Symbol:
Gtf2a2
Name:
general transcription factor 2A subunit 2
RGD ID:
620720
Description:
Predicted to enable several functions, including RNA polymerase II general transcription initiation factor activity; general transcription initiation factor binding activity; and protein dimerization activity. Involved in positive regulation of transcription by RNA polymerase II. Predicted to be located in cytosol and nucleoplasm. Predicted to be part of transcription factor TFIIA complex and transcription factor TFIID complex. Orthologous to human GTF2A2 (general transcription factor IIA subunit 2); PARTICIPATES IN RNA polymerase II transcription initiation pathway; INTERACTS WITH 4-tert-Octylphenol; ammonium chloride; bisphenol A.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
general transcription factor IIa 2; general transcription factor IIA subunit 2; general transcription factor IIA, 2; general transcription factor IIa, 2 (12kD subunit); general transcription factor2A subunit 2; MGC188808; TFIIA-gamma; transcription initiation factor IIA gamma chain; transcription initiation factor IIA subunit 2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 79,542,682 - 79,556,484 (+) NCBI GRCr8 mRatBN7.2 8 70,662,447 - 70,675,576 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 70,662,428 - 70,675,569 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 67,628,292 - 67,628,621 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 67,133,660 - 67,133,989 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 72,311,551 - 72,320,417 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 76,422,341 - 76,435,587 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 76,422,359 - 76,435,473 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 76,640,681 - 76,653,942 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 74,447,866 - 74,456,735 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 74,466,919 - 74,475,789 (+) NCBI Celera 8 71,051,449 - 71,060,316 (-) NCBI Celera Cytogenetic Map 8 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Gtf2a2 Rat (+)-catechin multiple interactions ISO GTF2A2 (Homo sapiens) 6480464 [Catechin co-treated with Grape Seed Proanthocyanidins] results in increased expression of GTF2A2 mRNA CTD PMID:24763279 Gtf2a2 Rat 1,2-dichloroethane decreases expression ISO Gtf2a2 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of GTF2A2 mRNA CTD PMID:28960355 Gtf2a2 Rat 1,2-dimethylhydrazine decreases expression ISO Gtf2a2 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of GTF2A2 mRNA CTD PMID:22206623 Gtf2a2 Rat 1,2-dimethylhydrazine multiple interactions ISO Gtf2a2 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of GTF2A2 mRNA CTD PMID:22206623 Gtf2a2 Rat 17beta-estradiol decreases expression ISO Gtf2a2 (Mus musculus) 6480464 Estradiol results in decreased expression of GTF2A2 mRNA CTD PMID:39298647 Gtf2a2 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Gtf2a2 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Gtf2a2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Gtf2a2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of GTF2A2 mRNA CTD PMID:21889950 Gtf2a2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Gtf2a2 (Mus musculus) 6480464 [TIPARP gene mutant form results in increased susceptibility to Tetrachlorodibenzodioxin] which results in decreased expression of GTF2A2 mRNA CTD PMID:25975270 Gtf2a2 Rat 2-hydroxypropanoic acid decreases expression ISO GTF2A2 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of GTF2A2 mRNA CTD PMID:30851411 Gtf2a2 Rat 4,4'-diaminodiphenylmethane decreases expression ISO Gtf2a2 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of GTF2A2 mRNA CTD PMID:18648102 Gtf2a2 Rat 4-tert-Octylphenol increases expression EXP 6480464 4-tert-octylphenol results in increased expression of GTF2A2 mRNA CTD PMID:17011747 Gtf2a2 Rat acrylamide increases expression ISO GTF2A2 (Homo sapiens) 6480464 Acrylamide results in increased expression of GTF2A2 mRNA CTD PMID:32763439 Gtf2a2 Rat all-trans-retinoic acid decreases expression ISO GTF2A2 (Homo sapiens) 6480464 Tretinoin results in decreased expression of GTF2A2 protein CTD PMID:16646664 Gtf2a2 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of GTF2A2 mRNA CTD PMID:16483693 Gtf2a2 Rat arsenite(3-) multiple interactions ISO GTF2A2 (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to GTF2A2 mRNA] CTD PMID:32406909 Gtf2a2 Rat benzo[a]pyrene increases methylation ISO GTF2A2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of GTF2A2 promoter CTD PMID:27901495 Gtf2a2 Rat beta-lapachone increases expression ISO GTF2A2 (Homo sapiens) 6480464 beta-lapachone results in increased expression of GTF2A2 mRNA CTD PMID:38218311 Gtf2a2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of GTF2A2 mRNA CTD PMID:25181051 and PMID:31129395 Gtf2a2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of GTF2A2 mRNA CTD PMID:34947998 Gtf2a2 Rat bisphenol A increases expression ISO Gtf2a2 (Mus musculus) 6480464 bisphenol A results in increased expression of GTF2A2 mRNA CTD PMID:38074096 Gtf2a2 Rat bisphenol A decreases expression ISO GTF2A2 (Homo sapiens) 6480464 bisphenol A results in decreased expression of GTF2A2 mRNA CTD PMID:29275510 Gtf2a2 Rat bisphenol A increases expression ISO GTF2A2 (Homo sapiens) 6480464 bisphenol A results in increased expression of GTF2A2 mRNA CTD PMID:25047013 Gtf2a2 Rat bisphenol F decreases expression ISO Gtf2a2 (Mus musculus) 6480464 bisphenol F results in decreased expression of GTF2A2 mRNA CTD PMID:38685157 Gtf2a2 Rat carbon nanotube increases expression ISO Gtf2a2 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25620056 Gtf2a2 Rat chloropicrin affects expression ISO GTF2A2 (Homo sapiens) 6480464 chloropicrin affects the expression of GTF2A2 mRNA CTD PMID:26352163 Gtf2a2 Rat ciguatoxin CTX1B affects expression ISO Gtf2a2 (Mus musculus) 6480464 Ciguatoxins affects the expression of GTF2A2 mRNA CTD PMID:18353800 Gtf2a2 Rat Dibutyl phosphate affects expression ISO GTF2A2 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of GTF2A2 mRNA CTD PMID:37042841 Gtf2a2 Rat diethylstilbestrol increases expression EXP 6480464 Diethylstilbestrol results in increased expression of GTF2A2 mRNA CTD PMID:17011747 Gtf2a2 Rat doxorubicin increases expression ISO GTF2A2 (Homo sapiens) 6480464 Doxorubicin results in increased expression of GTF2A2 mRNA CTD PMID:29803840 Gtf2a2 Rat ethanol increases expression EXP 6480464 Ethanol results in increased expression of GTF2A2 mRNA CTD PMID:17920746 Gtf2a2 Rat fipronil decreases expression EXP 6480464 fipronil results in decreased expression of GTF2A2 mRNA CTD PMID:34044035 Gtf2a2 Rat folic acid decreases expression ISO Gtf2a2 (Mus musculus) 6480464 Folic Acid results in decreased expression of GTF2A2 mRNA CTD PMID:25629700 Gtf2a2 Rat folic acid multiple interactions ISO Gtf2a2 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of GTF2A2 mRNA CTD PMID:22206623 Gtf2a2 Rat formaldehyde increases expression ISO GTF2A2 (Homo sapiens) 6480464 Formaldehyde results in increased expression of GTF2A2 mRNA CTD PMID:20655997 Gtf2a2 Rat GW 4064 multiple interactions ISO Gtf2a2 (Mus musculus) 6480464 GW 4064 promotes the reaction [NR1H4 protein binds to GTF2A2 gene] CTD PMID:20091679 Gtf2a2 Rat ivermectin decreases expression ISO GTF2A2 (Homo sapiens) 6480464 Ivermectin results in decreased expression of GTF2A2 protein CTD PMID:32959892 Gtf2a2 Rat lead diacetate decreases expression EXP 6480464 lead acetate results in decreased expression of GTF2A2 mRNA CTD PMID:22641619 Gtf2a2 Rat lead(0) affects expression ISO GTF2A2 (Homo sapiens) 6480464 Lead affects the expression of GTF2A2 mRNA CTD PMID:28903495 Gtf2a2 Rat ozone multiple interactions ISO GTF2A2 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of GTF2A2 mRNA CTD PMID:35430440 Gtf2a2 Rat p-tert-Amylphenol increases expression EXP 6480464 4-tert-octylphenol results in increased expression of GTF2A2 mRNA CTD PMID:17011747 Gtf2a2 Rat paclitaxel increases expression EXP 6480464 Paclitaxel analog results in increased expression of GTF2A2 mRNA and Paclitaxel results in increased expression of GTF2A2 mRNA CTD PMID:15585946 Gtf2a2 Rat pirinixic acid multiple interactions ISO Gtf2a2 (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of GTF2A2 mRNA CTD PMID:19710929 Gtf2a2 Rat rac-lactic acid decreases expression ISO GTF2A2 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of GTF2A2 mRNA CTD PMID:30851411 Gtf2a2 Rat rotenone increases expression ISO GTF2A2 (Homo sapiens) 6480464 Rotenone results in increased expression of GTF2A2 mRNA CTD PMID:33512557 Gtf2a2 Rat sodium arsenite affects expression ISO GTF2A2 (Homo sapiens) 6480464 sodium arsenite affects the expression of GTF2A2 mRNA CTD PMID:29319823 Gtf2a2 Rat tanespimycin increases expression ISO GTF2A2 (Homo sapiens) 6480464 tanespimycin analog results in increased expression of GTF2A2 protein CTD PMID:31370342 Gtf2a2 Rat testosterone decreases expression ISO GTF2A2 (Homo sapiens) 6480464 Testosterone results in decreased expression of GTF2A2 mRNA CTD PMID:33359661 Gtf2a2 Rat tetrachloromethane increases expression ISO Gtf2a2 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of GTF2A2 mRNA CTD PMID:31919559 Gtf2a2 Rat topiramate increases expression EXP 6480464 topiramate results in increased expression of GTF2A2 mRNA CTD PMID:16979414 Gtf2a2 Rat triptonide affects expression ISO Gtf2a2 (Mus musculus) 6480464 triptonide affects the expression of GTF2A2 mRNA CTD PMID:33045310 Gtf2a2 Rat tungsten increases expression ISO Gtf2a2 (Mus musculus) 6480464 Tungsten results in increased expression of GTF2A2 mRNA CTD PMID:30912803 Gtf2a2 Rat valproic acid decreases methylation ISO GTF2A2 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of GTF2A2 gene CTD PMID:29154799 Gtf2a2 Rat valproic acid increases expression ISO GTF2A2 (Homo sapiens) 6480464 Valproic Acid results in increased expression of GTF2A2 mRNA CTD PMID:23179753 Gtf2a2 Rat valproic acid affects expression ISO GTF2A2 (Homo sapiens) 6480464 Valproic Acid affects the expression of GTF2A2 mRNA CTD PMID:25979313 Gtf2a2 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of GTF2A2 mRNA CTD PMID:23034163
(+)-catechin (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2-hydroxypropanoic acid (ISO) 4,4'-diaminodiphenylmethane (ISO) 4-tert-Octylphenol (EXP) acrylamide (ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP) arsenite(3-) (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) carbon nanotube (ISO) chloropicrin (ISO) ciguatoxin CTX1B (ISO) Dibutyl phosphate (ISO) diethylstilbestrol (EXP) doxorubicin (ISO) ethanol (EXP) fipronil (EXP) folic acid (ISO) formaldehyde (ISO) GW 4064 (ISO) ivermectin (ISO) lead diacetate (EXP) lead(0) (ISO) ozone (ISO) p-tert-Amylphenol (EXP) paclitaxel (EXP) pirinixic acid (ISO) rac-lactic acid (ISO) rotenone (ISO) sodium arsenite (ISO) tanespimycin (ISO) testosterone (ISO) tetrachloromethane (ISO) topiramate (EXP) triptonide (ISO) tungsten (ISO) valproic acid (ISO) vinclozolin (EXP)
Gtf2a2 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 79,542,682 - 79,556,484 (+) NCBI GRCr8 mRatBN7.2 8 70,662,447 - 70,675,576 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 70,662,428 - 70,675,569 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 67,628,292 - 67,628,621 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 67,133,660 - 67,133,989 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 72,311,551 - 72,320,417 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 76,422,341 - 76,435,587 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 76,422,359 - 76,435,473 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 76,640,681 - 76,653,942 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 74,447,866 - 74,456,735 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 74,466,919 - 74,475,789 (+) NCBI Celera 8 71,051,449 - 71,060,316 (-) NCBI Celera Cytogenetic Map 8 q24 NCBI
GTF2A2 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 15 59,638,062 - 59,657,515 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 15 59,638,062 - 59,657,541 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 15 59,930,261 - 59,949,714 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 15 57,718,358 - 57,736,987 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 15 57,718,357 - 57,736,985 NCBI Celera 15 36,818,236 - 36,837,689 (-) NCBI Celera Cytogenetic Map 15 q22.2 NCBI HuRef 15 36,752,262 - 36,771,682 (-) NCBI HuRef CHM1_1 15 60,048,219 - 60,067,695 (-) NCBI CHM1_1 T2T-CHM13v2.0 15 57,439,769 - 57,459,225 (-) NCBI T2T-CHM13v2.0
Gtf2a2 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 69,919,830 - 69,930,148 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 69,919,832 - 69,930,148 (+) Ensembl GRCm39 Ensembl GRCm38 9 70,012,548 - 70,022,866 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 70,012,550 - 70,022,866 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 69,860,357 - 69,870,654 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 69,811,714 - 69,822,011 (+) NCBI MGSCv36 mm8 Celera 9 67,229,001 - 67,239,301 (+) NCBI Celera Cytogenetic Map 9 D NCBI cM Map 9 39.18 NCBI
Gtf2a2 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955450 15,181,824 - 15,195,594 (+) NCBI ChiLan1.0 ChiLan1.0
GTF2A2 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 16 48,902,349 - 48,922,048 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 15 53,085,842 - 53,104,641 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 15 38,608,360 - 38,627,156 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 15 56,913,452 - 56,932,051 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 15 56,913,452 - 56,932,052 (-) Ensembl panpan1.1 panPan2
GTF2A2 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 30 24,502,825 - 24,522,248 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 30 24,484,701 - 24,522,207 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 30 24,476,918 - 24,496,309 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 30 24,671,512 - 24,691,163 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 30 24,671,512 - 24,691,398 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 30 24,597,440 - 24,616,848 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 30 24,679,848 - 24,699,256 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 30 24,867,205 - 24,886,587 (-) NCBI UU_Cfam_GSD_1.0
Gtf2a2 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 102,788,934 - 102,803,926 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936471 20,636,202 - 20,652,013 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936471 20,636,997 - 20,651,986 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
GTF2A2 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 112,390,594 - 112,402,265 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 112,371,276 - 112,399,541 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 124,288,264 - 124,316,522 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
GTF2A2 (Chlorocebus sabaeus - green monkey)
Gtf2a2 (Heterocephalus glaber - naked mole-rat)
.
Assembly: RGSC_v3.4
Chromosome
Start Pos
End Pos
Reference Nucleotide
Variant Nucleotide
Variant Type
Strain
Variant Page
8
74447873
74447874
A
G
snv
WN/N (KNAW) , MR/N (KNAW), M520/N (KNAW), LE/Stm (KNAW), FHL/EurMcwi (MCW), ACI/N (KNAW), SS/JrHsdMcwi (MCW), ACI/EurMcwi (MCW), FHH/EurMcwi (MCW), BUF/N (KNAW)
View more Information
8
74447918
74447919
G
A
snv
ACI/EurMcwi (MCW) , FHL/EurMcwi (MCW)
View more Information
8
74449130
74449131
A
G
snv
LCR/2Mco (UMich) , HCR/2Mco (UMich), LCR/1Mco (UMich), HCR/1Mco (UMich), FHL/EurMcwi (MCW), ACI/EurMcwi (MCW)
View more Information
8
74449161
74449162
A
T
snv
ACI/EurMcwi (MCW) , FHL/EurMcwi (MCW), M520/N (KNAW), LCR/2Mco (UMich), LCR/1Mco (UMich), HCR/1Mco (UMich), HCR/2Mco (UMich)
View more Information
8
74449171
74449172
A
C
snv
SS/JrHsdMcwi (MCW) , ACI/N (KNAW), BN/SsN (KNAW), BN/NHsdMcwi (KNAW), ACI/EurMcwi (MCW), LE/Stm (KNAW), M520/N (KNAW), FHL/EurMcwi (MCW), F344/NRrrc (KNAW)
View more Information
Assembly: Rnor_5.0
Assembly: Rnor_6.0
Predicted Target Of
Count of predictions: 170 Count of miRNA genes: 124 Interacting mature miRNAs: 134 Transcripts: ENSRNOT00000014706 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
1298065 Scl16 Serum cholesterol level QTL 16 3.8 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30856404 75856404 Rat 1554321 Bmd3 Bone mineral density QTL 3 7.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 40952565 123900184 Rat 1578769 Uae31 Urinary albumin excretion QTL 31 3.3 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 30848154 101699754 Rat 1298079 Activ2 Activity QTL 2 9.5 0.000001 voluntary movement trait (VT:0003491) rearing measurement (CMO:0001515) 8 41866876 86866876 Rat 70161 Bp62 Blood pressure QTL 62 2.9 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 42692684 90165460 Rat 1578765 Klgr1 Kidney lesion grade QTL 1 3.3 0.0001 kidney morphology trait (VT:0002135) organ lesion measurement (CMO:0000677) 8 30848154 101699754 Rat 1582222 Epfw2 Epididymal fat weight QTL 2 3.2 0.0005 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 8 31737729 76737729 Rat 61464 Niddm11 Non-insulin dependent diabetes mellitus QTL 11 3.1 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 35582032 80582032 Rat 4889938 Bss89 Bone structure and strength QTL 89 3.8 tibia size trait (VT:0100001) tibia cortical bone volume (CMO:0001725) 8 50095249 82460899 Rat 1578755 Pur5 Proteinuria QTL 5 3.3 0.0001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 8 30848154 101699754 Rat 1300146 Rf17 Renal function QTL 17 2.9 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 8 28242912 73242912 Rat 8662823 Vetf5 Vascular elastic tissue fragility QTL 5 1.9 artery integrity trait (VT:0010639) patent ductus arteriosus score (CMO:0002566) 8 28242912 99525068 Rat 2313088 Bss75 Bone structure and strength QTL 75 3.1 0.0001 body length (VT:0001256) body length, nose to rump (CMO:0000079) 8 30848154 82460899 Rat 631210 Bw3 Body weight QTL3 5.9 mesenteric fat pad mass (VT:0010427) mesenteric fat pad weight to body weight ratio (CMO:0000654) 8 69349194 112783834 Rat 1358896 Bp262 Blood pressure QTL 262 2.89 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 27205715 99103503 Rat 731182 Uae24 Urinary albumin excretion QTL 24 6.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 19331152 93965294 Rat 737824 Hcar10 Hepatocarcinoma resistance QTL 10 2.9 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 8 40713066 82925667 Rat 1331769 Rf39 Renal function QTL 39 3.871 urine output (VT:0003620) timed urine volume (CMO:0000260) 8 41866876 75097878 Rat 61358 Bp39 Blood pressure QTL 39 2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 35551938 80551938 Rat 1358906 Bp253 Blood pressure QTL 253 4 0.0004 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 40713066 93965294 Rat 1358907 Cm40 Cardiac mass QTL 40 1.89 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 27205715 99103503 Rat 70197 BpQTLcluster8 Blood pressure QTL cluster 8 3.482 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 46531639 119088626 Rat 2316950 Scl66 Serum cholesterol level QTL 66 4.1 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30848259 105647037 Rat 1582254 Kidm31 Kidney mass QTL 31 3 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 8 54237644 85365202 Rat 10402857 Bp380 Blood pressure QTL 380 0.95 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 53968765 98968765 Rat 1358892 Kidm26 Kidney mass QTL 26 3.69 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 27205715 99103503 Rat 5684973 Bss100 Bone structure and strength QTL 100 4.7 tibia area (VT:1000281) tibia area measurement (CMO:0001382) 8 50095249 82460899 Rat 1582243 Bw66 Body weight QTL 66 3.4 0.0048 body mass (VT:0001259) body weight (CMO:0000012) 8 54237644 85365202 Rat 2313057 Bss76 Bone structure and strength QTL 76 3 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 8 30848154 82460899 Rat 12879878 Bw183 Body weight QTL 183 0.001 body mass (VT:0001259) body weight (CMO:0000012) 8 43296169 98968765 Rat 1300177 Cm2 Cardiac mass QTL 2 3.65 heart mass (VT:0007028) heart weight (CMO:0000017) 8 54259986 100382532 Rat 1549908 Neudeg1 Neurodegradation QTL 1 5.5 0 nervous system integrity trait (VT:0010566) logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986) 8 30188867 94457446 Rat 12879879 Cm99 Cardiac mass QTL 99 0.001 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 43296169 98968765 Rat 2313067 Bss77 Bone structure and strength QTL 77 3.1 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 8 30848154 82460899 Rat 12879880 Cm100 Cardiac mass QTL 100 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 8 43296169 98968765 Rat 12879881 Cm101 Cardiac mass QTL 101 0.001 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 8 43296169 98968765 Rat 12879882 Am8 Aortic mass QTL 8 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 8 43296169 98968765 Rat 12879883 Kidm65 Kidney mass QTL 65 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 43296169 98968765 Rat 1358912 Bw51 Body weight QTL 51 2.95 body mass (VT:0001259) body weight (CMO:0000012) 8 51351728 107062046 Rat 1300171 Bp184 Blood pressure QTL 184 3.66 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 8 70513503 118219066 Rat 2313086 Bss60 Bone structure and strength QTL 60 4.1 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 8 50095249 82460899 Rat 2303171 Bp331 Blood pressure QTL 331 5.57 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 61290298 119084929 Rat 2293697 Bmd39 Bone mineral density QTL 39 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 8 54043744 98968765 Rat 1331837 Bw23 Body weight QTL 23 4.19 0.00007 body mass (VT:0001259) body weight (CMO:0000012) 8 46531722 99083736 Rat 1331838 Niddm61 Non-insulin dependent diabetes mellitus QTL 61 3.53 0.0004 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 36469535 99083736 Rat 631650 Stl6 Serum triglyceride level QTL 6 4 0.0019 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 10378157 112202585 Rat 631653 Bp125 Blood pressure QTL 125 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 66142385 111142385 Rat 1581557 Eae16 Experimental allergic encephalomyelitis QTL 16 3.8 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 8 8462195 110921472 Rat 631271 Lecl1 Lens clarity QTL 1 0.001 lens clarity trait (VT:0001304) age of onset/diagnosis of cataract (CMO:0001584) 8 18984168 84531599 Rat 2303564 Gluco43 Glucose level QTL 43 3 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 8 26130187 71130187 Rat 2303570 Gluco48 Glucose level QTL 48 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 8 49805831 94805831 Rat 2313046 Bss78 Bone structure and strength QTL 78 3.5 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 8 30848154 82460899 Rat 2303572 Insul13 Insulin level QTL 13 2 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 8 26130187 71130187 Rat 2301402 Bp316 Blood pressure QTL 316 0.005 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 53968765 98968765 Rat 631664 Hcar3 Hepatocarcinoma resistance QTL 3 2.9 0.0005 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 8 54237644 99103503 Rat
RH128620
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 70,675,419 - 70,675,611 (+) MAPPER mRatBN7.2 Rnor_6.0 8 76,435,325 - 76,435,516 NCBI Rnor6.0 Rnor_5.0 8 76,640,752 - 76,640,943 UniSTS Rnor5.0 RGSC_v3.4 8 74,456,857 - 74,457,048 UniSTS RGSC3.4 Celera 8 71,051,136 - 71,051,327 UniSTS Cytogenetic Map 8 q24 UniSTS
BF390041
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 70,671,233 - 70,671,355 (+) MAPPER mRatBN7.2 Rnor_6.0 8 76,431,139 - 76,431,260 NCBI Rnor6.0 Rnor_5.0 8 76,645,008 - 76,645,129 UniSTS Rnor5.0 RGSC_v3.4 8 74,452,671 - 74,452,792 UniSTS RGSC3.4 Celera 8 71,055,392 - 71,055,513 UniSTS Cytogenetic Map 8 q24 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
3
11
43
82
57
60
41
19
41
160
73
74
35
41
19
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000084148 ⟹ ENSRNOP00000071778
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 70,662,456 - 70,675,569 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000085496 ⟹ ENSRNOP00000068825
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 70,662,428 - 70,675,568 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000112984 ⟹ ENSRNOP00000077033
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 70,662,428 - 70,675,302 (+) Ensembl
RefSeq Acc Id:
NM_001412186 ⟹ NP_001399115
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 79,543,355 - 79,556,484 (+) NCBI mRatBN7.2 8 70,662,447 - 70,675,576 (+) NCBI
RefSeq Acc Id:
NM_053345 ⟹ NP_445797
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 79,543,355 - 79,556,484 (+) NCBI mRatBN7.2 8 70,662,447 - 70,675,576 (+) NCBI Rnor_6.0 8 76,426,335 - 76,435,203 (+) NCBI Rnor_5.0 8 76,640,681 - 76,653,942 (-) NCBI RGSC_v3.4 8 74,447,866 - 74,456,735 (+) RGD Celera 8 71,051,449 - 71,060,316 (-) RGD
Sequence:
ATGGCATATCAGTTATACAGAAATACAACTTTGGGGAACAGTCTTCAAGAGAGCCTTGATGAGCTCATACAGTCTCAACAGATCACCCCCCAGCTTGCCCTTCAAGTTCTACTTCAGTTTGATAAAGC TATAAATTCAGCATTGGCTCAGAGAGTCAGGAACAGAGTCAATTTCAGGGGCTCTCTAAATACATACAGATTCTGCGATAATGTTTGGACTTTTGTATTGAATGATGTTGAATTCAGAGAGGTGACAG AACTTATTAAAGTGGATAAAGTGAAAATTGTAGCCTGTGATGGTAAAAATACCGGTTCCAATACCACGGAATGA
hide sequence
RefSeq Acc Id:
NR_178067
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 79,543,355 - 79,556,484 (+) NCBI mRatBN7.2 8 70,662,447 - 70,675,576 (+) NCBI
RefSeq Acc Id:
XM_039082206 ⟹ XP_038938134
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 79,543,499 - 79,556,484 (+) NCBI mRatBN7.2 8 70,665,433 - 70,675,576 (+) NCBI
RefSeq Acc Id:
XM_063266219 ⟹ XP_063122289
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 79,542,682 - 79,556,484 (+) NCBI
RefSeq Acc Id:
XM_063266220 ⟹ XP_063122290
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 79,543,479 - 79,556,484 (+) NCBI
RefSeq Acc Id:
XM_063266221 ⟹ XP_063122291
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 79,542,682 - 79,553,345 (+) NCBI
RefSeq Acc Id:
XM_063266222 ⟹ XP_063122292
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 79,542,682 - 79,552,438 (+) NCBI
RefSeq Acc Id:
NP_445797 ⟸ NM_053345
- UniProtKB:
O08950 (UniProtKB/Swiss-Prot), A6KEU8 (UniProtKB/TrEMBL), A6KEU9 (UniProtKB/TrEMBL)
- Sequence:
MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINSALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE
hide sequence
RefSeq Acc Id:
XP_038938134 ⟸ XM_039082206
- Peptide Label:
isoform X2
- UniProtKB:
O08950 (UniProtKB/Swiss-Prot), A6KEU8 (UniProtKB/TrEMBL), A6KEU9 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000071778 ⟸ ENSRNOT00000084148
Ensembl Acc Id:
ENSRNOP00000068825 ⟸ ENSRNOT00000085496
Ensembl Acc Id:
ENSRNOP00000077033 ⟸ ENSRNOT00000112984
RefSeq Acc Id:
NP_001399115 ⟸ NM_001412186
- UniProtKB:
O08950 (UniProtKB/Swiss-Prot), A6KEU8 (UniProtKB/TrEMBL), A6KEU9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063122289 ⟸ XM_063266219
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_063122291 ⟸ XM_063266221
- Peptide Label:
isoform X3
- UniProtKB:
B5DEM4 (UniProtKB/TrEMBL), A6KEV1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063122292 ⟸ XM_063266222
- Peptide Label:
isoform X3
- UniProtKB:
B5DEM4 (UniProtKB/TrEMBL), A6KEV1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063122290 ⟸ XM_063266220
- Peptide Label:
isoform X1
RGD ID: 13696105
Promoter ID: EPDNEW_R6627
Type: multiple initiation site
Name: LOC103695118_1
Description: transcription initiation factor IIA subunit 2
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 8 76,422,353 - 76,422,413 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2017-05-18
Gtf2a2
general transcription factor 2A subunit 2
Gtf2a2
general transcription factor2A subunit 2
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2016-05-04
Gtf2a2
general transcription factor2A subunit 2
Gtf2a2
general transcription factor IIA, 2
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2008-10-30
Gtf2a2
general transcription factor IIA, 2
Gtf2a2
general transcription factor IIa 2
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2004-12-14
Gtf2a2
general transcription factor Iia 2
general transcription factor IIa, 2 (12kD subunit)
Name updated
1299863
APPROVED
2002-08-07
Gtf2a2
general transcription factor IIa, 2 (12kD subunit)
Symbol and Name status set to provisional
70820
PROVISIONAL