Symbol:
Emp3
Name:
epithelial membrane protein 3
RGD ID:
621094
Description:
Predicted to be involved in apoptotic process and bleb assembly. Predicted to be active in plasma membrane. Orthologous to human EMP3 (epithelial membrane protein 3 (MAM blood group)); INTERACTS WITH 1,2,4-trimethylbenzene; 17alpha-ethynylestradiol; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
EMP-3; MGC108667
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
EMP3 (epithelial membrane protein 3 (MAM blood group)) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Emp3 (epithelial membrane protein 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Emp3 (epithelial membrane protein 3 (MAM blood group)) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
EMP3 (epithelial membrane protein 3 (MAM blood group)) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
EMP3 (epithelial membrane protein 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Emp3 (epithelial membrane protein 3 (MAM blood group)) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
EMP3 (epithelial membrane protein 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
EMP3 (epithelial membrane protein 3 (MAM blood group)) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Emp3 (epithelial membrane protein 3 (MAM blood group)) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
FXR2 (FMR1 autosomal homolog 2) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
EMP3 (epithelial membrane protein 3 (MAM blood group))
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Emp3 (epithelial membrane protein 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
emp3b (epithelial membrane protein 3b)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Danio rerio (zebrafish):
emp3a
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
emp3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 105,525,086 - 105,528,370 (-) NCBI GRCr8 mRatBN7.2 1 96,388,651 - 96,391,946 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 96,388,652 - 96,391,988 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 101,774,797 - 101,777,974 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 110,246,785 - 110,249,962 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 103,537,150 - 103,540,327 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 101,900,731 - 101,903,948 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 101,900,733 - 101,903,910 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 102,979,695 - 102,982,874 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 96,389,783 - 96,392,960 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 96,467,893 - 96,471,071 (-) NCBI Celera 1 90,641,302 - 90,644,479 (-) NCBI Celera Cytogenetic Map 1 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Emp3 Rat 1,1-dichloroethene increases expression ISO Emp3 (Mus musculus) 6480464 vinylidene chloride results in increased expression of EMP3 mRNA CTD PMID:26682919 Emp3 Rat 1,2,4-trimethylbenzene decreases expression EXP 6480464 pseudocumene results in decreased expression of EMP3 protein CTD PMID:17337753 Emp3 Rat 1,2-dimethylhydrazine increases expression ISO Emp3 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of EMP3 mRNA CTD PMID:22206623 Emp3 Rat 17alpha-ethynylestradiol increases expression ISO Emp3 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of EMP3 mRNA CTD PMID:17942748 Emp3 Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of EMP3 mRNA CTD PMID:17557909 Emp3 Rat 17alpha-ethynylestradiol multiple interactions ISO Emp3 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of EMP3 mRNA CTD PMID:17942748 Emp3 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of EMP3 mRNA CTD PMID:32145629 Emp3 Rat 17beta-estradiol decreases expression ISO EMP3 (Homo sapiens) 6480464 Estradiol results in decreased expression of EMP3 mRNA CTD PMID:31614463 Emp3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Emp3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of EMP3 mRNA CTD PMID:17337447 Emp3 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of EMP3 mRNA CTD PMID:34747641 Emp3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Emp3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of EMP3 mRNA CTD PMID:21570461 Emp3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO EMP3 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of EMP3 mRNA CTD PMID:20106945 and PMID:21632981 Emp3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO EMP3 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of EMP3 mRNA CTD PMID:22298810 Emp3 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Emp3 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of EMP3 mRNA CTD PMID:17942748 Emp3 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Emp3 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Emp3 Rat 4,4'-sulfonyldiphenol increases expression ISO Emp3 (Mus musculus) 6480464 bisphenol S results in increased expression of EMP3 mRNA CTD PMID:30951980 and PMID:39298647 Emp3 Rat 4,4'-sulfonyldiphenol increases methylation ISO Emp3 (Mus musculus) 6480464 bisphenol S results in increased methylation of EMP3 exon CTD PMID:33297965 Emp3 Rat 4-hydroxyphenyl retinamide decreases expression ISO Emp3 (Mus musculus) 6480464 Fenretinide results in decreased expression of EMP3 mRNA CTD PMID:28973697 Emp3 Rat 5-aza-2'-deoxycytidine affects expression ISO EMP3 (Homo sapiens) 6480464 Decitabine affects the expression of EMP3 mRNA CTD PMID:23300844 Emp3 Rat 5-fluorouracil increases expression ISO Emp3 (Mus musculus) 6480464 Fluorouracil results in increased expression of EMP3 mRNA CTD PMID:19272435 Emp3 Rat 7,12-dimethyltetraphene increases expression ISO EMP3 (Homo sapiens) 6480464 9 more ... CTD PMID:21527772 Emp3 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of EMP3 mRNA CTD PMID:31881176 Emp3 Rat actinomycin D increases expression ISO EMP3 (Homo sapiens) 6480464 Dactinomycin results in increased expression of EMP3 mRNA CTD PMID:21527772 Emp3 Rat aflatoxin B1 affects expression ISO EMP3 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of EMP3 protein CTD PMID:20106945 Emp3 Rat aflatoxin B1 increases expression ISO EMP3 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of EMP3 mRNA and Aflatoxin B1 results in increased expression of EMP3 protein CTD PMID:21527772 and PMID:27153756 Emp3 Rat all-trans-retinoic acid increases expression ISO EMP3 (Homo sapiens) 6480464 Tretinoin results in increased expression of EMP3 mRNA CTD PMID:16054129 Emp3 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of EMP3 mRNA CTD PMID:35163327 Emp3 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of EMP3 mRNA CTD PMID:16483693 Emp3 Rat aristolochic acid A increases expression ISO EMP3 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of EMP3 mRNA CTD PMID:33212167 Emp3 Rat aristolochic acids increases expression EXP 6480464 Aristolochic Acids results in increased expression of EMP3 mRNA CTD PMID:19717638 Emp3 Rat Aroclor 1254 decreases expression ISO EMP3 (Homo sapiens) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of EMP3 mRNA CTD PMID:16934159 Emp3 Rat arsenous acid decreases expression ISO EMP3 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of EMP3 mRNA CTD PMID:20458559 Emp3 Rat atrazine increases expression ISO EMP3 (Homo sapiens) 6480464 Atrazine results in increased expression of EMP3 mRNA CTD PMID:22378314 Emp3 Rat avobenzone increases expression ISO EMP3 (Homo sapiens) 6480464 avobenzone results in increased expression of EMP3 mRNA CTD PMID:31016361 Emp3 Rat azathioprine increases expression ISO EMP3 (Homo sapiens) 6480464 Azathioprine results in increased expression of EMP3 mRNA CTD PMID:22623647 Emp3 Rat benzo[a]pyrene increases expression ISO Emp3 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of EMP3 mRNA CTD PMID:22228805 Emp3 Rat benzo[a]pyrene increases methylation ISO EMP3 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of EMP3 exon CTD PMID:27901495 Emp3 Rat benzo[a]pyrene decreases methylation ISO EMP3 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of EMP3 3' UTR CTD PMID:27901495 Emp3 Rat benzo[a]pyrene affects methylation ISO EMP3 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of EMP3 promoter CTD PMID:27901495 Emp3 Rat benzo[a]pyrene increases expression ISO EMP3 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of EMP3 mRNA CTD PMID:21632981 more ... Emp3 Rat beta-lapachone increases expression ISO EMP3 (Homo sapiens) 6480464 beta-lapachone results in increased expression of EMP3 mRNA CTD PMID:38218311 Emp3 Rat beta-naphthoflavone increases expression ISO EMP3 (Homo sapiens) 6480464 beta-Naphthoflavone results in increased expression of EMP3 mRNA CTD PMID:19737606 Emp3 Rat bis(2-ethylhexyl) phthalate increases expression ISO EMP3 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of EMP3 mRNA CTD PMID:31163220 Emp3 Rat bis(2-ethylhexyl) phthalate increases expression ISO Emp3 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of EMP3 mRNA CTD PMID:33754040 Emp3 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of EMP3 mRNA CTD PMID:25181051 and PMID:32145629 Emp3 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of EMP3 mRNA CTD PMID:30816183 more ... Emp3 Rat bisphenol A increases expression ISO Emp3 (Mus musculus) 6480464 bisphenol A results in increased expression of EMP3 mRNA CTD PMID:30951980 Emp3 Rat bisphenol A decreases expression ISO EMP3 (Homo sapiens) 6480464 bisphenol A results in decreased expression of EMP3 mRNA CTD PMID:29275510 Emp3 Rat bisphenol F increases expression ISO Emp3 (Mus musculus) 6480464 bisphenol F results in increased expression of EMP3 mRNA CTD PMID:30951980 Emp3 Rat calcitriol decreases expression ISO EMP3 (Homo sapiens) 6480464 Calcitriol results in decreased expression of EMP3 mRNA CTD PMID:26485663 Emp3 Rat carbon nanotube increases expression ISO Emp3 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Emp3 Rat chlordecone increases expression ISO Emp3 (Mus musculus) 6480464 Chlordecone results in increased expression of EMP3 mRNA CTD PMID:33711761 Emp3 Rat chloropicrin decreases expression ISO EMP3 (Homo sapiens) 6480464 chloropicrin results in decreased expression of EMP3 mRNA CTD PMID:26352163 Emp3 Rat chloroprene decreases expression ISO Emp3 (Mus musculus) 6480464 Chloroprene results in decreased expression of EMP3 mRNA CTD PMID:23125180 Emp3 Rat cisplatin increases expression ISO EMP3 (Homo sapiens) 6480464 Cisplatin results in increased expression of EMP3 mRNA and Cisplatin results in increased expression of EMP3 protein CTD PMID:21278888 and PMID:27594783 Emp3 Rat cisplatin affects expression ISO EMP3 (Homo sapiens) 6480464 Cisplatin affects the expression of EMP3 mRNA CTD PMID:23300844 Emp3 Rat cisplatin increases expression ISO Emp3 (Mus musculus) 6480464 Cisplatin results in increased expression of EMP3 mRNA CTD PMID:21151649 Emp3 Rat cisplatin affects response to substance ISO EMP3 (Homo sapiens) 6480464 EMP3 protein affects the susceptibility to Cisplatin CTD PMID:16217747 Emp3 Rat copper(II) sulfate increases expression ISO EMP3 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of EMP3 mRNA CTD PMID:19549813 Emp3 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of EMP3 mRNA CTD PMID:26577399 Emp3 Rat cyclophosphamide increases expression ISO EMP3 (Homo sapiens) 6480464 Cyclophosphamide results in increased expression of EMP3 mRNA CTD PMID:21527772 Emp3 Rat cyclosporin A increases expression ISO EMP3 (Homo sapiens) 6480464 Cyclosporine results in increased expression of EMP3 mRNA CTD PMID:20106945 more ... Emp3 Rat diarsenic trioxide decreases expression ISO EMP3 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of EMP3 mRNA CTD PMID:20458559 Emp3 Rat Dibutyl phosphate affects expression ISO EMP3 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of EMP3 mRNA CTD PMID:37042841 Emp3 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of EMP3 mRNA CTD PMID:17379624 Emp3 Rat dicrotophos decreases expression ISO EMP3 (Homo sapiens) 6480464 dicrotophos results in decreased expression of EMP3 mRNA CTD PMID:28302478 Emp3 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of EMP3 mRNA CTD PMID:25152437 Emp3 Rat doxorubicin decreases expression ISO EMP3 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of EMP3 mRNA CTD PMID:29803840 Emp3 Rat elemental selenium increases expression ISO EMP3 (Homo sapiens) 6480464 Selenium results in increased expression of EMP3 mRNA CTD PMID:19244175 Emp3 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of EMP3 mRNA CTD PMID:29391264 Emp3 Rat epoxiconazole decreases expression ISO Emp3 (Mus musculus) 6480464 epoxiconazole results in decreased expression of EMP3 mRNA CTD PMID:35436446 Emp3 Rat etoposide increases expression ISO EMP3 (Homo sapiens) 6480464 Etoposide results in increased expression of EMP3 mRNA CTD PMID:21527772 Emp3 Rat fluvastatin multiple interactions ISO EMP3 (Homo sapiens) 6480464 [zoledronic acid co-treated with fluvastatin] results in increased expression of EMP3 mRNA CTD PMID:16996129 Emp3 Rat folic acid decreases expression ISO Emp3 (Mus musculus) 6480464 Folic Acid results in decreased expression of EMP3 mRNA CTD PMID:25629700 Emp3 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of EMP3 mRNA CTD PMID:22061828 Emp3 Rat hydralazine multiple interactions ISO EMP3 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of EMP3 mRNA CTD PMID:17183730 Emp3 Rat indole-3-methanol affects expression EXP 6480464 indole-3-carbinol affects the expression of EMP3 mRNA CTD PMID:21396975 Emp3 Rat iron dichloride increases expression ISO EMP3 (Homo sapiens) 6480464 ferrous chloride results in increased expression of EMP3 mRNA CTD PMID:35984750 Emp3 Rat ivermectin decreases expression ISO EMP3 (Homo sapiens) 6480464 Ivermectin results in decreased expression of EMP3 protein CTD PMID:32959892 Emp3 Rat L-ascorbic acid multiple interactions ISO EMP3 (Homo sapiens) 6480464 [Quercetin co-treated with Ascorbic Acid] results in increased expression of EMP3 mRNA CTD PMID:17639512 Emp3 Rat lidocaine increases expression EXP 6480464 Lidocaine results in increased expression of EMP3 mRNA CTD PMID:35283115 Emp3 Rat methyl methanesulfonate increases expression ISO EMP3 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of EMP3 mRNA CTD PMID:21527772 Emp3 Rat methyl methanesulfonate decreases expression ISO EMP3 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of EMP3 mRNA CTD PMID:23649840 Emp3 Rat N-methyl-4-phenylpyridinium increases expression ISO EMP3 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of EMP3 mRNA CTD PMID:24810058 Emp3 Rat nickel atom increases expression ISO EMP3 (Homo sapiens) 6480464 Nickel results in increased expression of EMP3 mRNA CTD PMID:25583101 Emp3 Rat ochratoxin A increases expression EXP 6480464 ochratoxin A results in increased expression of EMP3 mRNA CTD PMID:19717638 Emp3 Rat p-menthan-3-ol increases expression ISO EMP3 (Homo sapiens) 6480464 Menthol results in increased expression of EMP3 mRNA CTD PMID:26760959 Emp3 Rat paclitaxel increases expression ISO EMP3 (Homo sapiens) 6480464 Paclitaxel results in increased expression of EMP3 mRNA CTD PMID:19682730 Emp3 Rat paracetamol affects expression ISO Emp3 (Mus musculus) 6480464 Acetaminophen affects the expression of EMP3 mRNA CTD PMID:17562736 Emp3 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of EMP3 mRNA CTD PMID:33387578 Emp3 Rat perfluorohexanesulfonic acid increases expression ISO Emp3 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of EMP3 mRNA CTD PMID:37995155 Emp3 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of EMP3 mRNA CTD PMID:35163327 Emp3 Rat pirinixic acid multiple interactions ISO EMP3 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of EMP3 mRNA CTD PMID:19710929 Emp3 Rat quercetin multiple interactions ISO EMP3 (Homo sapiens) 6480464 [Quercetin co-treated with Ascorbic Acid] results in increased expression of EMP3 mRNA CTD PMID:17639512 Emp3 Rat quercetin increases expression ISO EMP3 (Homo sapiens) 6480464 Quercetin results in increased expression of EMP3 mRNA CTD PMID:21632981 Emp3 Rat quinolin-8-ol increases expression ISO EMP3 (Homo sapiens) 6480464 Oxyquinoline results in increased expression of EMP3 mRNA CTD PMID:21632981 Emp3 Rat Salinomycin decreases expression ISO EMP3 (Homo sapiens) 6480464 salinomycin results in decreased expression of EMP3 mRNA CTD PMID:19682730 Emp3 Rat selenium atom increases expression ISO EMP3 (Homo sapiens) 6480464 Selenium results in increased expression of EMP3 mRNA CTD PMID:19244175 Emp3 Rat silicon dioxide increases expression ISO EMP3 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of EMP3 mRNA CTD PMID:25895662 Emp3 Rat sodium arsenite decreases expression ISO EMP3 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of EMP3 mRNA CTD PMID:38568856 Emp3 Rat Soman increases expression EXP 6480464 Soman results in increased expression of EMP3 mRNA CTD PMID:19281266 Emp3 Rat sulforaphane decreases expression ISO EMP3 (Homo sapiens) 6480464 sulforaphane results in decreased expression of EMP3 mRNA CTD PMID:31838189 Emp3 Rat sunitinib decreases expression ISO EMP3 (Homo sapiens) 6480464 Sunitinib results in decreased expression of EMP3 mRNA CTD PMID:31533062 Emp3 Rat tert-butyl hydroperoxide increases expression ISO Emp3 (Mus musculus) 6480464 tert-Butylhydroperoxide results in increased expression of EMP3 mRNA CTD PMID:15003993 Emp3 Rat testosterone decreases expression ISO Emp3 (Mus musculus) 6480464 Testosterone results in decreased expression of EMP3 mRNA CTD PMID:19693291 Emp3 Rat tetrachloromethane increases expression ISO Emp3 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of EMP3 mRNA CTD PMID:27339419 and PMID:31919559 Emp3 Rat tetradecane decreases expression EXP 6480464 n-tetradecane results in decreased expression of EMP3 protein CTD PMID:17337753 Emp3 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of EMP3 mRNA CTD PMID:34492290 Emp3 Rat triphenyl phosphate affects expression ISO EMP3 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of EMP3 mRNA CTD PMID:37042841 Emp3 Rat tunicamycin increases expression ISO EMP3 (Homo sapiens) 6480464 Tunicamycin results in increased expression of EMP3 mRNA CTD PMID:29453283 Emp3 Rat valproic acid multiple interactions ISO EMP3 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of EMP3 mRNA CTD PMID:17183730 Emp3 Rat valproic acid increases expression ISO Emp3 (Mus musculus) 6480464 Valproic Acid results in increased expression of EMP3 mRNA CTD PMID:24896083 Emp3 Rat valproic acid decreases expression ISO EMP3 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of EMP3 mRNA CTD PMID:23179753 more ... Emp3 Rat vancomycin decreases expression ISO Emp3 (Mus musculus) 6480464 Vancomycin results in decreased expression of EMP3 mRNA CTD PMID:18930951 Emp3 Rat vitamin E increases expression ISO EMP3 (Homo sapiens) 6480464 Vitamin E results in increased expression of EMP3 mRNA CTD PMID:19244175 Emp3 Rat zoledronic acid multiple interactions ISO EMP3 (Homo sapiens) 6480464 [zoledronic acid co-treated with fluvastatin] results in increased expression of EMP3 mRNA CTD PMID:16996129 Emp3 Rat zoledronic acid increases expression ISO EMP3 (Homo sapiens) 6480464 zoledronic acid results in increased expression of EMP3 mRNA CTD PMID:20977926
1,1-dichloroethene (ISO) 1,2,4-trimethylbenzene (EXP) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (ISO) 5-fluorouracil (ISO) 7,12-dimethyltetraphene (ISO) acetamide (EXP) actinomycin D (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) ammonium chloride (EXP) aristolochic acid A (ISO) aristolochic acids (EXP) Aroclor 1254 (ISO) arsenous acid (ISO) atrazine (ISO) avobenzone (ISO) azathioprine (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) beta-naphthoflavone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) calcitriol (ISO) carbon nanotube (ISO) chlordecone (ISO) chloropicrin (ISO) chloroprene (ISO) cisplatin (ISO) copper(II) sulfate (ISO) Cuprizon (EXP) cyclophosphamide (ISO) cyclosporin A (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP) dicrotophos (ISO) diuron (EXP) doxorubicin (ISO) elemental selenium (ISO) endosulfan (EXP) epoxiconazole (ISO) etoposide (ISO) fluvastatin (ISO) folic acid (ISO) gentamycin (EXP) hydralazine (ISO) indole-3-methanol (EXP) iron dichloride (ISO) ivermectin (ISO) L-ascorbic acid (ISO) lidocaine (EXP) methyl methanesulfonate (ISO) N-methyl-4-phenylpyridinium (ISO) nickel atom (ISO) ochratoxin A (EXP) p-menthan-3-ol (ISO) paclitaxel (ISO) paracetamol (EXP,ISO) perfluorohexanesulfonic acid (ISO) perfluorooctanoic acid (EXP) pirinixic acid (ISO) quercetin (ISO) quinolin-8-ol (ISO) Salinomycin (ISO) selenium atom (ISO) silicon dioxide (ISO) sodium arsenite (ISO) Soman (EXP) sulforaphane (ISO) sunitinib (ISO) tert-butyl hydroperoxide (ISO) testosterone (ISO) tetrachloromethane (ISO) tetradecane (EXP) thioacetamide (EXP) triphenyl phosphate (ISO) tunicamycin (ISO) valproic acid (ISO) vancomycin (ISO) vitamin E (ISO) zoledronic acid (ISO)
Emp3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 105,525,086 - 105,528,370 (-) NCBI GRCr8 mRatBN7.2 1 96,388,651 - 96,391,946 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 96,388,652 - 96,391,988 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 101,774,797 - 101,777,974 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 110,246,785 - 110,249,962 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 103,537,150 - 103,540,327 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 101,900,731 - 101,903,948 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 101,900,733 - 101,903,910 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 102,979,695 - 102,982,874 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 96,389,783 - 96,392,960 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 96,467,893 - 96,471,071 (-) NCBI Celera 1 90,641,302 - 90,644,479 (-) NCBI Celera Cytogenetic Map 1 q22 NCBI
EMP3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 48,325,552 - 48,330,553 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 48,321,310 - 48,330,559 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 48,828,809 - 48,833,810 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 53,520,454 - 53,525,622 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 53,520,453 - 53,525,622 NCBI Celera 19 45,693,863 - 45,699,044 (+) NCBI Celera Cytogenetic Map 19 q13.33 NCBI HuRef 19 45,209,377 - 45,214,558 (+) NCBI HuRef CHM1_1 19 48,830,732 - 48,835,916 (+) NCBI CHM1_1 T2T-CHM13v2.0 19 51,319,698 - 51,324,699 (+) NCBI T2T-CHM13v2.0
Emp3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 45,567,447 - 45,570,850 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 45,567,447 - 45,570,828 (-) Ensembl GRCm39 Ensembl GRCm38 7 45,918,023 - 45,921,426 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 45,918,023 - 45,921,404 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 53,173,393 - 53,176,796 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 45,786,106 - 45,789,446 (-) NCBI MGSCv36 mm8 Celera 7 41,383,035 - 41,386,440 (-) NCBI Celera Cytogenetic Map 7 B3 NCBI cM Map 7 29.6 NCBI
Emp3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955559 2,117,200 - 2,121,366 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955559 2,117,200 - 2,121,366 (-) NCBI ChiLan1.0 ChiLan1.0
EMP3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 54,429,929 - 54,435,117 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 56,356,040 - 56,361,407 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 45,326,302 - 45,331,462 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 53,919,933 - 53,925,147 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 53,919,986 - 53,925,147 (+) Ensembl panpan1.1 panPan2
EMP3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 107,901,778 - 107,905,912 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 107,901,781 - 107,905,619 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 107,423,282 - 107,427,399 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 108,426,213 - 108,430,346 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 108,426,216 - 108,430,232 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 108,092,642 - 108,096,761 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 107,739,405 - 107,743,526 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 108,575,501 - 108,579,626 (-) NCBI UU_Cfam_GSD_1.0
Emp3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409349 20,850,007 - 20,853,482 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936664 2,468,269 - 2,471,675 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936664 2,467,240 - 2,471,672 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
EMP3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 53,757,776 - 53,761,833 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 53,757,513 - 53,761,833 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 49,394,027 - 49,398,349 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
EMP3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 6 41,591,145 - 41,596,723 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 6 41,591,020 - 41,596,951 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666073 21,368,887 - 21,374,758 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Emp3
.
Predicted Target Of
Count of predictions: 58 Count of miRNA genes: 54 Interacting mature miRNAs: 55 Transcripts: ENSRNOT00000028656 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
2313059 Bss55 Bone structure and strength QTL 55 3.2 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 70209 Niddm23 Non-insulin dependent diabetes mellitus QTL 23 2.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 94494440 198324465 Rat 631688 Hcas2 Hepatocarcinoma susceptibility QTL 2 3 0.0001 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 5925874 115540829 Rat 1582234 Gluco18 Glucose level QTL 18 3.4 0.0003 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 78479925 123479925 Rat 1358359 Sradr1 Stress Responsive Adrenal Weight QTL 1 4.74 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 30882023 123479925 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 1331793 Bp200 Blood pressure QTL 200 3.71601 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94494440 172949803 Rat 1578654 Bss10 Bone structure and strength QTL 10 4 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 1 49393172 159356837 Rat 2300324 Fetw1 Fetal weight QTL 1 12.1 0.005 fetal growth trait (VT:0004201) fetal body weight (CMO:0002080) 1 85424647 100358001 Rat 1300121 Hrtrt1 Heart rate QTL 1 3.7 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 65789093 115540829 Rat 1331800 Scl25 Serum cholesterol level QTL 25 3.013 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 1 94494440 117601394 Rat 7421628 Bp361 Blood pressure QTL 361 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 66023617 118608521 Rat 631495 Bp96 Blood pressure QTL 96 4.52 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 22340647 102268831 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 2298545 Neuinf8 Neuroinflammation QTL 8 4.6 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 1 57336763 151090257 Rat 2313072 Bss53 Bone structure and strength QTL 53 4.3 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 43284731 118944897 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 2313078 Bss54 Bone structure and strength QTL 54 3.5 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 1302788 Scl19 Serum cholesterol QTL 19 4.6 0.001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 90532338 123479925 Rat 1549903 Bp267 Blood pressure QTL 267 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 77876254 106047988 Rat 2313083 Bmd74 Bone mineral density QTL 74 4 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 1 82174743 118944897 Rat 2313402 Anxrr24 Anxiety related response QTL 24 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 1 48963584 144267916 Rat 4889494 Scort2 Serum corticosterone level QTL 2 4.2 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 80592172 125592172 Rat 724567 Tcas6 Tongue tumor susceptibility QTL 6 6.85 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 1 92948896 144267916 Rat 61342 Bp27 Blood pressure QTL 27 3.4 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 56732668 98773277 Rat 61344 Bp29 Blood pressure QTL 29 7.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 78350581 123350581 Rat 724521 Uae1 Urinary albumin excretion QTL 1 3.8 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 90508614 173018436 Rat 1358902 Bw47 Body weight QTL 47 1.67 body mass (VT:0001259) body weight (CMO:0000012) 1 90508614 180359386 Rat 1358192 Ept13 Estrogen-induced pituitary tumorigenesis QTL 13 3.4 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 77494165 122494165 Rat 2313094 Bss58 Bone structure and strength QTL 58 3.7 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 43284731 118944897 Rat 2300164 Bmd44 Bone mineral density QTL 44 5.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 1 56949932 101949932 Rat 2313099 Bss56 Bone structure and strength QTL 56 2.4 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 1 43284731 118944897 Rat 2313098 Bmd70 Bone mineral density QTL 70 3.6 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 43284731 118944897 Rat 1300153 Bp171 Blood pressure QTL 171 3.37 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 90664883 143200202 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 738022 Anxrr13 Anxiety related response QTL 13 4.6 0.00039 locomotor behavior trait (VT:0001392) number of 20 x 20 cm floor squares crossed into, out of or within a discrete space in an experimental apparatus (CMO:0001514) 1 83547917 128547917 Rat 152025249 Scl82 Serum cholesterol level QTL 82 4.77 blood cholesterol amount (VT:0000180) 1 50343510 99980958 Rat 10054135 Gmadr2 Adrenal mass QTL 2 1.97 0.0129 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 77857876 122857876 Rat 7411712 Strs4 Sensitivity to stroke QTL 4 8.7 cerebrum integrity trait (VT:0010549) percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932) 1 78430536 123430536 Rat 1331749 Hrtrt11 Heart rate QTL 11 2.973 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 94494440 198211706 Rat 1331751 Bp199 Blood pressure QTL 199 3.60022 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 94494440 181830018 Rat 2293142 Bp314 Blood pressure QTL 314 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 92184926 137184926 Rat 2313051 Bss57 Bone structure and strength QTL 57 3.7 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 43284731 118944897 Rat 724529 Cm16 Cardiac mass QTL 16 2.7 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 1 87580395 150700247 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000028656 ⟹ ENSRNOP00000028656
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 96,388,652 - 96,391,988 (-) Ensembl Rnor_6.0 Ensembl 1 101,900,733 - 101,903,910 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000106496 ⟹ ENSRNOP00000095309
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 96,388,652 - 96,391,750 (-) Ensembl
RefSeq Acc Id:
NM_030847 ⟹ NP_110474
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 105,525,088 - 105,528,265 (-) NCBI mRatBN7.2 1 96,388,654 - 96,391,831 (-) NCBI Rnor_6.0 1 101,900,733 - 101,903,910 (-) NCBI Rnor_5.0 1 102,979,695 - 102,982,874 (-) NCBI RGSC_v3.4 1 96,389,783 - 96,392,960 (-) RGD Celera 1 90,641,302 - 90,644,479 (-) RGD
Sequence:
CGAGGACAGACTCCAACTCTGACTTCTTCAGCGACTCTCGAGACTTCCCGAACCAAGCCGTCTTTCCTCAGACCTTACAGTCCTCCCAGCCTTCCTCTCTGACTTAGAGAGCCAGACCCCAGCCCTCT
hide sequence
RefSeq Acc Id:
XM_006229158 ⟹ XP_006229220
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 105,525,086 - 105,528,216 (-) NCBI mRatBN7.2 1 96,388,652 - 96,391,792 (-) NCBI Rnor_6.0 1 101,900,731 - 101,903,855 (-) NCBI Rnor_5.0 1 102,979,695 - 102,982,874 (-) NCBI
Sequence:
GTTATTCAGATGGGACTTTATTTACTGGGCAGCATGGCACCATGGGTGGGGCACCTCAGGCAGGAAGAAGCCCTCTGCTCTTAGCTCCAGAGGAGAAGTCTGAGACTTCCCGAACCAAGCCGTCTTTC
hide sequence
RefSeq Acc Id:
XM_008759418 ⟹ XP_008757640
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 105,525,086 - 105,528,370 (-) NCBI mRatBN7.2 1 96,388,652 - 96,391,946 (-) NCBI Rnor_6.0 1 101,900,731 - 101,903,948 (-) NCBI
Sequence:
GGAAGGAGGGAGCAGAAGGGCGGGGCAAGAGGCCCAATCGAGGACAGACTCCAACTCTGACTTC
hide sequence
RefSeq Acc Id:
XM_039091912 ⟹ XP_038947840
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 105,525,086 - 105,528,068 (-) NCBI mRatBN7.2 1 96,388,652 - 96,391,663 (-) NCBI
RefSeq Acc Id:
NP_110474 ⟸ NM_030847
- UniProtKB:
Q9QYW5 (UniProtKB/Swiss-Prot), A6JBA1 (UniProtKB/TrEMBL)
- Sequence:
MSLLLLVVSALHILILVLLFVATLDKSWWTLPEKESLNLWYDCTWNTTAKTWACSNVSENGWLKAVQALMVLSLILCCLSFILFMIQLYTMRRGGLFYATGLCQLCTSAAVFSGALIYAIHAKEILAK
hide sequence
RefSeq Acc Id:
XP_006229220 ⟸ XM_006229158
- Peptide Label:
isoform X1
- UniProtKB:
Q9QYW5 (UniProtKB/Swiss-Prot), A6JBA1 (UniProtKB/TrEMBL)
- Sequence:
MSLLLLVVSALHILILVLLFVATLDKSWWTLPEKESLNLWYDCTWNTTAKTWACSNVSENGWLK
hide sequence
RefSeq Acc Id:
XP_008757640 ⟸ XM_008759418
- Peptide Label:
isoform X1
- UniProtKB:
Q9QYW5 (UniProtKB/Swiss-Prot), A6JBA1 (UniProtKB/TrEMBL)
- Sequence:
MSLLLLVVSALHILILVLLFVATLDKSWWTLPEKESLNLWYDCTWNTTAKTWACSNVSENGWLKAVQALMVLSLILCCLSFILFMIQLYTMRRGGLFYATGLCQLCTSAAVFSGALIYAIHAKEILAK
hide sequence
Ensembl Acc Id:
ENSRNOP00000028656 ⟸ ENSRNOT00000028656
RefSeq Acc Id:
XP_038947840 ⟸ XM_039091912
- Peptide Label:
isoform X1
- UniProtKB:
Q9QYW5 (UniProtKB/Swiss-Prot), A6JBA1 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000095309 ⟸ ENSRNOT00000106496
RGD ID: 13690057 Promoter ID: EPDNEW_R582 Type: multiple initiation site Name: Emp3_1 Description: epithelial membrane protein 3 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 101,903,913 - 101,903,973 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-09-10
Emp3
epithelial membrane protein 3
Symbol and Name status set to approved
1299863 APPROVED
2002-08-07
Emp3
epithelial membrane protein 3
Symbol and Name status set to provisional
70820 PROVISIONAL
