Symbol:
Insl6
Name:
insulin-like 6
RGD ID:
62061
Description:
Predicted to enable hormone activity. Predicted to be involved in signal transduction. Predicted to act upstream of or within several processes, including flagellated sperm motility; male gonad development; and spermatid development. Predicted to be located in extracellular region. Orthologous to human INSL6 (insulin like 6); INTERACTS WITH 17beta-estradiol; ammonium chloride; bisphenol A.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
insulin-like peptide 6; insulin-like peptide INSL6
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
INSL6 (insulin like 6) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Insl6 (insulin-like 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Insl6 (insulin like 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
INSL6 (insulin like 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
INSL6 (insulin like 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Insl6 (insulin like 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
INSL6 (insulin like 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
INSL6 (insulin like 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Insl6 (insulin like 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Insl6 (insulin-like 6)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
INSL6 (insulin like 6)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
rflb
Alliance
DIOPT (Ensembl Compara|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 236,483,530 - 236,487,065 (-) NCBI GRCr8 mRatBN7.2 1 227,069,958 - 227,073,493 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 227,069,958 - 227,073,493 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 235,471,624 - 235,475,151 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 242,401,288 - 242,404,815 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 235,218,731 - 235,222,261 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 247,473,292 - 247,476,827 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 247,473,292 - 247,476,827 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 254,721,416 - 254,724,951 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 232,990,534 - 232,994,069 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 233,154,556 - 233,158,092 (-) NCBI Celera 1 224,221,875 - 224,225,410 (-) NCBI Celera Cytogenetic Map 1 q52 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Insl6 Rat (1->4)-beta-D-glucan multiple interactions ISO Insl6 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of INSL6 mRNA CTD PMID:36331819 Insl6 Rat 1,2-dimethylhydrazine decreases expression ISO Insl6 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of INSL6 mRNA CTD PMID:22206623 Insl6 Rat 1,2-dimethylhydrazine multiple interactions ISO Insl6 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of INSL6 mRNA CTD PMID:22206623 Insl6 Rat 17alpha-ethynylestradiol affects expression ISO Insl6 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of INSL6 mRNA CTD PMID:17555576 Insl6 Rat 17alpha-ethynylestradiol multiple interactions ISO Insl6 (Mus musculus) 6480464 [Ibuprofen co-treated with hydroxyibuprofen co-treated with Diclofenac co-treated with Ethinyl Estradiol] results in decreased expression of INSL6 mRNA CTD PMID:37844793 Insl6 Rat 17beta-estradiol multiple interactions EXP 6480464 [Testosterone co-treated with Estradiol] results in increased expression of INSL6 mRNA CTD PMID:32741896 Insl6 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Insl6 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin binds to AHR protein] which results in increased expression of INSL6 mRNA and [TIPARP gene mutant form results in increased susceptibility to Tetrachlorodibenzodioxin] which results in increased expression of INSL6 mRNA CTD PMID:16214954 and PMID:25975270 Insl6 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Insl6 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of INSL6 mRNA CTD PMID:18796159 more ... Insl6 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Insl6 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of INSL6 mRNA CTD PMID:20702594 more ... Insl6 Rat 2,3,7,8-Tetrachlorodibenzofuran affects expression ISO Insl6 (Mus musculus) 6480464 2 more ... CTD PMID:20702594 Insl6 Rat 3,3',4,4',5-pentachlorobiphenyl affects expression ISO Insl6 (Mus musculus) 6480464 3 more ... CTD PMID:20702594 Insl6 Rat 4-hydroxyphenyl retinamide decreases expression ISO Insl6 (Mus musculus) 6480464 Fenretinide results in decreased expression of INSL6 mRNA CTD PMID:28973697 Insl6 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of INSL6 mRNA CTD PMID:16483693 Insl6 Rat arsane affects methylation ISO INSL6 (Homo sapiens) 6480464 Arsenic affects the methylation of INSL6 gene CTD PMID:25304211 Insl6 Rat arsenic atom affects methylation ISO INSL6 (Homo sapiens) 6480464 Arsenic affects the methylation of INSL6 gene CTD PMID:25304211 Insl6 Rat arsenite(3-) decreases methylation ISO INSL6 (Homo sapiens) 6480464 arsenite results in decreased methylation of INSL6 promoter CTD PMID:23974009 Insl6 Rat arsenite(3-) increases expression ISO INSL6 (Homo sapiens) 6480464 arsenite results in increased expression of INSL6 mRNA CTD PMID:23974009 Insl6 Rat benzo[a]pyrene increases expression ISO Insl6 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of INSL6 mRNA CTD PMID:19770486 more ... Insl6 Rat benzo[a]pyrene decreases methylation ISO INSL6 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of INSL6 exon CTD PMID:27901495 Insl6 Rat benzo[a]pyrene increases methylation ISO INSL6 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of INSL6 promoter CTD PMID:27901495 Insl6 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Insl6 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of INSL6 mRNA CTD PMID:35550907 Insl6 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of INSL6 mRNA CTD PMID:25181051 Insl6 Rat bisphenol A increases expression ISO Insl6 (Mus musculus) 6480464 bisphenol A results in increased expression of INSL6 mRNA CTD PMID:32156529 and PMID:38074096 Insl6 Rat bisphenol A decreases methylation ISO INSL6 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of INSL6 gene CTD PMID:31601247 Insl6 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of INSL6 gene CTD PMID:28505145 Insl6 Rat carbon nanotube increases expression ISO Insl6 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Insl6 Rat CGP 52608 multiple interactions ISO INSL6 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to INSL6 gene] CTD PMID:28238834 Insl6 Rat chlorpyrifos increases expression ISO Insl6 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of INSL6 mRNA CTD PMID:37019170 Insl6 Rat choline multiple interactions ISO Insl6 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of INSL6 mRNA CTD PMID:20938992 Insl6 Rat chromium(6+) affects expression ISO Insl6 (Mus musculus) 6480464 chromium hexavalent ion affects the expression of INSL6 mRNA CTD PMID:28472532 Insl6 Rat decabromodiphenyl ether decreases expression EXP 6480464 decabromobiphenyl ether results in decreased expression of INSL6 mRNA CTD PMID:23640034 Insl6 Rat dibenzofurans increases expression ISO Insl6 (Mus musculus) 6480464 Dibenzofurans results in increased expression of INSL6 mRNA CTD PMID:34254344 Insl6 Rat diclofenac multiple interactions ISO Insl6 (Mus musculus) 6480464 [Ibuprofen co-treated with hydroxyibuprofen co-treated with Diclofenac co-treated with Ethinyl Estradiol] results in decreased expression of INSL6 mRNA CTD PMID:37844793 Insl6 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of INSL6 mRNA CTD PMID:29391264 Insl6 Rat folic acid multiple interactions ISO Insl6 (Mus musculus) 6480464 [1 more ... CTD PMID:20938992 and PMID:22206623 Insl6 Rat furan increases expression EXP 6480464 furan results in increased expression of INSL6 mRNA CTD PMID:25539665 Insl6 Rat ibuprofen multiple interactions ISO Insl6 (Mus musculus) 6480464 [Ibuprofen co-treated with hydroxyibuprofen co-treated with Diclofenac co-treated with Ethinyl Estradiol] results in decreased expression of INSL6 mRNA CTD PMID:37844793 Insl6 Rat L-methionine multiple interactions ISO Insl6 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of INSL6 mRNA CTD PMID:20938992 Insl6 Rat levonorgestrel multiple interactions ISO INSL6 (Homo sapiens) 6480464 [testosterone undecanoate co-treated with Levonorgestrel] results in increased expression of INSL6 mRNA CTD PMID:19074003 Insl6 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions ISO Insl6 (Mus musculus) 6480464 MYBPC3 protein affects the reaction [benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased expression of INSL6 mRNA] CTD PMID:25566086 Insl6 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal increases expression ISO Insl6 (Mus musculus) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased expression of INSL6 mRNA CTD PMID:25566086 Insl6 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Insl6 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of INSL6 mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in increased expression of INSL6 mRNA CTD PMID:36331819 Insl6 Rat pirinixic acid increases expression ISO Insl6 (Mus musculus) 6480464 pirinixic acid results in increased expression of INSL6 mRNA CTD PMID:20813756 and PMID:23811191 Insl6 Rat silicon dioxide increases expression ISO Insl6 (Mus musculus) 6480464 Silicon Dioxide results in increased expression of INSL6 mRNA CTD PMID:29341224 Insl6 Rat sulforaphane increases expression ISO Insl6 (Mus musculus) 6480464 sulforaphane results in increased expression of INSL6 mRNA CTD PMID:30529165 Insl6 Rat tamoxifen affects expression ISO Insl6 (Mus musculus) 6480464 Tamoxifen affects the expression of INSL6 mRNA CTD PMID:17555576 Insl6 Rat testosterone increases expression ISO Insl6 (Mus musculus) 6480464 Testosterone results in increased expression of INSL6 mRNA CTD PMID:19693291 Insl6 Rat testosterone multiple interactions EXP 6480464 [Testosterone co-treated with Estradiol] results in increased expression of INSL6 mRNA CTD PMID:32741896 Insl6 Rat testosterone undecanoate multiple interactions ISO INSL6 (Homo sapiens) 6480464 [testosterone undecanoate co-treated with Levonorgestrel] results in increased expression of INSL6 mRNA CTD PMID:19074003 Insl6 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of INSL6 mRNA CTD PMID:23411599 Insl6 Rat titanium dioxide increases expression ISO Insl6 (Mus musculus) 6480464 titanium dioxide results in increased expression of INSL6 mRNA CTD PMID:23557971 Insl6 Rat trichloroethene increases expression ISO Insl6 (Mus musculus) 6480464 Trichloroethylene results in increased expression of INSL6 mRNA CTD PMID:25549359 Insl6 Rat valproic acid increases expression ISO Insl6 (Mus musculus) 6480464 Valproic Acid results in increased expression of INSL6 mRNA CTD PMID:21427059 Insl6 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of INSL6 mRNA CTD PMID:23555832
(1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,3,7,8-Tetrachlorodibenzofuran (ISO) 3,3',4,4',5-pentachlorobiphenyl (ISO) 4-hydroxyphenyl retinamide (ISO) ammonium chloride (EXP) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) carbon nanotube (ISO) CGP 52608 (ISO) chlorpyrifos (ISO) choline (ISO) chromium(6+) (ISO) decabromodiphenyl ether (EXP) dibenzofurans (ISO) diclofenac (ISO) endosulfan (EXP) folic acid (ISO) furan (EXP) ibuprofen (ISO) L-methionine (ISO) levonorgestrel (ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) perfluorooctane-1-sulfonic acid (ISO) pirinixic acid (ISO) silicon dioxide (ISO) sulforaphane (ISO) tamoxifen (ISO) testosterone (EXP,ISO) testosterone undecanoate (ISO) thioacetamide (EXP) titanium dioxide (ISO) trichloroethene (ISO) valproic acid (ISO) vinclozolin (EXP)
Insl6 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 236,483,530 - 236,487,065 (-) NCBI GRCr8 mRatBN7.2 1 227,069,958 - 227,073,493 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 227,069,958 - 227,073,493 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 235,471,624 - 235,475,151 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 242,401,288 - 242,404,815 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 235,218,731 - 235,222,261 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 247,473,292 - 247,476,827 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 247,473,292 - 247,476,827 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 254,721,416 - 254,724,951 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 232,990,534 - 232,994,069 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 233,154,556 - 233,158,092 (-) NCBI Celera 1 224,221,875 - 224,225,410 (-) NCBI Celera Cytogenetic Map 1 q52 NCBI
INSL6 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 9 4,991,976 - 5,185,639 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 9 5,123,880 - 5,185,647 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 9 5,163,868 - 5,185,639 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 9 5,153,863 - 5,175,618 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 9 5,153,864 - 5,175,618 NCBI Celera 9 5,089,480 - 5,111,235 (-) NCBI Celera Cytogenetic Map 9 p24.1 NCBI HuRef 9 5,119,294 - 5,141,049 (-) NCBI HuRef CHM1_1 9 5,164,034 - 5,185,789 (-) NCBI CHM1_1 T2T-CHM13v2.0 9 4,992,955 - 5,190,714 (-) NCBI T2T-CHM13v2.0
Insl6 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 19 29,298,754 - 29,302,718 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 19 29,298,744 - 29,302,756 (-) Ensembl GRCm39 Ensembl GRCm38 19 29,321,354 - 29,325,318 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 19 29,321,344 - 29,325,356 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 19 29,395,844 - 29,399,808 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 19 29,387,351 - 29,391,315 (-) NCBI MGSCv36 mm8 Celera 19 30,097,916 - 30,101,880 (-) NCBI Celera Cytogenetic Map 19 C1 NCBI cM Map 19 23.82 NCBI
Insl6 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955434 9,349,142 - 9,355,739 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955434 9,349,033 - 9,355,817 (-) NCBI ChiLan1.0 ChiLan1.0
INSL6 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 11 119,362,748 - 119,434,904 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 9 119,368,695 - 119,390,561 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 9 5,007,158 - 5,029,056 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 9 5,192,023 - 5,213,827 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 9 5,192,023 - 5,213,827 (-) Ensembl panpan1.1 panPan2
INSL6 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 93,457,854 - 93,474,777 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 93,459,945 - 93,474,793 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 93,866,056 - 93,882,980 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 94,011,512 - 94,028,434 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 94,011,678 - 94,028,449 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 93,643,885 - 93,660,812 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 93,368,454 - 93,385,388 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 94,132,819 - 94,149,742 (-) NCBI UU_Cfam_GSD_1.0
Insl6
INSL6 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 216,792,787 - 216,823,479 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 216,792,785 - 216,820,197 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 242,534,691 - 242,561,841 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
INSL6 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 12 74,345,243 - 74,372,778 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 12 74,346,706 - 74,372,729 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 62,743,906 - 62,770,088 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Insl6
.
Predicted Target Of
Count of predictions: 28 Count of miRNA genes: 27 Interacting mature miRNAs: 27 Transcripts: ENSRNOT00000021298 Prediction methods: Microtar, Rnahybrid Result types: miRGate_prediction
8693637 Alc29 Alcohol consumption QTL 29 2.7 0.258 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 1 207987464 234238494 Rat 1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 1357335 Bw39 Body weight QTL 39 3.3 body mass (VT:0001259) body weight (CMO:0000012) 1 197814409 242814409 Rat 2302375 Bw83 Body weight QTL 83 4.87 0.0002 body mass (VT:0001259) body weight (CMO:0000012) 1 197697768 242697768 Rat 1354652 Kidm20 Kidney mass QTL 20 4.3 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 177227632 256448636 Rat 2293674 Bss39 Bone structure and strength QTL 39 7.1 0.0001 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 1 201554356 246554356 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 61455 Niddm7 Non-insulin dependent diabetes mellitus QTL 7 5.5 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 214537555 238757011 Rat 61327 Eae7 Experimental allergic encephalomyelitis QTL 7 5.6 body mass (VT:0001259) change in body weight (CMO:0002045) 1 216255568 260522016 Rat 1600392 Bw123 Body weight QTL 123 0.001 body mass (VT:0001259) body weight (CMO:0000012) 1 223201027 260522016 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 1578763 Kidm29 Kidney mass QTL 29 3.3 0.0001 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 1 179567751 260522016 Rat 1600395 Niddm69 Non-insulin dependent diabetes mellitus QTL 69 4.14 0.0002 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 195804352 257091168 Rat 1354624 Cm35 Cardiac mass QTL35 5.7 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 177227632 256448636 Rat 1600396 Niddm68 Non-insulin dependent diabetes mellitus QTL 68 4.97 0.0003 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 1600397 Edcs4 Endometrial carcinoma susceptibility QTL 4 2.2 uterus morphology trait (VT:0001120) percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759) 1 206081677 251081677 Rat 631838 Niddm36 Non-insulin dependent diabetes mellitus QTL 36 0.01 insulin secretion trait (VT:0003564) calculated pancreatic islet insulin release measurement (CMO:0001217) 1 184550676 229550676 Rat 8693661 Alc34 Alcohol consumption QTL 34 2.2 0.611 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 1 207987464 228627600 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 1600388 Niddm67 Non-insulin dependent diabetes mellitus QTL 67 5.84 0.000004 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 2293694 Bss38 Bone structure and strength QTL 38 7.05 0.0001 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 1 201554356 246554356 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 8655655 Arrd2 Age-related retinal degeneration QTL 2 7.79 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 183970203 243914901 Rat 734767 Niddm57 Non-insulin dependent diabetes mellitus QTL 57 body mass (VT:0001259) body weight (CMO:0000012) 1 224054293 260122809 Rat 1358898 Bp255 Blood pressure QTL 255 3.6 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 191019702 246062233 Rat 631215 Stl8 Serum triglyceride level QTL 8 9.27 0.0001 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 1 225126575 260522016 Rat 631843 Bw116 Body weight QTL 116 4.1 0.016 abdominal adipose amount (VT:1000220) abdominal fat pad weight (CMO:0000088) 1 224054293 260122809 Rat 2300175 Bmd40 Bone mineral density QTL 40 15.4 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 1 201554356 246554356 Rat 731175 Uae20 Urinary albumin excretion QTL 20 3.5 0.0018 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 221264111 259647894 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 724538 Kidm1 Kidney mass QTL 1 3.2 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 213707201 252085212 Rat 2293655 Bss36 Bone structure and strength QTL 36 10.66 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 201554356 246554356 Rat 1298084 Thym4 Thymus enlargement QTL 4 10.68 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 197814409 242814409 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 8552891 Epfw5 Epididymal fat weight QTL 5 4.4 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 1 193113876 238113876 Rat 734769 Niddm58 Non-insulin dependent diabetes mellitus QTL 58 body mass (VT:0001259) body weight (CMO:0000012) 1 224569538 260122809 Rat 734768 Niddm59 Non-insulin dependent diabetes mellitus QTL 59 body mass (VT:0001259) body weight (CMO:0000012) 1 213843987 258843987 Rat 1358890 Bp259 Blood pressure QTL 259 3.06 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 210702053 260522016 Rat 724533 Rf51 Renal function QTL 51 5.3 0.0002 kidney plasma flow trait (VT:0005524) renal plasma flow (CMO:0001914) 1 218753816 256448513 Rat 1354580 Scort1 Serum corticosterone level QTL 1 3.4 blood corticosterone amount (VT:0005345) blood corticosterone level (CMO:0001172) 1 156677124 256448636 Rat 1358292 Cm37 Cardiac mass QTL 37 6.2 8e-07 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 1 196248093 241248093 Rat 61376 Bp42 Blood pressure QTL 42 23.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 197814409 242814409 Rat 634313 Niddm43 Non-insulin dependent diabetes mellitus QTL 43 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 199050459 259647894 Rat 1549910 Bw54 Body weight QTL 54 0.05 body mass (VT:0001259) body weight (CMO:0000012) 1 214647894 259647894 Rat 70211 Niddm24 Non-insulin dependent diabetes mellitus QTL 24 3.79 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 214647894 259647894 Rat 1357399 Bw45 Body weight QTL 45 3.05 body mass (VT:0001259) body mass index (BMI) (CMO:0000105) 1 206329708 251329708 Rat 724552 Glom2 Glomerulus QTL 2 3.3 0.0001 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli directly contacting the kidney surface (CMO:0001001) 1 222363780 260522016 Rat 1357404 Bw42 Body weight QTL 42 4.49 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 1 206329708 251329708 Rat 10053715 Scort24 Serum corticosterone level QTL 24 2.13 0.0088 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 221414816 260522016 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 1358916 Kidm22 Kidney mass QTL 22 3.32 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 210702053 240947965 Rat 2312564 Glom18 Glomerulus QTL 18 2.4 0.003 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 1 185356336 231689108 Rat 634321 Hc1 Hypercalciuria QTL 1 2.91 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 178810256 240830002 Rat 61400 Niddm1 Non-insulin dependent diabetes mellitus QTL 1 11 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 218753689 245907899 Rat 10059587 Bw173 Body weight QTL 173 3.23 0.025 body mass (VT:0001259) body weight (CMO:0000012) 1 202069611 247069611 Rat 2292216 Bw80 Body weight QTL 80 3.23 0.0019 body mass (VT:0001259) body weight (CMO:0000012) 1 213533809 243914901 Rat 1300168 Bp170 Blood pressure QTL 170 2.76 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 207702246 228581766 Rat 2292220 Bp306 Blood pressure QTL 306 3.47 0.00087 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 243914901 Rat 10059590 Kidm44 Kidney mass QTL 44 3.42 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 191033875 236033875 Rat 1641926 Teswt2 Testicular weight QTL 2 2.82 testis mass (VT:1000644) both testes wet weight (CMO:0000175) 1 197697768 238755659 Rat 631658 Cm7 Cardiac mass QTL 7 5.32 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 1 196248093 241248093 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 2293700 Bmd27 Bone mineral density QTL 27 6.6 0.0001 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 1 224054293 243747962 Rat 2293701 Bmd34 Bone mineral density QTL 34 8.3 0.0001 femur strength trait (VT:0010010) femoral neck ultimate force (CMO:0001703) 1 224054293 243747962 Rat 7387289 Uae45 Urinary albumin excretion QTL 45 2.86 0.0021 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 223262787 260522016 Rat 8655855 Arrd3 Age-related retinal degeneration QTL 3 3.07 lens clarity trait (VT:0001304) cataract incidence/prevalence measurement (CMO:0001585) 1 183970203 243914901 Rat 1600374 Mcs17 Mammary carcinoma susceptibility QTL 17 3 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 1 197670404 242670404 Rat 6480786 Bw97 Body weight QTL 97 5.03 body mass (VT:0001259) body weight (CMO:0000012) 1 225126575 227604520 Rat 1600363 Hc6 Hypercalciuria QTL 6 2.7 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 203995416 244113296 Rat 8693618 Alc25 Alcohol consumption QTL 25 3 0.28 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 1 207987464 228627600 Rat 738032 Hcas5 Hepatocarcinoma susceptibility QTL 5 3.12 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 176426412 257976495 Rat 1358191 Ept10 Estrogen-induced pituitary tumorigenesis QTL 10 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 192825253 243914732 Rat 2302040 Pia35 Pristane induced arthritis QTL 35 3.8 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 1 216255568 260522016 Rat 7394701 Uae46 Urinary albumin excretion QTL 46 3.6 0.0056 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 201554356 246554356 Rat 1598821 Rf55 Renal function QTL 55 6.3 renal blood flow trait (VT:2000006) ratio of change in renal blood flow to change in renal perfusion pressure (CMO:0001239) 1 218748008 257976495 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
8
8
13
69
46
47
25
25
25
6
117
51
57
26
53
22
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000021298 ⟹ ENSRNOP00000021298
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 227,069,958 - 227,073,493 (-) Ensembl Rnor_6.0 Ensembl 1 247,473,292 - 247,476,827 (-) Ensembl
RefSeq Acc Id:
NM_022583 ⟹ NP_072105
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 236,483,530 - 236,487,065 (-) NCBI mRatBN7.2 1 227,069,958 - 227,073,493 (-) NCBI Rnor_6.0 1 247,473,292 - 247,476,827 (-) NCBI Rnor_5.0 1 254,721,416 - 254,724,951 (-) NCBI RGSC_v3.4 1 232,990,534 - 232,994,069 (-) RGD Celera 1 224,221,875 - 224,225,410 (-) RGD
Sequence:
GGGCGTGGTGCGTGTAGAAGGCGGGGCGGGGCGGGGGCGGGGCGACGGCCGTTGCAGCGCGCCGGGCCCTATAGTGGAGCCCAGGGATGAAGCAGCTGTGCTGTTCTTGTCTGTTGTGGCTTGGACTC
hide sequence
RefSeq Acc Id:
NP_072105 ⟸ NM_022583
- Peptide Label:
precursor
- UniProtKB:
Q9WV41 (UniProtKB/Swiss-Prot), A6I0V7 (UniProtKB/TrEMBL)
- Sequence:
MKQLCCSCLLWLGLLLAPFSQEQEEVTSPTKLCGRDLLVEVIKLCGQNDWSRFSMEEQSPMTELVPQYTRKVKTFNPHRSSSSWGRFTNPGVSQKKATHTWESQSLPNYQLKKEELLPKTGVHSYHGG
hide sequence
Ensembl Acc Id:
ENSRNOP00000021298 ⟸ ENSRNOT00000021298
RGD ID: 13690844 Promoter ID: EPDNEW_R1369 Type: multiple initiation site Name: Insl6_1 Description: insulin-like 6 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 247,476,781 - 247,476,841 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-06-10
Insl6
insulin-like 6
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_domains
has an insulin family B-chain cysteine motif
61639
gene_expression
expressed in the seminiferous tubules in spermatocytes and round spermatids in the testis
61639
gene_product
member of the insulin family
61639
gene_protein
encodes a 188 amino acid protein
61639
gene_protein
has dibasic sequence at the junction of the C-peptide and A-chain suggesting the requirement of multiple prohormone convertases to form a mature hormone
61639
