISO) cell projection (IEA) cytoplasm (IEA,ISO,ISS) dendrite (IEA,ISO,ISS) membrane (IEA) membrane raft (IEA,ISO) neuronal cell body membrane (IEA,ISO,ISS) perikaryon (IEA,ISO,ISS) plasma membrane (IDA,IEA,ISO) vesicle (IEA,ISO,ISS) voltage-gated potassium channel complex (IBA,IDA,IEA,ISO)
1.
MiRP2 forms potassium channels in skeletal muscle with Kv3.4 and is associated with periodic paralysis.
Abbott GW, etal., Cell. 2001 Jan 26;104(2):217-31.
2.
Sexual dimorphism and oestrogen regulation of KCNE3 expression modulates the functional properties of KCNQ1 K(+) channels.
Alzamora R, etal., J Physiol. 2011 Nov 1;589(Pt 21):5091-107. doi: 10.1113/jphysiol.2011.215772. Epub 2011 Sep 12.
3.
Regulation and properties of KCNQ1 (K(V)LQT1) and impact of the cystic fibrosis transmembrane conductance regulator.
Boucherot A, etal., J Membr Biol 2001 Jul 1;182(1):39-47.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
MinK, MiRP1, and MiRP2 diversify Kv3.1 and Kv3.2 potassium channel gating.
Lewis A, etal., J Biol Chem. 2004 Feb 27;279(9):7884-92. Epub 2003 Dec 16.
6.
MinK-related peptide 2 modulates Kv2.1 and Kv3.1 potassium channels in mammalian brain.
McCrossan ZA, etal., J Neurosci. 2003 Sep 3;23(22):8077-91.
7.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
8.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
10.
GOA pipeline
RGD automated data pipeline
11.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
13.
Comprehensive gene review and curation
RGD comprehensive gene curation
Kcne3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 163,936,035 - 163,942,998 (+) NCBI GRCr8 mRatBN7.2 1 154,523,903 - 154,530,865 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 154,523,830 - 154,532,020 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 162,518,249 - 162,525,206 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 169,698,347 - 169,705,304 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 162,571,923 - 162,578,879 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 165,189,934 - 165,196,949 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 165,189,985 - 165,196,948 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 171,390,138 - 171,397,804 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 157,558,044 - 157,565,008 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 157,636,337 - 157,643,300 (+) NCBI Celera 1 152,607,926 - 152,614,889 (+) NCBI Celera Cytogenetic Map 1 q32 NCBI
KCNE3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 74,454,841 - 74,467,549 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 74,454,841 - 74,467,729 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 74,165,886 - 74,178,594 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 73,843,534 - 73,856,248 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 11 73,843,805 - 73,850,798 NCBI Celera 11 71,472,396 - 71,485,109 (-) NCBI Celera Cytogenetic Map 11 q13.4 NCBI HuRef 11 70,461,201 - 70,473,937 (-) NCBI HuRef CHM1_1 11 74,049,426 - 74,062,143 (-) NCBI CHM1_1 T2T-CHM13v2.0 11 74,384,260 - 74,396,980 (-) NCBI T2T-CHM13v2.0
Kcne3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 99,825,714 - 99,834,076 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 99,825,709 - 99,834,076 (+) Ensembl GRCm39 Ensembl GRCm38 7 100,176,507 - 100,184,869 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 100,176,502 - 100,184,869 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 107,327,207 - 107,333,374 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 100,052,780 - 100,058,947 (+) NCBI MGSCv36 mm8 Celera 7 100,513,245 - 100,519,198 (+) NCBI Celera Cytogenetic Map 7 E2 NCBI cM Map 7 54.33 NCBI
Kcne3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955414 17,166,546 - 17,200,353 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955414 17,166,537 - 17,200,385 (+) NCBI ChiLan1.0 ChiLan1.0
KCNE3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 75,396,558 - 75,409,080 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 76,440,593 - 76,453,426 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 69,527,663 - 69,540,236 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 72,832,858 - 72,845,399 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 72,835,048 - 72,835,359 (-) Ensembl panpan1.1 panPan2
KCNE3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 21 23,860,727 - 23,872,194 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 21 23,871,648 - 23,871,947 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 21 23,625,823 - 23,638,780 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 21 24,063,194 - 24,076,168 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 21 24,074,135 - 24,074,434 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 21 23,860,571 - 23,873,532 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 21 24,057,896 - 24,070,858 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 21 23,975,487 - 23,988,456 (+) NCBI UU_Cfam_GSD_1.0
Kcne3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 61,876,838 - 61,888,024 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936498 3,478,039 - 3,478,350 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936498 3,477,313 - 3,487,580 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
KCNE3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 9 8,810,720 - 8,822,494 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 9 8,810,716 - 8,822,191 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 9 9,649,248 - 9,660,859 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
KCNE3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 1 65,699,558 - 65,710,305 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 1 65,700,156 - 65,700,467 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666043 60,150,565 - 60,161,017 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Kcne3
.
Predicted Target Of
Count of predictions: 322 Count of miRNA genes: 202 Interacting mature miRNAs: 224 Transcripts: ENSRNOT00000048437 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
61442 Strs1 Sensitivity to stroke QTL 1 7.4 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 1 121767634 166767634 Rat 1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 1578654 Bss10 Bone structure and strength QTL 10 4 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 1 49393172 159356837 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 1598866 Bp287 Blood pressure QTL 287 5.1 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 121006655 166006655 Rat 1578770 Stresp23 Stress response QTL 23 kidney sympathetic nerve activity (VT:0004050) stimulated renal sympathetic nerve activity to basal renal sympathetic nerve activity ratio (CMO:0001786) 1 123350408 182418476 Rat 70160 Bw18 Body weight QTL 18 5.7 body mass (VT:0001259) body weight (CMO:0000012) 1 144267353 196383668 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 631199 Cm23 Cardiac mass QTL 23 4.6 0.0004 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 115585465 172949803 Rat 1354636 Lmblg1 Limb length QTL 1 6.4 tibia length (VT:0004357) tibia length (CMO:0000450) 1 151162512 201278233 Rat 1598850 Bp297 Blood pressure QTL 297 2.1 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 121006655 166006655 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 1598853 Memor3 Memory QTL 3 4.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 1 143506580 212458660 Rat 1354634 Kidm12 Kidney mass QTL 12 3.9 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 1 151162512 201278233 Rat 152025232 Bw192 Body weight QTL 192 3.93 body mass (VT:0001259) 1 117917486 196963478 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 61343 Bp28 Blood pressure QTL 28 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 151646613 196646613 Rat 724521 Uae1 Urinary albumin excretion QTL 1 3.8 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 90508614 173018436 Rat 1358902 Bw47 Body weight QTL 47 1.67 body mass (VT:0001259) body weight (CMO:0000012) 1 90508614 180359386 Rat 61348 Bp30 Blood pressure QTL 30 2.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 144017057 197814409 Rat 8655649 Arrd1 Age-related retinal degeneration QTL 1 4.89 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 100357752 183970443 Rat 7771612 Cm80 Cardiac mass QTL 80 8.4 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 1 149448574 221264292 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 631202 Gluco13 Glucose level QTL 13 0.0001 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 131763437 159756369 Rat 631205 Bp196 Blood pressure QTL 196 4 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118944897 199050459 Rat 1300158 Bp173 Blood pressure QTL 173 3.48 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 1 115540693 185145286 Rat 631206 Niddm40 Non-insulin dependent diabetes mellitus QTL 40 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 136745990 163747690 Rat 737828 Hcas3 Hepatocarcinoma susceptibility QTL 3 4.9 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 1 144267353 222987745 Rat 1331749 Hrtrt11 Heart rate QTL 11 2.973 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 94494440 198211706 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1358886 Bp260 Blood pressure QTL 260 3.67 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 151162766 225824951 Rat 1331751 Bp199 Blood pressure QTL 199 3.60022 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 94494440 181830018 Rat 9685799 Bp375 Blood pressure QTL 375 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 170611501 Rat 2293140 Bp313 Blood pressure QTL 313 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 121833674 166833674 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 9685802 Bp376 Blood pressure QTL 376 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 126540680 171540680 Rat 1641895 Bp298 Blood pressure QTL 298 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 123350408 182418476 Rat 70209 Niddm23 Non-insulin dependent diabetes mellitus QTL 23 2.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 94494440 198324465 Rat 634315 Niddm45 Non-insulin dependent diabetes mellitus QTL 45 7.16 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 144267916 172949660 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 61379 Bp44 Blood pressure QTL 44 19.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 144267916 174133260 Rat 1331793 Bp200 Blood pressure QTL 200 3.71601 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94494440 172949803 Rat 2313060 Bss71 Bone structure and strength QTL 71 2.6 0.0001 long bone metaphysis morphology trait (VT:0000133) tibia midshaft total cross-sectional area (CMO:0001715) 1 118944747 163944747 Rat 6893347 Bw98 Body weight QTL 98 0.2 0.53 body mass (VT:0001259) body weight (CMO:0000012) 1 133680936 178680936 Rat 1354591 Cm36 Cardiac mass QTL 36 4.1 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 102813953 201278233 Rat 724550 Thym3 Thymus enlargement QTL 3 7.82 0.001 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 136829932 181829932 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 71118 Thym1 Thymus enlargement QTL 1 10.17 0.001 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 136829932 181829932 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 631519 Pia11 Pristane induced arthritis QTL 11 5.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 1 136830018 181830018 Rat 6893361 Bw104 Body weight QTL 104 0.59 0.27 body mass (VT:0001259) body weight (CMO:0000012) 1 133680936 178680936 Rat 738006 Anxrr14 Anxiety related response QTL 14 4 0.00035 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 130636910 175636910 Rat 1558645 Bw55 Body weight QTL 55 3.2 0.004 body mass (VT:0001259) body weight (CMO:0000012) 1 133680936 178680936 Rat 1354615 Cm32 Cardiac mass QTL 32 5.2 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 102813953 201278233 Rat 634348 Bp138 Blood pressure QTL 138 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 168883176 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 738028 Anxrr12 Anxiety related response QTL 12 4.9 0.00001 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 130636910 175636910 Rat 1354620 Kidm19 Kidney mass QTL 19 4 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 201278233 Rat 8693608 Alc24 Alcohol consumption QTL 24 2.3 0.74 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 1 150452391 168228760 Rat 631654 Bp107 Blood pressure QTL 107 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 170611501 Rat 631544 Bp84 Blood pressure QTL 84 5.6 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350408 181759564 Rat 152025212 Bw190 Body weight QTL 190 5.7 body mass (VT:0001259) 1 123556856 196963478 Rat 631549 Bp89 Blood pressure QTL 89 5.7 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350581 201284552 Rat 1358189 Cstrr1 Cold stress response QTL 1 0.0001 catecholamine amount (VT:0010543) urine norepinephrine level (CMO:0001629) 1 123350408 182418476 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat 1354602 Bw35 Body weight QTL 35 12.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 201278233 Rat
AW533943
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 154,526,740 - 154,526,896 (+) MAPPER mRatBN7.2 Rnor_6.0 1 165,192,825 - 165,192,980 NCBI Rnor6.0 Rnor_5.0 1 171,393,680 - 171,393,835 UniSTS Rnor5.0 RGSC_v3.4 1 157,560,884 - 157,561,039 UniSTS RGSC3.4 Celera 1 152,610,765 - 152,610,920 UniSTS RH 3.4 Map 1 1255.2 UniSTS Cytogenetic Map 1 q32 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
111
90
89
58
25
58
6
217
97
91
45
56
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000048437 ⟹ ENSRNOP00000044706
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 154,523,830 - 154,532,020 (+) Ensembl Rnor_6.0 Ensembl 1 165,189,985 - 165,196,948 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000097656
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 154,523,876 - 154,532,020 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000106352
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 154,523,830 - 154,532,020 (+) Ensembl
RefSeq Acc Id:
NM_022235 ⟹ NP_071571
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 163,936,035 - 163,942,998 (+) NCBI mRatBN7.2 1 154,523,903 - 154,530,865 (+) NCBI Rnor_6.0 1 165,189,985 - 165,196,949 (+) NCBI Rnor_5.0 1 171,390,138 - 171,397,804 (+) NCBI RGSC_v3.4 1 157,558,044 - 157,565,008 (+) RGD Celera 1 152,607,926 - 152,614,889 (+) RGD
Sequence:
CACTGAGCGCCGCTGGGCATCACTGCAGTGCTCACCGGAGACAGATCGCAGAGTCAGATCACATTCCAGCTCTTCCCATACCTCGATTTCTGTTGCTATGGAGACTTCCAACGGGACTGAGACCTGGT
hide sequence
RefSeq Acc Id:
NP_071571 ⟸ NM_022235
- UniProtKB:
Q9JJV7 (UniProtKB/Swiss-Prot), A6I6L9 (UniProtKB/TrEMBL)
- Sequence:
METSNGTETWYKSLHAVLKALNTTLHSHLLCRPGPGPGSGTGPDNQTEDHRASLPGRNDNSYMYILFVMFLFAVTVGSLILGYTRSRKVDKRSDPYHVYIKNRVSMI
hide sequence
Ensembl Acc Id:
ENSRNOP00000044706 ⟸ ENSRNOT00000048437
RGD ID: 13690238 Promoter ID: EPDNEW_R761 Type: multiple initiation site Name: Kcne3_1 Description: potassium voltage-gated channel subfamily E regulatory subunit3 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 165,189,970 - 165,190,030 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-02-11
Kcne3
potassium voltage-gated channel subfamily E regulatory subunit 3
Kcne3
potassium channel, voltage gated subfamily E regulatory beta subunit 3
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2016-01-27
Kcne3
potassium channel, voltage gated subfamily E regulatory beta subunit 3
Kcne3
potassium channel, voltage-gated Isk-related subfamily E regulatory beta subunit 3
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2015-01-26
Kcne3
potassium channel, voltage-gated Isk-related subfamily E regulatory beta subunit 3
Kcne3
potassium voltage-gated channel, Isk-related family, member 3
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2011-04-29
Kcne3
potassium voltage-gated channel, Isk-related family, member 3
Kcne3
potassium voltage-gated channel, Isk-related subfamily, gene 3
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-02-22
Kcne3
potassium voltage-gated channel, Isk-related subfamily, gene 3
Kcne3
potassium voltage-gated channel, Isk-related subfamily, member 3
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-20
Kcne3
potassium voltage-gated channel, Isk-related subfamily, member 3
mink-related peptide 2
Name updated
1299863 APPROVED
2002-08-07
Kcne3
mink-related peptide 2
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_process
coexpression activates K+ currents
633042
