Symbol:
Ptgr1
Name:
prostaglandin reductase 1
RGD ID:
621195
Description:
Enables 15-oxoprostaglandin 13-oxidase [NAD(P)+] activity and 2-alkenal reductase (NADPH) activity. Involved in several processes, including leukotriene B4 metabolic process; negative regulation of reactive oxygen species biosynthetic process; and response to antineoplastic agent. Located in cytosol and nucleus. Biomarker of hypertension. Orthologous to human PTGR1 (prostaglandin reductase 1); INTERACTS WITH 1,2,4-trimethylbenzene; 1-penten-3-one; 15-dehydro-prostaglandin E2.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
15-oxoprostaglandin 13-reductase; D3T-inducible gene 1 protein; DIG-1; Dig1; dithiolethione-inducible gene 1 protein; dithiolethione-inducible gene-1; leukotriene B4 12-hydroxydehydrogenase; Ltb4dh; NAD(P)H-dependent alkenal/one oxidoreductase; NADP-dependent leukotriene B4 12-hydroxydehydrogenase; PRG-1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PTGR1 (prostaglandin reductase 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Ptgr1 (prostaglandin reductase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Ptgr1 (prostaglandin reductase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PTGR1 (prostaglandin reductase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PTGR1 (prostaglandin reductase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ptgr1 (prostaglandin reductase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PTGR1 (prostaglandin reductase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PTGR1 (prostaglandin reductase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Ptgr1 (prostaglandin reductase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
ASRGL1 (asparaginase and isoaspartyl peptidase 1) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
PTGR1 (prostaglandin reductase 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Ptgr1 (prostaglandin reductase 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ptgr1 (prostaglandin reductase 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
si:dkey-11k2.7
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
YML131W
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector)
Xenopus tropicalis (tropical clawed frog):
ptgr1.3
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
ptgr1.2
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 78,579,060 - 78,597,671 (-) NCBI GRCr8 mRatBN7.2 5 73,784,000 - 73,802,624 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 73,784,009 - 73,802,666 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 75,685,300 - 75,703,919 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 77,506,913 - 77,525,540 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 77,479,071 - 77,497,693 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 76,110,746 - 76,129,361 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 76,110,738 - 76,129,441 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 80,255,192 - 80,273,709 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 77,010,809 - 77,029,326 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 77,015,922 - 77,034,439 (-) NCBI Celera 5 72,607,043 - 72,625,264 (-) NCBI Celera Cytogenetic Map 5 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ptgr1 Rat (1->4)-beta-D-glucan multiple interactions ISO Ptgr1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PTGR1 mRNA CTD PMID:36331819 Ptgr1 Rat (E)-cinnamyl alcohol increases expression ISO PTGR1 (Homo sapiens) 6480464 cinnamyl alcohol results in increased expression of PTGR1 mRNA CTD PMID:20566472 Ptgr1 Rat 1,1-dichloroethene increases expression ISO Ptgr1 (Mus musculus) 6480464 vinylidene chloride results in increased expression of PTGR1 mRNA CTD PMID:26682919 Ptgr1 Rat 1,2,4-trimethylbenzene decreases expression EXP 6480464 pseudocumene results in decreased expression of PTGR1 protein CTD PMID:17337753 Ptgr1 Rat 1,2-dichloroethane decreases expression ISO Ptgr1 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of PTGR1 mRNA CTD PMID:28189721 and PMID:28960355 Ptgr1 Rat 1,2-dimethylhydrazine multiple interactions ISO Ptgr1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of PTGR1 mRNA CTD PMID:22206623 Ptgr1 Rat 1-chloro-2,4-dinitrobenzene increases expression ISO PTGR1 (Homo sapiens) 6480464 Dinitrochlorobenzene results in increased expression of PTGR1 mRNA CTD PMID:20566472 Ptgr1 Rat 1-Hydroxypyrene increases expression ISO PTGR1 (Homo sapiens) 6480464 1-hydroxypyrene results in increased expression of PTGR1 mRNA CTD PMID:21854004 Ptgr1 Rat 1-penten-3-one multiple interactions EXP 6480464 [PTGR1 protein co-treated with NADP] affects the reduction of 1-pentene-3-one CTD PMID:11524419 Ptgr1 Rat 13,14-dihydro-15-keto-PGF2alpha multiple interactions ISO PTGR1 (Homo sapiens) 6480464 [PTGR1 protein results in increased metabolism of 15-ketoprostaglandin F2alpha] which results in increased abundance of 15-keto-13 and 14-dihydroprostaglandin F2alpha CTD PMID:25619643 Ptgr1 Rat 13,14-dihydro-15-keto-PGF2alpha increases abundance ISO PTGR1 (Homo sapiens) 6480464 PTGR1 protein results in increased abundance of 15-keto-13 and 14-dihydroprostaglandin F2alpha CTD PMID:25619643 Ptgr1 Rat 13,14-dihydro-15-oxo-prostaglandin E2 increases abundance ISO PTGR1 (Homo sapiens) 6480464 PTGR1 protein results in increased abundance of 15-keto-13 and 14-dihydroprostaglandin E2 CTD PMID:25619643 Ptgr1 Rat 13,14-dihydro-15-oxo-prostaglandin E2 multiple interactions ISO PTGR1 (Homo sapiens) 6480464 [PTGR1 protein results in increased metabolism of 15-ketoprostaglandin E2] which results in increased abundance of 15-keto-13 and 14-dihydroprostaglandin E2 CTD PMID:25619643 Ptgr1 Rat 13,14-dihydro-15-oxoprostaglandin E1 multiple interactions ISO PTGR1 (Homo sapiens) 6480464 [PTGR1 protein results in increased metabolism of 15-ketoprostaglandin E] which results in increased abundance of 13 and 14-dihydro-15-ketoprostaglandin E1 CTD PMID:25619643 Ptgr1 Rat 13,14-dihydro-15-oxoprostaglandin E1 increases abundance ISO PTGR1 (Homo sapiens) 6480464 PTGR1 protein results in increased abundance of 13 and 14-dihydro-15-ketoprostaglandin E1 CTD PMID:25619643 Ptgr1 Rat 15-dehydro-prostaglandin E2 multiple interactions EXP 6480464 15-ketoprostaglandin E2 inhibits the reaction [PTGR1 protein results in increased reduction of 10-nitro-oleic acid analog] more ... CTD PMID:23878198 Ptgr1 Rat 15-dehydro-prostaglandin E2 multiple interactions ISO PTGR1 (Homo sapiens) 6480464 [PTGR1 protein results in increased metabolism of 15-ketoprostaglandin E2] which results in increased abundance of 15-keto-13 and 14-dihydroprostaglandin E2 CTD PMID:25619643 Ptgr1 Rat 15-dehydro-prostaglandin E2 increases metabolic processing ISO PTGR1 (Homo sapiens) 6480464 PTGR1 protein results in increased metabolism of 15-ketoprostaglandin E2 CTD PMID:25619643 Ptgr1 Rat 15-dehydro-prostaglandin E2 increases reduction EXP 6480464 PTGR1 protein results in increased reduction of 15-ketoprostaglandin E2 CTD PMID:23878198 Ptgr1 Rat 15-oxoprostaglandin F2alpha increases metabolic processing ISO PTGR1 (Homo sapiens) 6480464 PTGR1 protein results in increased metabolism of 15-ketoprostaglandin F2alpha CTD PMID:25619643 Ptgr1 Rat 15-oxoprostaglandin F2alpha multiple interactions ISO PTGR1 (Homo sapiens) 6480464 [PTGR1 protein results in increased metabolism of 15-ketoprostaglandin F2alpha] which results in increased abundance of 15-keto-13 and 14-dihydroprostaglandin F2alpha CTD PMID:25619643 Ptgr1 Rat 17alpha-ethynylestradiol multiple interactions ISO Ptgr1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PTGR1 mRNA CTD PMID:17942748 Ptgr1 Rat 17beta-estradiol multiple interactions ISO PTGR1 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in decreased expression of PTGR1 mRNA CTD PMID:20660070 Ptgr1 Rat 2,2',4,4',5,5'-hexachlorobiphenyl increases expression ISO PTGR1 (Homo sapiens) 6480464 2 more ... CTD PMID:38568856 Ptgr1 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO PTGR1 (Homo sapiens) 6480464 2 more ... CTD PMID:19095052 Ptgr1 Rat 2,2',5,5'-tetrachlorobiphenyl decreases expression EXP 6480464 2 more ... CTD PMID:23829299 Ptgr1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PTGR1 mRNA CTD PMID:18796159 and PMID:21215274 Ptgr1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Ptgr1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of PTGR1 mRNA CTD PMID:19770486 Ptgr1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Ptgr1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PTGR1 mRNA CTD PMID:17942748 Ptgr1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Ptgr1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PTGR1 mRNA CTD PMID:20702594 more ... Ptgr1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PTGR1 mRNA CTD PMID:20558275 and PMID:33387578 Ptgr1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO PTGR1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of PTGR1 mRNA CTD PMID:20106945 and PMID:21632981 Ptgr1 Rat 2,3,7,8-Tetrachlorodibenzofuran affects expression ISO Ptgr1 (Mus musculus) 6480464 2 more ... CTD PMID:20702594 Ptgr1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Ptgr1 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Ptgr1 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of PTGR1 mRNA CTD PMID:21346803 Ptgr1 Rat 2,4-Nonadienal multiple interactions EXP 6480464 [PTGR1 protein co-treated with NADP] affects the reduction of 2 and 4-nonadienal CTD PMID:11524419 Ptgr1 Rat 2-acetamidofluorene multiple interactions EXP 6480464 [2-Acetylaminofluorene co-treated with Diethylnitrosamine] results in increased expression of PTGR1 mRNA CTD PMID:16158176 Ptgr1 Rat 2-butoxyethanol decreases expression ISO Ptgr1 (Mus musculus) 6480464 n-butoxyethanol results in decreased expression of PTGR1 mRNA CTD PMID:19812364 Ptgr1 Rat 2-hexenal multiple interactions EXP 6480464 [PTGR1 protein co-treated with NADP] affects the reduction of 2-hexenal CTD PMID:11524419 Ptgr1 Rat 2-hydroxypropanoic acid increases expression ISO PTGR1 (Homo sapiens) 6480464 Lactic Acid results in increased expression of PTGR1 mRNA CTD PMID:20566472 Ptgr1 Rat 2-hydroxypropanoic acid decreases expression ISO PTGR1 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of PTGR1 mRNA CTD PMID:30851411 Ptgr1 Rat 2-pentenal multiple interactions EXP 6480464 [PTGR1 protein co-treated with NADP] affects the reduction of 2-pentenal CTD PMID:11524419 Ptgr1 Rat 2-tert-butylhydroquinone increases expression ISO Ptgr1 (Mus musculus) 6480464 2-tert-butylhydroquinone results in increased expression of PTGR1 mRNA CTD PMID:16014739 Ptgr1 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of PTGR1 protein CTD PMID:34915118 Ptgr1 Rat 3-phenylprop-2-enal multiple interactions EXP 6480464 [PTGR1 protein co-treated with NADP] affects the reduction of cinnamaldehyde CTD PMID:11524419 Ptgr1 Rat 3H-1,2-dithiole-3-thione multiple interactions ISO PTGR1 (Homo sapiens) 6480464 1 and 2-dithiol-3-thione results in increased expression of and results in increased activity of PTGR1 protein CTD PMID:25179160 Ptgr1 Rat 3H-1,2-dithiole-3-thione increases expression EXP 632607 1 and 2-dithiole-3-thione increases expression of Ptgr1 mRNA in the liver RGD Ptgr1 Rat 4,4'-sulfonyldiphenol increases expression ISO Ptgr1 (Mus musculus) 6480464 bisphenol S results in increased expression of PTGR1 mRNA CTD PMID:30951980 Ptgr1 Rat 4,4'-sulfonyldiphenol increases methylation ISO Ptgr1 (Mus musculus) 6480464 bisphenol S results in increased methylation of PTGR1 promoter CTD PMID:33297965 Ptgr1 Rat 4-hydroxyhexenal multiple interactions EXP 6480464 [PTGR1 protein co-treated with NADP] affects the reduction of 4-hydroxy-2-hexenal CTD PMID:11524419 Ptgr1 Rat 4-hydroxynon-2-enal multiple interactions EXP 6480464 [PTGR1 protein co-treated with NADP] affects the reduction of 4-hydroxy-2-nonenal CTD PMID:11524419 Ptgr1 Rat 4-hydroxynon-2-enal decreases response to substance EXP 6480464 PTGR1 protein results in decreased susceptibility to 4-hydroxy-2-nonenal CTD PMID:11524419 Ptgr1 Rat 4-hydroxyphenyl retinamide increases expression ISO Ptgr1 (Mus musculus) 6480464 Fenretinide results in increased expression of PTGR1 mRNA CTD PMID:28973697 Ptgr1 Rat 4-hydroxyphenyl retinamide decreases expression ISO Ptgr1 (Mus musculus) 6480464 Fenretinide results in decreased expression of PTGR1 mRNA CTD PMID:28973697 Ptgr1 Rat 5-aza-2'-deoxycytidine affects expression ISO PTGR1 (Homo sapiens) 6480464 Decitabine affects the expression of PTGR1 mRNA CTD PMID:23300844 Ptgr1 Rat 5-fluorouracil increases expression ISO PTGR1 (Homo sapiens) 6480464 Fluorouracil results in increased expression of PTGR1 protein CTD PMID:15585135 and PMID:16803524 Ptgr1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of PTGR1 mRNA CTD PMID:24780913 Ptgr1 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of PTGR1 mRNA CTD PMID:31881176 Ptgr1 Rat acrolein multiple interactions EXP 6480464 [PTGR1 protein co-treated with NADP] affects the reduction of Acrolein CTD PMID:11524419 Ptgr1 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of PTGR1 mRNA CTD PMID:23630614 and PMID:25378103 Ptgr1 Rat alachlor increases expression EXP 6480464 alachlor results in increased expression of PTGR1 mRNA CTD PMID:12419858 Ptgr1 Rat all-trans-retinoic acid decreases expression ISO PTGR1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of PTGR1 mRNA CTD PMID:33167477 Ptgr1 Rat all-trans-retinoic acid increases expression ISO PTGR1 (Homo sapiens) 6480464 Tretinoin results in increased expression of PTGR1 mRNA CTD PMID:23724009 Ptgr1 Rat alpha-hexylcinnamaldehyde increases expression ISO PTGR1 (Homo sapiens) 6480464 hexyl cinnamic aldehyde results in increased expression of PTGR1 mRNA CTD PMID:20566472 Ptgr1 Rat amiodarone increases expression ISO PTGR1 (Homo sapiens) 6480464 Amiodarone results in increased expression of PTGR1 mRNA CTD PMID:19774075 Ptgr1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PTGR1 mRNA CTD PMID:16483693 Ptgr1 Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of PTGR1 mRNA CTD PMID:30779732 Ptgr1 Rat ampicillin decreases expression ISO PTGR1 (Homo sapiens) 6480464 Ampicillin results in decreased expression of PTGR1 mRNA CTD PMID:21632981 Ptgr1 Rat andrographolide multiple interactions ISO Ptgr1 (Mus musculus) 6480464 [andrographolide co-treated with beta-Naphthoflavone] results in increased expression of PTGR1 mRNA CTD PMID:19737545 Ptgr1 Rat aristolochic acid A increases expression ISO PTGR1 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of PTGR1 mRNA and aristolochic acid I results in increased expression of PTGR1 protein CTD PMID:33212167 Ptgr1 Rat arsenite(3-) multiple interactions ISO PTGR1 (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to PTGR1 mRNA] CTD PMID:32406909 Ptgr1 Rat arsenous acid increases expression ISO PTGR1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of PTGR1 mRNA CTD PMID:20458559 and PMID:22521957 Ptgr1 Rat azathioprine increases expression ISO PTGR1 (Homo sapiens) 6480464 Azathioprine results in increased expression of PTGR1 mRNA CTD PMID:22623647 Ptgr1 Rat Azoxymethane multiple interactions ISO Ptgr1 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of PTGR1 mRNA CTD PMID:29950665 Ptgr1 Rat Bandrowski's base increases expression ISO PTGR1 (Homo sapiens) 6480464 Bandrowski's base results in increased expression of PTGR1 mRNA CTD PMID:20566472 Ptgr1 Rat benzo[a]pyrene increases expression ISO Ptgr1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of PTGR1 mRNA CTD PMID:19770486 and PMID:21715664 Ptgr1 Rat benzo[a]pyrene decreases expression ISO PTGR1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of PTGR1 mRNA CTD PMID:32234424 Ptgr1 Rat benzo[a]pyrene increases methylation ISO PTGR1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of PTGR1 promoter CTD PMID:27901495 Ptgr1 Rat benzo[a]pyrene increases methylation ISO Ptgr1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased methylation of PTGR1 promoter CTD PMID:27901495 Ptgr1 Rat benzo[a]pyrene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with 1 more ... CTD PMID:18711122 Ptgr1 Rat benzo[a]pyrene affects expression ISO PTGR1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the expression of PTGR1 mRNA CTD PMID:21714911 Ptgr1 Rat benzo[a]pyrene increases expression ISO PTGR1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of PTGR1 mRNA and Benzo(a)pyrene results in increased expression of PTGR1 protein CTD PMID:20064835 more ... Ptgr1 Rat benzo[a]pyrene diol epoxide I decreases expression ISO PTGR1 (Homo sapiens) 6480464 7 more ... CTD PMID:20018196 Ptgr1 Rat benzo[b]fluoranthene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with benzo(b)fluoranthene] affects the expression of PTGR1 mRNA CTD PMID:18711122 Ptgr1 Rat benzo[b]fluoranthene increases expression ISO Ptgr1 (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of PTGR1 mRNA CTD PMID:26377693 Ptgr1 Rat benzoic acid increases expression ISO PTGR1 (Homo sapiens) 6480464 Benzoic Acid results in increased expression of PTGR1 mRNA CTD PMID:20566472 Ptgr1 Rat benzylideneacetone multiple interactions EXP 6480464 [PTGR1 protein co-treated with NADP] affects the reduction of benzylideneacetone CTD PMID:11524419 Ptgr1 Rat beta-lapachone increases expression ISO PTGR1 (Homo sapiens) 6480464 beta-lapachone results in increased expression of PTGR1 mRNA CTD PMID:38218311 Ptgr1 Rat beta-naphthoflavone multiple interactions ISO Ptgr1 (Mus musculus) 6480464 [andrographolide co-treated with beta-Naphthoflavone] results in increased expression of PTGR1 mRNA CTD PMID:19737545 Ptgr1 Rat bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of PTGR1 mRNA CTD PMID:31199487 Ptgr1 Rat bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of PTGR1 mRNA CTD PMID:33789034 Ptgr1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Testosterone] results in decreased expression of PTGR1 mRNA CTD PMID:26496021 Ptgr1 Rat bisphenol A decreases expression ISO PTGR1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of PTGR1 protein CTD PMID:34186270 Ptgr1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PTGR1 mRNA CTD PMID:32145629 and PMID:34947998 Ptgr1 Rat bisphenol A affects expression ISO PTGR1 (Homo sapiens) 6480464 bisphenol A affects the expression of PTGR1 mRNA CTD PMID:30903817 Ptgr1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of PTGR1 mRNA CTD PMID:25181051 Ptgr1 Rat bisphenol F increases expression ISO Ptgr1 (Mus musculus) 6480464 bisphenol F results in increased expression of PTGR1 mRNA CTD PMID:30951980 Ptgr1 Rat bisphenol F increases expression ISO PTGR1 (Homo sapiens) 6480464 bisphenol F results in increased expression of PTGR1 protein CTD PMID:34186270 Ptgr1 Rat buten-2-one multiple interactions EXP 6480464 [PTGR1 protein co-treated with NADP] affects the reduction of 3-buten-2-one CTD PMID:11524419 Ptgr1 Rat Butylbenzyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of PTGR1 mRNA CTD PMID:31199487 Ptgr1 Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of PTGR1 mRNA CTD PMID:19167457 Ptgr1 Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of PTGR1 mRNA CTD PMID:25993096 Ptgr1 Rat cadmium dichloride increases expression ISO Ptgr1 (Mus musculus) 6480464 Cadmium Chloride results in increased expression of PTGR1 mRNA CTD PMID:20883709 Ptgr1 Rat cadmium dichloride increases expression ISO PTGR1 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of PTGR1 mRNA CTD PMID:26472689 Ptgr1 Rat cadmium sulfate multiple interactions ISO PTGR1 (Homo sapiens) 6480464 [cadmium sulfate co-treated with cobaltous chloride co-treated with lead chloride] results in increased expression of PTGR1 mRNA CTD PMID:18654764 Ptgr1 Rat caffeine decreases expression EXP 6480464 Caffeine results in decreased expression of PTGR1 mRNA CTD PMID:25868845 Ptgr1 Rat calycosin increases expression ISO PTGR1 (Homo sapiens) 401959214 [Calycosin cotreated with gallic acid] increases expression of PTGR1 mRNA in hepatocellular carcinoma cells RGD Ptgr1 Rat cannabidiol increases expression ISO PTGR1 (Homo sapiens) 6480464 Cannabidiol results in increased expression of PTGR1 mRNA CTD PMID:31518892 Ptgr1 Rat carbamazepine affects expression ISO PTGR1 (Homo sapiens) 6480464 Carbamazepine affects the expression of PTGR1 mRNA CTD PMID:25979313 Ptgr1 Rat carbon nanotube decreases expression ISO Ptgr1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Ptgr1 Rat cefaloridine increases expression EXP 6480464 Cephaloridine results in increased expression of PTGR1 mRNA CTD PMID:18500788 Ptgr1 Rat chalcone multiple interactions EXP 6480464 [PTGR1 protein co-treated with NADP] affects the reduction of Chalcone CTD PMID:11524419 Ptgr1 Rat chloropicrin increases expression ISO PTGR1 (Homo sapiens) 6480464 chloropicrin results in increased expression of PTGR1 mRNA CTD PMID:26352163 Ptgr1 Rat choline multiple interactions ISO Ptgr1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of PTGR1 mRNA CTD PMID:20938992 Ptgr1 Rat chromium(6+) affects expression ISO Ptgr1 (Mus musculus) 6480464 chromium hexavalent ion affects the expression of PTGR1 mRNA CTD PMID:28472532 Ptgr1 Rat cinnamyl alcohol increases expression ISO PTGR1 (Homo sapiens) 6480464 cinnamyl alcohol results in increased expression of PTGR1 mRNA CTD PMID:20566472 Ptgr1 Rat cisplatin increases expression ISO Ptgr1 (Mus musculus) 6480464 Cisplatin results in increased expression of PTGR1 mRNA CTD PMID:21151649 Ptgr1 Rat cisplatin multiple interactions ISO PTGR1 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of PTGR1 mRNA CTD PMID:27392435 Ptgr1 Rat cisplatin affects expression ISO PTGR1 (Homo sapiens) 6480464 Cisplatin affects the expression of PTGR1 mRNA CTD PMID:23300844 Ptgr1 Rat cobalt dichloride multiple interactions ISO PTGR1 (Homo sapiens) 6480464 [cadmium sulfate co-treated with cobaltous chloride co-treated with lead chloride] results in increased expression of PTGR1 mRNA CTD PMID:18654764 Ptgr1 Rat cobalt dichloride increases expression ISO PTGR1 (Homo sapiens) 6480464 cobaltous chloride results in increased expression of PTGR1 mRNA CTD PMID:19320972 Ptgr1 Rat cobalt dichloride increases expression EXP 6480464 cobaltous chloride results in increased expression of PTGR1 mRNA CTD PMID:24386269 Ptgr1 Rat copper atom multiple interactions ISO PTGR1 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of PTGR1 mRNA CTD PMID:20971185 Ptgr1 Rat copper(0) multiple interactions ISO PTGR1 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of PTGR1 mRNA CTD PMID:20971185 Ptgr1 Rat copper(II) chloride increases expression ISO PTGR1 (Homo sapiens) 6480464 cupric chloride results in increased expression of PTGR1 mRNA CTD PMID:38568856 Ptgr1 Rat copper(II) sulfate increases expression ISO PTGR1 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of PTGR1 mRNA CTD PMID:19549813 Ptgr1 Rat coumarin increases expression EXP 6480464 coumarin results in increased expression of PTGR1 mRNA CTD PMID:18480146 Ptgr1 Rat crocidolite asbestos decreases expression ISO Ptgr1 (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of PTGR1 mRNA CTD PMID:29279043 Ptgr1 Rat crotonaldehyde multiple interactions EXP 6480464 [PTGR1 protein co-treated with NADP] affects the reduction of 2-butenal CTD PMID:11524419 Ptgr1 Rat cyclosporin A increases expression ISO PTGR1 (Homo sapiens) 6480464 Cyclosporine results in increased expression of PTGR1 mRNA CTD PMID:25562108 Ptgr1 Rat cyclosporin A decreases expression ISO Ptgr1 (Mus musculus) 6480464 Cyclosporine results in decreased expression of PTGR1 mRNA CTD PMID:19770486 Ptgr1 Rat cyclosporin A decreases expression ISO PTGR1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of PTGR1 mRNA CTD PMID:20106945 Ptgr1 Rat dexamethasone multiple interactions EXP 6480464 Dexamethasone inhibits the reaction [sephadex results in increased expression of PTGR1 protein] CTD PMID:25878373 Ptgr1 Rat dexamethasone decreases expression EXP 6480464 Dexamethasone results in decreased expression of PTGR1 mRNA CTD PMID:14618091 Ptgr1 Rat dextran sulfate multiple interactions ISO Ptgr1 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of PTGR1 mRNA CTD PMID:29950665 Ptgr1 Rat diarsenic trioxide increases expression ISO PTGR1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of PTGR1 mRNA CTD PMID:20458559 and PMID:22521957 Ptgr1 Rat dibenz[a,h]anthracene multiple interactions EXP 6480464 [1 more ... CTD PMID:18711122 Ptgr1 Rat dibenzo[a,l]pyrene multiple interactions EXP 6480464 [1 more ... CTD PMID:18711122 Ptgr1 Rat dibenzoylmethane multiple interactions ISO Ptgr1 (Mus musculus) 6480464 [sulforaphane co-treated with dibenzoylmethane] results in increased expression of PTGR1 mRNA CTD PMID:17942926 Ptgr1 Rat dibutyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of PTGR1 mRNA CTD PMID:31199487 Ptgr1 Rat diclofenac decreases activity ISO PTGR1 (Homo sapiens) 6480464 Diclofenac results in decreased activity of PTGR1 protein CTD PMID:25619643 Ptgr1 Rat diethyl maleate increases expression ISO Ptgr1 (Mus musculus) 6480464 diethyl maleate results in increased expression of PTGR1 mRNA CTD PMID:25270620 Ptgr1 Rat diethyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of PTGR1 mRNA CTD PMID:31199487 Ptgr1 Rat diisobutyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of PTGR1 mRNA CTD PMID:31199487 Ptgr1 Rat diisononyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of PTGR1 mRNA CTD PMID:31199487 Ptgr1 Rat disulfiram increases expression ISO PTGR1 (Homo sapiens) 6480464 Disulfiram results in increased expression of PTGR1 mRNA CTD PMID:20566472 Ptgr1 Rat dithionitrobenzoic acid multiple interactions EXP 6480464 Dithionitrobenzoic Acid inhibits the reaction [PTGR1 protein results in increased reduction of 10-nitro-oleic acid analog] and Dithionitrobenzoic Acid inhibits the reaction [PTGR1 protein results in increased reduction of 15-ketoprostaglandin E2] CTD PMID:23878198 Ptgr1 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of PTGR1 mRNA CTD PMID:21551480 Ptgr1 Rat dorsomorphin multiple interactions ISO PTGR1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Ptgr1 Rat elemental selenium affects expression EXP 6480464 Selenium affects the expression of PTGR1 protein CTD PMID:19351701 Ptgr1 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of PTGR1 mRNA CTD PMID:29391264 Ptgr1 Rat eugenol increases expression ISO PTGR1 (Homo sapiens) 6480464 Eugenol results in increased expression of PTGR1 mRNA CTD PMID:20566472 Ptgr1 Rat fenoprofen affects activity ISO PTGR1 (Homo sapiens) 6480464 Fenoprofen affects the activity of PTGR1 protein CTD PMID:25619643 Ptgr1 Rat ferric oxide increases expression EXP 6480464 ferric oxide analog results in increased expression of PTGR1 mRNA CTD PMID:38615722 Ptgr1 Rat fipronil increases expression EXP 6480464 fipronil results in increased expression of PTGR1 mRNA CTD PMID:31881178 Ptgr1 Rat fluoranthene multiple interactions EXP 6480464 [1 more ... CTD PMID:18711122 Ptgr1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of PTGR1 mRNA CTD PMID:24136188 Ptgr1 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of PTGR1 mRNA CTD PMID:24793618 Ptgr1 Rat folic acid multiple interactions ISO Ptgr1 (Mus musculus) 6480464 [1 more ... CTD PMID:20938992 and PMID:22206623 Ptgr1 Rat formononetin increases expression ISO PTGR1 (Homo sapiens) 401959214 [Formononetin cotreated with gallic acid] increases expression of PTGR1 mRNA in hepatocellular carcinoma cells RGD Ptgr1 Rat furan increases expression EXP 6480464 furan results in increased expression of PTGR1 mRNA CTD PMID:25539665 and PMID:26194646 Ptgr1 Rat gallic acid increases expression ISO PTGR1 (Homo sapiens) 401959214 [Gallic acid cotreated with calycosin or formononetin] increases expression of PTGR1 mRNA in hepatocellular carcinoma cells RGD Ptgr1 Rat gamma-linolenic acid increases expression ISO PTGR1 (Homo sapiens) 6480464 gamma-Linolenic Acid results in increased expression of PTGR1 mRNA CTD PMID:20664735 Ptgr1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of PTGR1 mRNA CTD PMID:33387578 Ptgr1 Rat glafenine decreases expression EXP 6480464 Glafenine results in decreased expression of PTGR1 mRNA CTD PMID:24136188 Ptgr1 Rat gold atom increases expression ISO PTGR1 (Homo sapiens) 6480464 Gold results in increased expression of PTGR1 mRNA CTD PMID:29705079 Ptgr1 Rat gold(0) increases expression ISO PTGR1 (Homo sapiens) 6480464 Gold results in increased expression of PTGR1 mRNA CTD PMID:29705079 Ptgr1 Rat hexane increases expression ISO PTGR1 (Homo sapiens) 6480464 n-hexane results in increased expression of PTGR1 mRNA CTD PMID:20566472 Ptgr1 Rat hydrogen peroxide increases expression ISO Ptgr1 (Mus musculus) 6480464 Hydrogen Peroxide results in increased expression of PTGR1 mRNA CTD PMID:14729362 Ptgr1 Rat hydrogen peroxide affects expression ISO PTGR1 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of PTGR1 mRNA CTD PMID:23410634 Ptgr1 Rat ibuprofen affects activity ISO PTGR1 (Homo sapiens) 6480464 Ibuprofen affects the activity of PTGR1 protein CTD PMID:25619643 Ptgr1 Rat indometacin decreases activity ISO PTGR1 (Homo sapiens) 6480464 Indomethacin results in decreased activity of PTGR1 protein CTD PMID:25619643 Ptgr1 Rat indometacin multiple interactions EXP 6480464 Indomethacin inhibits the reaction [PTGR1 protein results in increased reduction of 10-nitro-oleic acid analog] and Indomethacin inhibits the reaction [PTGR1 protein results in increased reduction of 15-ketoprostaglandin E2] CTD PMID:23878198 Ptgr1 Rat isoeugenol increases expression ISO PTGR1 (Homo sapiens) 6480464 isoeugenol results in increased expression of PTGR1 mRNA CTD PMID:20566472 Ptgr1 Rat ivermectin decreases expression ISO PTGR1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of PTGR1 protein CTD PMID:32959892 Ptgr1 Rat L-methionine multiple interactions ISO Ptgr1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of PTGR1 mRNA CTD PMID:20938992 Ptgr1 Rat lead diacetate increases expression ISO PTGR1 (Homo sapiens) 6480464 lead acetate results in increased expression of PTGR1 mRNA CTD PMID:22839698 and PMID:38568856 Ptgr1 Rat lead(II) chloride multiple interactions ISO PTGR1 (Homo sapiens) 6480464 [cadmium sulfate co-treated with cobaltous chloride co-treated with lead chloride] results in increased expression of PTGR1 mRNA CTD PMID:18654764 Ptgr1 Rat leflunomide decreases expression EXP 6480464 leflunomide results in decreased expression of PTGR1 mRNA CTD PMID:24136188 Ptgr1 Rat manganese(II) chloride increases expression EXP 6480464 manganese chloride results in increased expression of PTGR1 mRNA CTD PMID:22281203 Ptgr1 Rat menadione increases expression ISO Ptgr1 (Mus musculus) 6480464 Vitamin K 3 results in increased expression of PTGR1 mRNA CTD PMID:25270620 Ptgr1 Rat menadione increases expression ISO PTGR1 (Homo sapiens) 6480464 Vitamin K 3 results in increased expression of PTGR1 mRNA CTD PMID:23410634 Ptgr1 Rat mercury dichloride increases expression ISO PTGR1 (Homo sapiens) 6480464 Mercuric Chloride results in increased expression of PTGR1 mRNA CTD PMID:38568856 Ptgr1 Rat methyl salicylate increases expression ISO PTGR1 (Homo sapiens) 6480464 methyl salicylate results in increased expression of PTGR1 mRNA CTD PMID:20566472 Ptgr1 Rat N-methyl-4-phenylpyridinium decreases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of PTGR1 mRNA CTD PMID:16026605 Ptgr1 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [2-Acetylaminofluorene co-treated with Diethylnitrosamine] results in increased expression of PTGR1 mRNA and [Diethylnitrosamine co-treated with Thioacetamide] results in increased expression of PTGR1 mRNA CTD PMID:16158176 and PMID:28943392 Ptgr1 Rat N-nitrosodiethylamine increases expression EXP 14401713 Diethylnitrosamine increases expression of Ptgr1 protein in the liver RGD Ptgr1 Rat N-nitrosodiethylamine increases expression ISO Ptgr1 (Mus musculus) 6480464 Diethylnitrosamine results in increased expression of PTGR1 mRNA CTD PMID:24535843 Ptgr1 Rat NADP zwitterion multiple interactions EXP 6480464 [PTGR1 protein co-treated with NADP] affects the reduction of (2E)-decenal more ... CTD PMID:11524419 and PMID:21939268 Ptgr1 Rat NADP(+) multiple interactions EXP 6480464 [PTGR1 protein co-treated with NADP] affects the reduction of (2E)-decenal more ... CTD PMID:11524419 and PMID:21939268 Ptgr1 Rat nickel dichloride affects expression EXP 6480464 nickel chloride affects the expression of PTGR1 mRNA CTD PMID:22110744 Ptgr1 Rat nickel sulfate increases expression ISO PTGR1 (Homo sapiens) 6480464 nickel sulfate results in increased expression of PTGR1 mRNA CTD PMID:20566472 Ptgr1 Rat Niflumic acid decreases activity ISO PTGR1 (Homo sapiens) 6480464 Niflumic Acid results in decreased activity of PTGR1 protein CTD PMID:25619643 Ptgr1 Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of PTGR1 mRNA CTD PMID:24136188 Ptgr1 Rat nimesulide affects activity ISO PTGR1 (Homo sapiens) 6480464 nimesulide affects the activity of PTGR1 protein CTD PMID:25619643 Ptgr1 Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of PTGR1 mRNA CTD PMID:33484710 Ptgr1 Rat non-2-enal multiple interactions EXP 6480464 [PTGR1 protein co-treated with NADP] affects the reduction of 2-nonenal CTD PMID:11524419 Ptgr1 Rat ochratoxin A decreases expression ISO PTGR1 (Homo sapiens) 6480464 ochratoxin A results in decreased expression of PTGR1 mRNA CTD PMID:32905824 Ptgr1 Rat oct-2-enal multiple interactions EXP 6480464 [PTGR1 protein co-treated with NADP] affects the reduction of 2-octenal CTD PMID:11524419 Ptgr1 Rat ozone multiple interactions ISO Ptgr1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of PTGR1 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in increased expression of PTGR1 mRNA CTD PMID:34911549 Ptgr1 Rat p-toluidine increases expression EXP 6480464 4-toluidine results in increased expression of PTGR1 mRNA CTD PMID:27638505 Ptgr1 Rat paracetamol decreases expression ISO PTGR1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of PTGR1 mRNA CTD PMID:21420995 and PMID:29067470 Ptgr1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of PTGR1 mRNA CTD PMID:33387578 Ptgr1 Rat paraquat increases expression ISO PTGR1 (Homo sapiens) 6480464 Paraquat results in increased expression of PTGR1 protein CTD PMID:34064677 Ptgr1 Rat PCB138 increases expression EXP 6480464 2 more ... CTD PMID:23829299 Ptgr1 Rat perfluorohexanesulfonic acid increases expression ISO Ptgr1 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of PTGR1 mRNA CTD PMID:37995155 Ptgr1 Rat perfluorooctane-1-sulfonic acid decreases expression EXP 6480464 perfluorooctane sulfonic acid results in decreased expression of PTGR1 mRNA CTD PMID:18692542 Ptgr1 Rat perfluorooctane-1-sulfonic acid increases expression ISO PTGR1 (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in increased expression of PTGR1 mRNA CTD PMID:25812627 Ptgr1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Ptgr1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PTGR1 mRNA CTD PMID:36331819 Ptgr1 Rat perfluorooctanoic acid increases expression ISO PTGR1 (Homo sapiens) 6480464 perfluorooctanoic acid results in increased expression of PTGR1 mRNA CTD PMID:25812627 Ptgr1 Rat phenobarbital affects expression ISO Ptgr1 (Mus musculus) 6480464 Phenobarbital affects the expression of PTGR1 mRNA CTD PMID:23091169 Ptgr1 Rat phenobarbital increases expression ISO Ptgr1 (Mus musculus) 6480464 Phenobarbital results in increased expression of PTGR1 mRNA CTD PMID:19482888 Ptgr1 Rat phenobarbital multiple interactions ISO Ptgr1 (Mus musculus) 6480464 NR1I3 protein affects the reaction [Phenobarbital results in increased expression of PTGR1 mRNA] CTD PMID:19482888 Ptgr1 Rat phenylmercury acetate increases expression ISO PTGR1 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of PTGR1 mRNA CTD PMID:26272509 Ptgr1 Rat phenylmercury acetate multiple interactions ISO PTGR1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PTGR1 mRNA CTD PMID:27188386 Ptgr1 Rat pirinixic acid multiple interactions ISO PTGR1 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of PTGR1 mRNA CTD PMID:19710929 Ptgr1 Rat pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of PTGR1 mRNA CTD PMID:19162173 Ptgr1 Rat progesterone decreases activity EXP 6480464 Progesterone results in decreased activity of PTGR1 protein CTD PMID:11524419 Ptgr1 Rat progesterone increases expression EXP 6480464 Progesterone results in increased expression of PTGR1 mRNA CTD PMID:20726854 Ptgr1 Rat progesterone multiple interactions ISO PTGR1 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in decreased expression of PTGR1 mRNA CTD PMID:20660070 Ptgr1 Rat propan-2-ol increases expression ISO PTGR1 (Homo sapiens) 6480464 2-Propanol results in increased expression of PTGR1 mRNA CTD PMID:20566472 Ptgr1 Rat prostaglandin F1alpha increases metabolic processing ISO PTGR1 (Homo sapiens) 6480464 PTGR1 protein results in increased metabolism of prostaglandin F1 analog CTD PMID:25619643 Ptgr1 Rat quercetin affects expression EXP 6480464 Quercetin affects the expression of PTGR1 mRNA CTD PMID:18178720 Ptgr1 Rat quercetin increases expression ISO PTGR1 (Homo sapiens) 6480464 Quercetin results in increased expression of PTGR1 mRNA CTD PMID:21632981 Ptgr1 Rat quercetin multiple interactions ISO Ptgr1 (Mus musculus) 6480464 Quercetin inhibits the reaction [APOE gene mutant form results in increased expression of PTGR1 protein] CTD PMID:20093625 Ptgr1 Rat quercetin decreases activity EXP 6480464 Quercetin results in decreased activity of PTGR1 protein CTD PMID:11524419 Ptgr1 Rat rac-lactic acid increases expression ISO PTGR1 (Homo sapiens) 6480464 Lactic Acid results in increased expression of PTGR1 mRNA CTD PMID:20566472 Ptgr1 Rat rac-lactic acid decreases expression ISO PTGR1 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of PTGR1 mRNA CTD PMID:30851411 Ptgr1 Rat resorcinol increases expression ISO PTGR1 (Homo sapiens) 6480464 resorcinol results in increased expression of PTGR1 mRNA CTD PMID:22623647 Ptgr1 Rat rotenone affects expression EXP 6480464 Rotenone affects the expression of PTGR1 mRNA CTD PMID:28374803 Ptgr1 Rat SB 431542 multiple interactions ISO PTGR1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Ptgr1 Rat selenium atom affects expression EXP 6480464 Selenium affects the expression of PTGR1 protein CTD PMID:19351701 Ptgr1 Rat silicon dioxide decreases expression ISO PTGR1 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of PTGR1 mRNA CTD PMID:25895662 Ptgr1 Rat silicon dioxide increases expression ISO Ptgr1 (Mus musculus) 6480464 Silicon Dioxide results in increased expression of PTGR1 protein CTD PMID:34170461 Ptgr1 Rat sodium arsenite increases expression ISO Ptgr1 (Mus musculus) 6480464 sodium arsenite results in increased expression of PTGR1 mRNA CTD PMID:20883709 and PMID:25270620 Ptgr1 Rat sodium arsenite increases expression ISO PTGR1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of PTGR1 mRNA CTD PMID:38568856 Ptgr1 Rat sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of PTGR1 protein CTD PMID:29459688 Ptgr1 Rat sodium dodecyl sulfate increases expression ISO PTGR1 (Homo sapiens) 6480464 Sodium Dodecyl Sulfate results in increased expression of PTGR1 mRNA CTD PMID:20566472 Ptgr1 Rat sulforaphane multiple interactions ISO Ptgr1 (Mus musculus) 6480464 [sulforaphane co-treated with dibenzoylmethane] results in increased expression of PTGR1 mRNA CTD PMID:17942926 Ptgr1 Rat sulforaphane increases expression ISO PTGR1 (Homo sapiens) 6480464 sulforaphane results in increased expression of PTGR1 mRNA CTD PMID:31838189 Ptgr1 Rat sunitinib decreases expression ISO PTGR1 (Homo sapiens) 6480464 Sunitinib results in decreased expression of PTGR1 mRNA CTD PMID:31533062 Ptgr1 Rat temozolomide decreases expression ISO PTGR1 (Homo sapiens) 6480464 Temozolomide results in decreased expression of PTGR1 mRNA CTD PMID:31758290 Ptgr1 Rat tert-butyl hydroperoxide increases expression ISO Ptgr1 (Mus musculus) 6480464 tert-Butylhydroperoxide results in increased expression of PTGR1 mRNA CTD PMID:14729362 Ptgr1 Rat tert-butyl hydroperoxide increases expression ISO PTGR1 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in increased expression of PTGR1 mRNA CTD PMID:23410634 Ptgr1 Rat testosterone multiple interactions EXP 6480464 [bisphenol A co-treated with Testosterone] results in decreased expression of PTGR1 mRNA CTD PMID:26496021 Ptgr1 Rat tetrachloromethane affects expression ISO Ptgr1 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of PTGR1 mRNA CTD PMID:17484886 Ptgr1 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of PTGR1 protein CTD PMID:27623180 Ptgr1 Rat tetrachloromethane increases expression ISO Ptgr1 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of PTGR1 mRNA CTD PMID:27339419 and PMID:31919559 Ptgr1 Rat theaflavin multiple interactions ISO Ptgr1 (Mus musculus) 6480464 theaflavin inhibits the reaction [APOE gene mutant form results in increased expression of PTGR1 protein] CTD PMID:20093625 Ptgr1 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of PTGR1 mRNA CTD PMID:34492290 Ptgr1 Rat thioacetamide multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Thioacetamide] results in increased expression of PTGR1 mRNA CTD PMID:28943392 Ptgr1 Rat thiram increases expression ISO PTGR1 (Homo sapiens) 6480464 Thiram results in increased expression of PTGR1 mRNA CTD PMID:38568856 Ptgr1 Rat titanium dioxide affects expression ISO Ptgr1 (Mus musculus) 6480464 titanium dioxide affects the expression of PTGR1 mRNA CTD PMID:23557971 Ptgr1 Rat titanium dioxide multiple interactions ISO Ptgr1 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of PTGR1 mRNA CTD PMID:29950665 Ptgr1 Rat titanium dioxide decreases expression ISO Ptgr1 (Mus musculus) 6480464 titanium dioxide results in decreased expression of PTGR1 mRNA CTD PMID:29264374 Ptgr1 Rat trans-chalcone multiple interactions EXP 6480464 [PTGR1 protein co-treated with NADP] affects the reduction of Chalcone CTD PMID:11524419 Ptgr1 Rat trans-isoeugenol increases expression ISO PTGR1 (Homo sapiens) 6480464 isoeugenol results in increased expression of PTGR1 mRNA CTD PMID:20566472 Ptgr1 Rat tributylstannane increases expression ISO Ptgr1 (Mus musculus) 6480464 tributyltin results in increased expression of PTGR1 mRNA CTD PMID:31939706 Ptgr1 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of PTGR1 mRNA CTD PMID:33387578 Ptgr1 Rat trichostatin A increases expression ISO PTGR1 (Homo sapiens) 6480464 trichostatin A results in increased expression of PTGR1 mRNA CTD PMID:27188386 Ptgr1 Rat triphenyl phosphate increases expression EXP 6480464 triphenyl phosphate results in increased expression of PTGR1 mRNA CTD PMID:30589522 Ptgr1 Rat undecane decreases expression EXP 6480464 undecane results in decreased expression of PTGR1 protein CTD PMID:17337753 Ptgr1 Rat urethane decreases expression ISO PTGR1 (Homo sapiens) 6480464 Urethane results in decreased expression of PTGR1 mRNA CTD PMID:28818685 Ptgr1 Rat valdecoxib decreases expression EXP 6480464 valdecoxib results in decreased expression of PTGR1 mRNA CTD PMID:24136188 Ptgr1 Rat valproic acid increases expression ISO PTGR1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of PTGR1 mRNA CTD PMID:19101580 more ... Ptgr1 Rat valproic acid multiple interactions ISO PTGR1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PTGR1 mRNA CTD PMID:27188386 Ptgr1 Rat vinclozolin increases methylation EXP 6480464 vinclozolin results in increased methylation of PTGR1 gene CTD PMID:31079544 and PMID:31682807 Ptgr1 Rat vorinostat increases expression ISO PTGR1 (Homo sapiens) 6480464 vorinostat results in increased expression of PTGR1 mRNA CTD PMID:27188386
(1->4)-beta-D-glucan (ISO) (E)-cinnamyl alcohol (ISO) 1,1-dichloroethene (ISO) 1,2,4-trimethylbenzene (EXP) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 1-chloro-2,4-dinitrobenzene (ISO) 1-Hydroxypyrene (ISO) 1-penten-3-one (EXP) 13,14-dihydro-15-keto-PGF2alpha (ISO) 13,14-dihydro-15-oxo-prostaglandin E2 (ISO) 13,14-dihydro-15-oxoprostaglandin E1 (ISO) 15-dehydro-prostaglandin E2 (EXP,ISO) 15-oxoprostaglandin F2alpha (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,2',5,5'-tetrachlorobiphenyl (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,4-dinitrotoluene (EXP) 2,4-Nonadienal (EXP) 2-acetamidofluorene (EXP) 2-butoxyethanol (ISO) 2-hexenal (EXP) 2-hydroxypropanoic acid (ISO) 2-pentenal (EXP) 2-tert-butylhydroquinone (ISO) 3-chloropropane-1,2-diol (EXP) 3-phenylprop-2-enal (EXP) 3H-1,2-dithiole-3-thione (EXP,ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyhexenal (EXP) 4-hydroxynon-2-enal (EXP) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) acrolein (EXP) aflatoxin B1 (EXP) alachlor (EXP) all-trans-retinoic acid (ISO) alpha-hexylcinnamaldehyde (ISO) amiodarone (ISO) ammonium chloride (EXP) amphetamine (EXP) ampicillin (ISO) andrographolide (ISO) aristolochic acid A (ISO) arsenite(3-) (ISO) arsenous acid (ISO) azathioprine (ISO) Azoxymethane (ISO) Bandrowski's base (ISO) benzo[a]pyrene (EXP,ISO) benzo[a]pyrene diol epoxide I (ISO) benzo[b]fluoranthene (EXP,ISO) benzoic acid (ISO) benzylideneacetone (EXP) beta-lapachone (ISO) beta-naphthoflavone (ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) bisphenol F (ISO) buten-2-one (EXP) Butylbenzyl phthalate (EXP) C60 fullerene (EXP) cadmium dichloride (EXP,ISO) cadmium sulfate (ISO) caffeine (EXP) calycosin (ISO) cannabidiol (ISO) carbamazepine (ISO) carbon nanotube (ISO) cefaloridine (EXP) chalcone (EXP) chloropicrin (ISO) choline (ISO) chromium(6+) (ISO) cinnamyl alcohol (ISO) cisplatin (ISO) cobalt dichloride (EXP,ISO) copper atom (ISO) copper(0) (ISO) copper(II) chloride (ISO) copper(II) sulfate (ISO) coumarin (EXP) crocidolite asbestos (ISO) crotonaldehyde (EXP) cyclosporin A (ISO) dexamethasone (EXP) dextran sulfate (ISO) diarsenic trioxide (ISO) dibenz[a,h]anthracene (EXP) dibenzo[a,l]pyrene (EXP) dibenzoylmethane (ISO) dibutyl phthalate (EXP) diclofenac (ISO) diethyl maleate (ISO) diethyl phthalate (EXP) diisobutyl phthalate (EXP) diisononyl phthalate (EXP) disulfiram (ISO) dithionitrobenzoic acid (EXP) diuron (EXP) dorsomorphin (ISO) elemental selenium (EXP) endosulfan (EXP) eugenol (ISO) fenoprofen (ISO) ferric oxide (EXP) fipronil (EXP) fluoranthene (EXP) flutamide (EXP) folic acid (ISO) formononetin (ISO) furan (EXP) gallic acid (ISO) gamma-linolenic acid (ISO) gentamycin (EXP) glafenine (EXP) gold atom (ISO) gold(0) (ISO) hexane (ISO) hydrogen peroxide (ISO) ibuprofen (ISO) indometacin (EXP,ISO) isoeugenol (ISO) ivermectin (ISO) L-methionine (ISO) lead diacetate (ISO) lead(II) chloride (ISO) leflunomide (EXP) manganese(II) chloride (EXP) menadione (ISO) mercury dichloride (ISO) methyl salicylate (ISO) N-methyl-4-phenylpyridinium (EXP) N-nitrosodiethylamine (EXP,ISO) NADP zwitterion (EXP) NADP(+) (EXP) nickel dichloride (EXP) nickel sulfate (ISO) Niflumic acid (ISO) nimesulide (EXP,ISO) nitrofen (EXP) non-2-enal (EXP) ochratoxin A (ISO) oct-2-enal (EXP) ozone (ISO) p-toluidine (EXP) paracetamol (EXP,ISO) paraquat (ISO) PCB138 (EXP) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (EXP,ISO) perfluorooctanoic acid (ISO) phenobarbital (ISO) phenylmercury acetate (ISO) pirinixic acid (EXP,ISO) progesterone (EXP,ISO) propan-2-ol (ISO) prostaglandin F1alpha (ISO) quercetin (EXP,ISO) rac-lactic acid (ISO) resorcinol (ISO) rotenone (EXP) SB 431542 (ISO) selenium atom (EXP) silicon dioxide (ISO) sodium arsenite (EXP,ISO) sodium dodecyl sulfate (ISO) sulforaphane (ISO) sunitinib (ISO) temozolomide (ISO) tert-butyl hydroperoxide (ISO) testosterone (EXP) tetrachloromethane (EXP,ISO) theaflavin (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) trans-chalcone (EXP) trans-isoeugenol (ISO) tributylstannane (ISO) trichloroethene (EXP) trichostatin A (ISO) triphenyl phosphate (EXP) undecane (EXP) urethane (ISO) valdecoxib (EXP) valproic acid (ISO) vinclozolin (EXP) vorinostat (ISO)
1.
Plant Natural Products Calycosin and Gallic Acid Synergistically Attenuate Neutrophil Infiltration and Subsequent Injury in Isoproterenol-Induced Myocardial Infarction: A Possible Role for Leukotriene B4 12-Hydroxydehydrogenase?
Cheng Y, etal., Oxid Med Cell Longev. 2015;2015:434052. doi: 10.1155/2015/434052. Epub 2015 Jul 21.
2.
Antioxidative function and substrate specificity of NAD(P)H-dependent alkenal/one oxidoreductase. A new role for leukotriene B4 12-hydroxydehydrogenase/15-oxoprostaglandin 13-reductase.
Dick RA, etal., J Biol Chem. 2001 Nov 2;276(44):40803-10. doi: 10.1074/jbc.M105487200. Epub 2001 Aug 27.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
5.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
6.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.
Isolation of cDNAs representing dithiolethione-responsive genes.
Primiano T, etal., Carcinogenesis 1996 Nov;17(11):2297-303.
8.
Identification of dithiolethione-inducible gene-1 as a leukotriene B4 12-hydroxydehydrogenase: implications for chemoprevention.
Primiano T, etal., Carcinogenesis. 1998 Jun;19(6):999-1005. doi: 10.1093/carcin/19.6.999.
9.
GOA pipeline
RGD automated data pipeline
10.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
11.
Increased expression of prostaglandin reductase 1 in hepatocellular carcinomas from clinical cases and experimental tumors in rats.
Sánchez-Rodríguez R, etal., Int J Biochem Cell Biol. 2014 Aug;53:186-94. doi: 10.1016/j.biocel.2014.05.017. Epub 2014 May 20.
12.
Excessive leukotriene B4 in nucleus tractus solitarii is prohypertensive in spontaneously hypertensive rats.
Waki H, etal., Hypertension. 2013 Jan;61(1):194-201. doi: 10.1161/HYPERTENSIONAHA.112.192252. Epub 2012 Nov 19.
Ptgr1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 78,579,060 - 78,597,671 (-) NCBI GRCr8 mRatBN7.2 5 73,784,000 - 73,802,624 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 73,784,009 - 73,802,666 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 75,685,300 - 75,703,919 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 77,506,913 - 77,525,540 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 77,479,071 - 77,497,693 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 76,110,746 - 76,129,361 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 76,110,738 - 76,129,441 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 80,255,192 - 80,273,709 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 77,010,809 - 77,029,326 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 77,015,922 - 77,034,439 (-) NCBI Celera 5 72,607,043 - 72,625,264 (-) NCBI Celera Cytogenetic Map 5 q24 NCBI
PTGR1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 9 111,549,722 - 111,599,647 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 9 111,549,722 - 111,599,893 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 9 114,312,002 - 114,361,927 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 9 113,365,073 - 113,401,532 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 9 111,404,807 - 111,441,266 NCBI Celera 9 84,811,079 - 84,861,206 (-) NCBI Celera Cytogenetic Map 9 q31.3 NCBI HuRef 9 83,911,040 - 83,960,627 (-) NCBI HuRef CHM1_1 9 114,458,441 - 114,508,602 (-) NCBI CHM1_1 T2T-CHM13v2.0 9 123,721,096 - 123,771,025 (-) NCBI T2T-CHM13v2.0
Ptgr1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 58,965,590 - 58,987,131 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 58,965,439 - 58,987,119 (-) Ensembl GRCm39 Ensembl GRCm38 4 58,965,590 - 58,987,131 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 58,965,439 - 58,987,119 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 58,978,462 - 58,999,950 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 59,059,644 - 59,081,132 (-) NCBI MGSCv36 mm8 Celera 4 58,878,602 - 58,900,216 (-) NCBI Celera Cytogenetic Map 4 B3 NCBI cM Map 4 32.36 NCBI
Ptgr1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955419 15,708,456 - 15,739,147 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955419 15,708,456 - 15,738,774 (+) NCBI ChiLan1.0 ChiLan1.0
PTGR1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 11 27,816,183 - 27,860,132 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 9 27,824,016 - 27,862,494 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 9 82,700,541 - 82,739,024 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 9 110,862,122 - 110,900,829 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 9 110,848,804 - 110,900,829 (-) Ensembl panpan1.1 panPan2
PTGR1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 11 66,191,155 - 66,212,075 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 11 66,191,165 - 66,209,219 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 11 64,601,934 - 64,622,894 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 11 67,324,103 - 67,345,145 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 11 67,324,105 - 67,345,298 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 11 65,841,533 - 65,862,116 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 11 65,864,869 - 65,885,860 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 11 66,554,733 - 66,575,785 (-) NCBI UU_Cfam_GSD_1.0
Ptgr1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 181,503,868 - 181,535,213 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936559 1,731,533 - 1,762,671 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936559 1,731,346 - 1,762,676 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PTGR1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 252,373,282 - 252,395,948 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 252,373,272 - 252,395,948 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 283,170,868 - 283,177,809 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PTGR1
Ptgr1
.
Predicted Target Of
Count of predictions: 18 Count of miRNA genes: 17 Interacting mature miRNAs: 18 Transcripts: ENSRNOT00000020335 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1298067 Scl15 Serum cholesterol level QTL 15 4.8 0.001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 33215665 78215665 Rat 1300115 Hrtrt7 Heart rate QTL 7 2.76 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 5 47869062 90099692 Rat 1357396 Bw44 Body weight QTL 44 4.19 body mass (VT:0001259) body weight (CMO:0000012) 5 68984307 104251008 Rat 1549845 Scl44 Serum cholesterol level QTL 44 6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 40128307 148607290 Rat 61380 Edpm5 Estrogen-dependent pituitary mass QTL 5 4.5 0.92 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 5 68984307 104251008 Rat 70212 Niddm25 Non-insulin dependent diabetes mellitus QTL 25 3.54 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 1 131345958 Rat 1358353 Srcrtb2 Stress Responsive Cort Basal QTL 2 3.48 0.003 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 18873947 74251464 Rat 634305 Mamtr1 Mammary tumor resistance QTL 1 0.0001 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 12789751 113558310 Rat 61386 Bp49 Blood pressure QTL 49 16.6 cerebrum integrity trait (VT:0010549) brain infarction volume (CMO:0001013) 5 60293434 98603051 Rat 1331801 Rf33 Renal function QTL 33 4.149 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 5 43726656 129132602 Rat 1357402 Bw46 Body weight QTL 46 4.47 body mass (VT:0001259) body mass index (BMI) (CMO:0000105) 5 68984307 104251008 Rat 2302381 Bw84 Body weight QTL 84 4.47 body mass (VT:0001259) body mass index (BMI) (CMO:0000105) 5 68984307 104251008 Rat 1598807 Glom12 Glomerulus QTL 12 2.7 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 5 33215665 78215665 Rat 1302786 Kidm8 Kidney mass QTL 8 28.15 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 5 33215665 78215665 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 7411561 Bw134 Body weight QTL 134 24 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 49463600 94463600 Rat 2303615 Vencon7 Ventilatory control QTL 7 0.001 respiration trait (VT:0001943) respiration rate (CMO:0000289) 5 50983895 95983895 Rat 1576312 Emca8 Estrogen-induced mammary cancer QTL 8 4.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 50328551 141643988 Rat 1641912 Alcrsp18 Alcohol response QTL 18 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 5 35189153 141643988 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 1576317 Eutr2 Estrogen induced uterine response QTL 2 0.01 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 34730116 104251008 Rat 7394712 Emca13 Estrogen-induced mammary cancer QTL 13 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 9823266 99753708 Rat 1331773 Scl26 Serum cholesterol level QTL 26 3.065 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 43726656 86724018 Rat 70189 Mcs5 Mammary carcinoma susceptibility QTL 5 10.51 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 55805606 132207589 Rat 1331771 Rf35 Renal function QTL 35 4.36965 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 5 729470 86724018 Rat 61359 Eaex Experimental allergic encephalomyelitis QTL x 3 nervous system integrity trait (VT:0010566) post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422) 5 55715622 100715622 Rat 2290448 Scl54 Serum cholesterol level QTL 54 2.93 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 31663789 131345958 Rat 61426 Scl2 Serum cholesterol level QTL 2 7.3 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 59793399 143070159 Rat 1354598 Srn6 Serum renin concentration QTL 6 3.8 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 5 69540295 151018848 Rat 9589025 Epfw7 Epididymal fat weight QTL 7 20.66 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 5 49463600 94463600 Rat 2303574 Gluco42 Glucose level QTL 42 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 53496719 98496719 Rat 2290005 Mcs24 Mammary carcinoma susceptibility QTL 24 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 64719390 109719390 Rat 1331756 Rf34 Renal function QTL 34 4.16275 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 5 1 90450412 Rat 2306971 Anxrr21 Anxiety related response QTL 21 9.47 fear/anxiety-related behavior trait (VT:1000241) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 5 66174080 124160948 Rat 2316954 Rf57 Renal function QTL 57 0 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 5 59793528 90450144 Rat 1358895 Bp254 Blood pressure QTL 254 3.6 0.0003 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 5 58829236 128034027 Rat 2316959 Gluco59 Glucose level QTL 59 4.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 34944474 113558310 Rat 2312671 Scl64 Serum cholesterol level QTL 64 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 68984307 104251008 Rat 2316957 Pur21 Proteinuria QTL 21 6.2 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 5 59793528 113558156 Rat
RH137513
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 73,784,043 - 73,784,173 (+) MAPPER mRatBN7.2 Rnor_6.0 5 76,110,785 - 76,110,914 NCBI Rnor6.0 Rnor_5.0 5 80,255,224 - 80,255,353 UniSTS Rnor5.0 RGSC_v3.4 5 77,010,841 - 77,010,970 UniSTS RGSC3.4 Celera 5 72,607,075 - 72,607,204 UniSTS Cytogenetic Map 5 q24 UniSTS
BM386490
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 73,799,690 - 73,799,871 (+) MAPPER mRatBN7.2 Rnor_6.0 5 76,126,429 - 76,126,609 NCBI Rnor6.0 Rnor_5.0 5 80,270,777 - 80,270,957 UniSTS Rnor5.0 RGSC_v3.4 5 77,026,394 - 77,026,574 UniSTS RGSC3.4 Celera 5 72,622,332 - 72,622,512 UniSTS RH 3.4 Map 5 506.3 UniSTS Cytogenetic Map 5 q24 UniSTS
D19S409
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 73,798,118 - 73,799,022 (+) MAPPER mRatBN7.2 Rnor_6.0 5 76,124,858 - 76,125,761 NCBI Rnor6.0 Rnor_5.0 5 80,269,206 - 80,270,109 UniSTS Rnor5.0 RGSC_v3.4 5 77,024,823 - 77,025,726 UniSTS RGSC3.4 Celera 5 72,620,761 - 72,621,664 UniSTS Cytogenetic Map 5 q24 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000020335 ⟹ ENSRNOP00000020335
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 73,784,009 - 73,802,666 (-) Ensembl Rnor_6.0 Ensembl 5 76,110,738 - 76,129,441 (-) Ensembl
RefSeq Acc Id:
NM_138863 ⟹ NP_620218
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 78,579,060 - 78,597,671 (-) NCBI mRatBN7.2 5 73,784,012 - 73,802,624 (-) NCBI Rnor_6.0 5 76,110,753 - 76,129,361 (-) NCBI Rnor_5.0 5 80,255,192 - 80,273,709 (-) NCBI RGSC_v3.4 5 77,010,809 - 77,029,326 (-) RGD Celera 5 72,607,043 - 72,625,264 (-) RGD
Sequence:
CGGGAAGGAGTTTCTGTGAGACTGTGTTCATCAGGATGGTACAAGCTAAGACCTGGACCCTAAAGAAGCACTTTGAAGGCTTCCCTACGGACAGTAACTTTGAGTTGAGGACGACTGAGCTCCCACCC
hide sequence
RefSeq Acc Id:
XM_017593142 ⟹ XP_017448631
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 78,579,067 - 78,596,042 (-) NCBI mRatBN7.2 5 73,784,000 - 73,800,996 (-) NCBI Rnor_6.0 5 76,110,746 - 76,127,712 (-) NCBI
Sequence:
CCTGGACCCTAAAGAAGCACTTTGAAGGCTTCCCTACGGACAGTAACTTTGAGTTGAGGACGAC
hide sequence
RefSeq Acc Id:
NP_620218 ⟸ NM_138863
- UniProtKB:
Q5EBD3 (UniProtKB/Swiss-Prot), P97584 (UniProtKB/Swiss-Prot), A0A8L2QAI5 (UniProtKB/TrEMBL)
- Sequence:
MVQAKTWTLKKHFEGFPTDSNFELRTTELPPLNNGEVLLEALFLSVDPYMRVAAKKLKEGDSMMGEQVARVVESKNSAFPTGTIVVALLGWTSHSISDGNGLRKLPAEWPDKLPLSLALGTVGMPGLT
hide sequence
RefSeq Acc Id:
XP_017448631 ⟸ XM_017593142
- Peptide Label:
isoform X1
- UniProtKB:
A0A8L2QAI5 (UniProtKB/TrEMBL)
- Sequence:
MMGEQVARVVESKNSAFPTGTIVVALLGWTSHSISDGNGLRKLPAEWPDKLPLSLALGTVGMPGLTAYFGLLDICGLKGGETVLVNAAAGAVGSVVGQIAKLKGCKVVGTAGSDEKVAYLKKLGFDVA
hide sequence
Ensembl Acc Id:
ENSRNOP00000020335 ⟸ ENSRNOT00000020335
RGD ID: 13693766 Promoter ID: EPDNEW_R4291 Type: multiple initiation site Name: Ptgr1_1 Description: prostaglandin reductase 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 76,129,377 - 76,129,437 EPDNEW
BioCyc Gene G2FUF-41164 BioCyc
BioCyc Pathway PWY3DJ-11470 [sphingosine and sphingosine-1-phosphate metabolism] BioCyc
BioCyc Pathway Image PWY3DJ-11470 BioCyc
Ensembl Genes ENSRNOG00000015072 Ensembl, UniProtKB/TrEMBL
Ensembl Transcript ENSRNOT00000020335.7 UniProtKB/TrEMBL
Gene3D-CATH Medium-chain alcohol dehydrogenases, catalytic domain UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NAD(P)-binding Rossmann-like Domain UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE IMAGE:7307365 IMAGE-MGC_LOAD
InterPro ADH-like_C UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
ADH_N_2 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
GroES-like_sf UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MDR_fam UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NAD(P)-bd_dom_sf UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PKS_ER UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PTGR1 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report rno:192227 UniProtKB/Swiss-Prot
MGC_CLONE MGC:108590 IMAGE-MGC_LOAD
NCBI Gene 192227 ENTREZGENE
PANTHER PROSTAGLANDIN REDUCTASE 1 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PTHR43205 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam ADH_N_2 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
ADH_zinc_N UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen Ptgr1 PhenoGen
RatGTEx ENSRNOG00000015072 RatGTEx
SMART PKS_ER UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP SSF50129 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SSF51735 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt A0A8L2QAI5 ENTREZGENE, UniProtKB/TrEMBL
P97584 ENTREZGENE, UniProtKB/Swiss-Prot
Q5EBD3 ENTREZGENE
UniProt Secondary Q5EBD3 UniProtKB/Swiss-Prot
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-09-18
Ptgr1
prostaglandin reductase 1
Ltb4dh
leukotriene B4 12-hydroxydehydrogenase
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-09-10
Ltb4dh
leukotriene B4 12-hydroxydehydrogenase
Dig1
dithiolethione-inducible gene-1
Symbol and Name updated
1299863 APPROVED
2002-08-07
Dig1
dithiolethione-inducible gene-1
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_regulation
greatly induced in liver by 1,2-dithiole-3-thione (D3T)
632607
